Query psy9314
Match_columns 634
No_of_seqs 87 out of 89
Neff 3.2
Searched_HMMs 46136
Date Sat Aug 17 00:12:34 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy9314.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9314hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF13060 DUF3921: Protein of u 3.2 4.2E+02 0.0091 22.4 0.0 12 615-626 46-57 (58)
2 KOG4552|consensus 2.6 6.2E+02 0.013 26.9 0.5 17 615-632 127-143 (272)
3 PF10357 Kin17_mid: Domain of 2.3 7E+02 0.015 24.1 0.4 29 493-522 44-72 (127)
4 PF11402 Antifungal_prot: Anti 1.6 8.8E+02 0.019 20.6 -0.2 15 217-231 21-35 (53)
5 PF08561 Ribosomal_L37: Mitoch 1.4 1.1E+03 0.023 21.0 -0.0 14 2-15 18-31 (85)
6 COG4423 Uncharacterized protei 1.4 1.5E+03 0.032 20.7 0.8 33 1-33 1-33 (81)
7 KOG0527|consensus 1.2 9.2E+02 0.02 26.6 -1.0 8 625-632 84-91 (331)
8 COG2209 NqrE Na+-transporting 1.1 1.7E+03 0.038 22.8 0.4 19 174-192 24-42 (198)
9 PF15286 Bcl-2_3: Apoptosis re 1.0 1.6E+03 0.034 21.8 -0.1 13 18-30 23-35 (126)
10 PRK14621 hypothetical protein; 1.0 2.4E+03 0.053 19.8 1.1 30 19-48 57-86 (111)
No 1
>PF13060 DUF3921: Protein of unknown function (DUF3921)
Probab=3.17 E-value=4.2e+02 Score=22.37 Aligned_cols=12 Identities=50% Similarity=0.714 Sum_probs=7.0
Q ss_pred ccchhhhhcccc
Q psy9314 615 SSEVLIDHSYQN 626 (634)
Q Consensus 615 s~e~l~~~~~~~ 626 (634)
|-|+||||.|..
T Consensus 46 s~et~idkrylk 57 (58)
T PF13060_consen 46 SHETLIDKRYLK 57 (58)
T ss_pred hHHHHHHHHHhc
Confidence 456666666643
No 2
>KOG4552|consensus
Probab=2.62 E-value=6.2e+02 Score=26.93 Aligned_cols=17 Identities=59% Similarity=0.542 Sum_probs=12.7
Q ss_pred ccchhhhhcccccccccC
Q psy9314 615 SSEVLIDHSYQNSKMHNA 632 (634)
Q Consensus 615 s~e~l~~~~~~~~~~~~~ 632 (634)
|+|-||..+|+-|+ |||
T Consensus 127 sSEelIKyAHrIS~-~Na 143 (272)
T KOG4552|consen 127 SSEELIKYAHRISK-HNA 143 (272)
T ss_pred CHHHHHHHHHHhhh-ccc
Confidence 66778888888776 554
No 3
>PF10357 Kin17_mid: Domain of Kin17 curved DNA-binding protein; InterPro: IPR019447 This entry represents the conserved central 169 residue region of the Kin17 DNA/RNA-binding proteins. The N-terminal region of Kin17 contains a zinc-finger domain, while in the human and mouse proteins there is a RecA-like domain found in the C-terminal region. In humans, Kin17 protein forms intra-nuclear foci during cell proliferation and is re-distributed in the nucleoplasm during the cell cycle []. ; PDB: 2V1N_A.
Probab=2.28 E-value=7e+02 Score=24.14 Aligned_cols=29 Identities=17% Similarity=0.184 Sum_probs=14.5
Q ss_pred hhhhhcccccccccchhccccccchhhhcc
Q psy9314 493 SSEVLAEKDVVQSSEVLAEKDVVQSSEVLS 522 (634)
Q Consensus 493 s~E~l~~K~~v~sae~l~~kd~vq~aE~L~ 522 (634)
=+|||.||.||+=+-+.= ...-.|.-||-
T Consensus 44 YnEyI~Dk~HvHMNaT~W-~sLT~FvkyLg 72 (127)
T PF10357_consen 44 YNEYIQDKDHVHMNATRW-TSLTEFVKYLG 72 (127)
T ss_dssp HHHHTTSS----GGGSS--SSHHHHHHHHT
T ss_pred HHHHhcCccceeeccccc-chHHHHHHHHh
Confidence 368999999998654322 12245667773
No 4
>PF11402 Antifungal_prot: Antifungal protein; InterPro: IPR022706 Antifungal protein consists of five antiparallel beta strands which are highly twisted creating a beta barrel stabilised by four internal disulphide bridges []. A cationic site adjacent to a hydrophobic stretch on the protein surface may constitute a phospholipid binding site []. ; PDB: 1AFP_A 2KCN_A.
