Query         psy9314
Match_columns 634
No_of_seqs    87 out of 89
Neff          3.2 
Searched_HMMs 46136
Date          Sat Aug 17 00:12:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9314.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9314hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13060 DUF3921:  Protein of u   3.2 4.2E+02  0.0091   22.4   0.0   12  615-626    46-57  (58)
  2 KOG4552|consensus                2.6 6.2E+02   0.013   26.9   0.5   17  615-632   127-143 (272)
  3 PF10357 Kin17_mid:  Domain of    2.3   7E+02   0.015   24.1   0.4   29  493-522    44-72  (127)
  4 PF11402 Antifungal_prot:  Anti   1.6 8.8E+02   0.019   20.6  -0.2   15  217-231    21-35  (53)
  5 PF08561 Ribosomal_L37:  Mitoch   1.4 1.1E+03   0.023   21.0  -0.0   14    2-15     18-31  (85)
  6 COG4423 Uncharacterized protei   1.4 1.5E+03   0.032   20.7   0.8   33    1-33      1-33  (81)
  7 KOG0527|consensus                1.2 9.2E+02    0.02   26.6  -1.0    8  625-632    84-91  (331)
  8 COG2209 NqrE Na+-transporting    1.1 1.7E+03   0.038   22.8   0.4   19  174-192    24-42  (198)
  9 PF15286 Bcl-2_3:  Apoptosis re   1.0 1.6E+03   0.034   21.8  -0.1   13   18-30     23-35  (126)
 10 PRK14621 hypothetical protein;   1.0 2.4E+03   0.053   19.8   1.1   30   19-48     57-86  (111)

No 1  
>PF13060 DUF3921:  Protein of unknown function (DUF3921)
Probab=3.17  E-value=4.2e+02  Score=22.37  Aligned_cols=12  Identities=50%  Similarity=0.714  Sum_probs=7.0

Q ss_pred             ccchhhhhcccc
Q psy9314         615 SSEVLIDHSYQN  626 (634)
Q Consensus       615 s~e~l~~~~~~~  626 (634)
                      |-|+||||.|..
T Consensus        46 s~et~idkrylk   57 (58)
T PF13060_consen   46 SHETLIDKRYLK   57 (58)
T ss_pred             hHHHHHHHHHhc
Confidence            456666666643


No 2  
>KOG4552|consensus
Probab=2.62  E-value=6.2e+02  Score=26.93  Aligned_cols=17  Identities=59%  Similarity=0.542  Sum_probs=12.7

Q ss_pred             ccchhhhhcccccccccC
Q psy9314         615 SSEVLIDHSYQNSKMHNA  632 (634)
Q Consensus       615 s~e~l~~~~~~~~~~~~~  632 (634)
                      |+|-||..+|+-|+ |||
T Consensus       127 sSEelIKyAHrIS~-~Na  143 (272)
T KOG4552|consen  127 SSEELIKYAHRISK-HNA  143 (272)
T ss_pred             CHHHHHHHHHHhhh-ccc
Confidence            66778888888776 554


No 3  
>PF10357 Kin17_mid:  Domain of Kin17 curved DNA-binding protein;  InterPro: IPR019447  This entry represents the conserved central 169 residue region of the Kin17 DNA/RNA-binding proteins. The N-terminal region of Kin17 contains a zinc-finger domain, while in the human and mouse proteins there is a RecA-like domain found in the C-terminal region. In humans, Kin17 protein forms intra-nuclear foci during cell proliferation and is re-distributed in the nucleoplasm during the cell cycle []. ; PDB: 2V1N_A.
Probab=2.28  E-value=7e+02  Score=24.14  Aligned_cols=29  Identities=17%  Similarity=0.184  Sum_probs=14.5

Q ss_pred             hhhhhcccccccccchhccccccchhhhcc
Q psy9314         493 SSEVLAEKDVVQSSEVLAEKDVVQSSEVLS  522 (634)
Q Consensus       493 s~E~l~~K~~v~sae~l~~kd~vq~aE~L~  522 (634)
                      =+|||.||.||+=+-+.= ...-.|.-||-
T Consensus        44 YnEyI~Dk~HvHMNaT~W-~sLT~FvkyLg   72 (127)
T PF10357_consen   44 YNEYIQDKDHVHMNATRW-TSLTEFVKYLG   72 (127)
T ss_dssp             HHHHTTSS----GGGSS--SSHHHHHHHHT
T ss_pred             HHHHhcCccceeeccccc-chHHHHHHHHh
Confidence            368999999998654322 12245667773


No 4  
>PF11402 Antifungal_prot:  Antifungal protein;  InterPro: IPR022706  Antifungal protein consists of five antiparallel beta strands which are highly twisted creating a beta barrel stabilised by four internal disulphide bridges []. A cationic site adjacent to a hydrophobic stretch on the protein surface may constitute a phospholipid binding site []. ; PDB: 1AFP_A 2KCN_A.
Probab=1.59  E-value=8.8e+02  Score=20.61  Aligned_cols=15  Identities=27%  Similarity=0.326  Sum_probs=10.9