Probab=1.59 E-value=8.8e+02 Score=20.61 Aligned_cols=15 Identities=27% Similarity=0.326 Sum_probs=10.9
Q ss_pred ccccccchhhhhhhc
Q psy9314 217 EKDEVQNSEVLAEKN 231 (634)
Q Consensus 217 ~~~~iq~se~~~~k~ 231 (634)
-+..|++|+.|+|++
T Consensus 21 GK~~i~kCp~a~Nkk 35 (53)
T PF11402_consen 21 GKDHIVKCPSAANKK 35 (53)
T ss_dssp TEEEEEE-SSTTTS-
T ss_pred CceeEEeCcchhccc
Confidence 367899999999887
No 5
>PF08561 Ribosomal_L37: Mitochondrial ribosomal protein L37; InterPro: IPR013870 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry includes yeast MRPL37 a mitochondrial ribosomal protein [].
Probab=1.41 E-value=1.1e+03 Score=21.03 Aligned_cols=14 Identities=36% Similarity=0.536 Sum_probs=8.8
Q ss_pred cccccchhhhhhhh
Q psy9314 2 SIYKQGDEVLAEKD 15 (634)
Q Consensus 2 ~~~~~~~dvla~~d 15 (634)
.|||.|.|+.+.-|
T Consensus 18 Ni~K~g~DP~al~D 31 (85)
T PF08561_consen 18 NILKDGKDPVALPD 31 (85)
T ss_pred eeecCCCCCccCCc
Confidence 46777777666544
No 6
>COG4423 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=1.40 E-value=1.5e+03 Score=20.71 Aligned_cols=33 Identities=21% Similarity=0.167 Sum_probs=22.4
Q ss_pred Ccccccchhhhhhhhhhhcccccccchhhhhhh
Q psy9314 1 MSIYKQGDEVLAEKDEVQSSEVLSEKDEVQSSE 33 (634)
Q Consensus 1 ~~~~~~~~dvla~~dalvdad~la~~dalv~a~ 33 (634)
|.+|-..+.|-+++-.|..=--.+.+||+++|-
T Consensus 1 MALnIKDp~~d~lar~LA~rtg~S~t~AV~~Al 33 (81)
T COG4423 1 MALNIKDPEVDRLARELAARTGESKTDAVRDAL 33 (81)
T ss_pred CCCccCChHHHHHHHHHHHHhCCcHHHHHHHHH
Confidence 777777787777777776555556666666654
No 7
>KOG0527|consensus
Probab=1.24 E-value=9.2e+02 Score=26.60 Aligned_cols=8 Identities=75% Similarity=1.053 Sum_probs=3.6
Q ss_pred cccccccC
Q psy9314 625 QNSKMHNA 632 (634)
Q Consensus 625 ~~~~~~~~ 632 (634)
+|-||||+
T Consensus 84 qnP~mHNS 91 (331)
T KOG0527|consen 84 QNPKMHNS 91 (331)
T ss_pred hCcchhhH
Confidence 34444444
No 8
>COG2209 NqrE Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE [Energy production and conversion]
Probab=1.06 E-value=1.7e+03 Score=22.81 Aligned_cols=19 Identities=21% Similarity=0.141 Sum_probs=12.9
Q ss_pred chhhhhhcccccccccccc
Q psy9314 174 QSSEVLAEENEVQSSEVLA 192 (634)
Q Consensus 174 qs~e~l~~~~~~~t~~~~~ 192 (634)
--|.||+-+|+++|+-||-
T Consensus 24 GMCtflA~Skkvsta~GLG 42 (198)
T COG2209 24 GMCTFLAVSKKVSTAFGLG 42 (198)
T ss_pred HHHHHHhhhhhhccccCcc
Confidence 3477777777777776653
No 9
>PF15286 Bcl-2_3: Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like; PDB: 3BL2_B 3DVU_B 2ABO_A.
Probab=0.99 E-value=1.6e+03 Score=21.81 Aligned_cols=13 Identities=23% Similarity=0.330 Sum_probs=8.8
Q ss_pred hcccccccchhhh
Q psy9314 18 QSSEVLSEKDEVQ 30 (634)
Q Consensus 18 vdad~la~~dalv 30 (634)
||+++|+|||.+.
T Consensus 23 v~s~vL~DV~~i~ 35 (126)
T PF15286_consen 23 VDSGVLADVSKII 35 (126)
T ss_dssp TCCCHHHHHHHHH
T ss_pred cchhHHHhHHHHH
Confidence 6777777777653
No 10
>PRK14621 hypothetical protein; Provisional
Probab=0.97 E-value=2.4e+03 Score=19.82 Aligned_cols=30 Identities=30% Similarity=0.395 Sum_probs=18.7
Q ss_pred cccccccchhhhhhhhhhhhhhhhhhhhhh
Q psy9314 19 SSEVLSEKDEVQSSEVSAKKEAIQSSEVLA 48 (634)
Q Consensus 19 dad~la~~dalv~a~vla~~ealvda~~la 48 (634)
|.++|.+.+.|.|--+.|-++|+..++-++
T Consensus 57 dp~lldD~e~LeDLI~aA~NdA~~ka~~~~ 86 (111)
T PRK14621 57 DPEIMDDVEMVQDLVVAAVNSALEESAKLA 86 (111)
T ss_pred CHHHcCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence 444444666677776777777776666544
Done!