Q ss_pred             ccccccchhhhhhhc
Q psy9314         217 EKDEVQNSEVLAEKN  231 (634)
Q Consensus       217 ~~~~iq~se~~~~k~  231 (634)
                      -+..|++|+.|+|++
T Consensus        21 GK~~i~kCp~a~Nkk   35 (53)
T PF11402_consen   21 GKDHIVKCPSAANKK   35 (53)
T ss_dssp             TEEEEEE-SSTTTS-
T ss_pred             CceeEEeCcchhccc
Confidence            367899999999887


No 5  
>PF08561 Ribosomal_L37:  Mitochondrial ribosomal protein L37;  InterPro: IPR013870 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry includes yeast MRPL37 a mitochondrial ribosomal protein []. 
Probab=1.41  E-value=1.1e+03  Score=21.03  Aligned_cols=14  Identities=36%  Similarity=0.536  Sum_probs=8.8

Q ss_pred             cccccchhhhhhhh
Q psy9314           2 SIYKQGDEVLAEKD   15 (634)
Q Consensus         2 ~~~~~~~dvla~~d   15 (634)
                      .|||.|.|+.+.-|
T Consensus        18 Ni~K~g~DP~al~D   31 (85)
T PF08561_consen   18 NILKDGKDPVALPD   31 (85)
T ss_pred             eeecCCCCCccCCc
Confidence            46777777666544


No 6  
>COG4423 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=1.40  E-value=1.5e+03  Score=20.71  Aligned_cols=33  Identities=21%  Similarity=0.167  Sum_probs=22.4

Q ss_pred             Ccccccchhhhhhhhhhhcccccccchhhhhhh
Q psy9314           1 MSIYKQGDEVLAEKDEVQSSEVLSEKDEVQSSE   33 (634)
Q Consensus         1 ~~~~~~~~dvla~~dalvdad~la~~dalv~a~   33 (634)
                      |.+|-..+.|-+++-.|..=--.+.+||+++|-
T Consensus         1 MALnIKDp~~d~lar~LA~rtg~S~t~AV~~Al   33 (81)
T COG4423           1 MALNIKDPEVDRLARELAARTGESKTDAVRDAL   33 (81)
T ss_pred             CCCccCChHHHHHHHHHHHHhCCcHHHHHHHHH
Confidence            777777787777777776555556666666654


No 7  
>KOG0527|consensus
Probab=1.24  E-value=9.2e+02  Score=26.60  Aligned_cols=8  Identities=75%  Similarity=1.053  Sum_probs=3.6

Q ss_pred             cccccccC
Q psy9314         625 QNSKMHNA  632 (634)
Q Consensus       625 ~~~~~~~~  632 (634)
                      +|-||||+
T Consensus        84 qnP~mHNS   91 (331)
T KOG0527|consen   84 QNPKMHNS   91 (331)
T ss_pred             hCcchhhH
Confidence            34444444


No 8  
>COG2209 NqrE Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE [Energy production and conversion]
Probab=1.06  E-value=1.7e+03  Score=22.81  Aligned_cols=19  Identities=21%  Similarity=0.141  Sum_probs=12.9

Q ss_pred             chhhhhhcccccccccccc
Q psy9314         174 QSSEVLAEENEVQSSEVLA  192 (634)
Q Consensus       174 qs~e~l~~~~~~~t~~~~~  192 (634)
                      --|.||+-+|+++|+-||-
T Consensus        24 GMCtflA~Skkvsta~GLG   42 (198)
T COG2209          24 GMCTFLAVSKKVSTAFGLG   42 (198)
T ss_pred             HHHHHHhhhhhhccccCcc
Confidence            3477777777777776653


No 9  
>PF15286 Bcl-2_3:  Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like; PDB: 3BL2_B 3DVU_B 2ABO_A.
Probab=0.99  E-value=1.6e+03  Score=21.81  Aligned_cols=13  Identities=23%  Similarity=0.330  Sum_probs=8.8

Q ss_pred             hcccccccchhhh
Q psy9314          18 QSSEVLSEKDEVQ   30 (634)
Q Consensus        18 vdad~la~~dalv   30 (634)
                      ||+++|+|||.+.
T Consensus        23 v~s~vL~DV~~i~   35 (126)
T PF15286_consen   23 VDSGVLADVSKII   35 (126)
T ss_dssp             TCCCHHHHHHHHH
T ss_pred             cchhHHHhHHHHH
Confidence            6777777777653


No 10 
>PRK14621 hypothetical protein; Provisional
Probab=0.97  E-value=2.4e+03  Score=19.82  Aligned_cols=30  Identities=30%  Similarity=0.395  Sum_probs=18.7

Q ss_pred             cccccccchhhhhhhhhhhhhhhhhhhhhh
Q psy9314          19 SSEVLSEKDEVQSSEVSAKKEAIQSSEVLA   48 (634)
Q Consensus        19 dad~la~~dalv~a~vla~~ealvda~~la   48 (634)
                      |.++|.+.+.|.|--+.|-++|+..++-++
T Consensus        57 dp~lldD~e~LeDLI~aA~NdA~~ka~~~~   86 (111)
T PRK14621         57 DPEIMDDVEMVQDLVVAAVNSALEESAKLA   86 (111)
T ss_pred             CHHHcCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444444666677776777777776666544


Done!