Diaphorina citri psyllid: psy9318


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MKILVKEPSNIFVSHDLKSVQVGDFGLACCLLPHSPHQEGHSVIPVPPRSDHPLGTRLYAAPEQLHGLCDPKSDVYSLVICDKLHELRLLGKSYKLEELQYLRELFSPIRQDIGIVLFEMLINFSTDMEKSKEITKLKMGHMPPRISSKYPHFAKIISKLLDVNPKHRPSASQILLYLDERKRLSSEDDKDGIIDELKLDLAKKNEEIEKLHSIIQQLKQNAS
ccccccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MKILVKEPSNIFVSHDLKSVQVGDFGLACCLLP*****************DHPLGTRLYAAPEQLHGLCDPKSDVYSLVICDKLHELRLLGKSYKLEELQYLRELFSPIRQDIGIVLFEMLINFSTDMEKSKEITKLKMGHMPPRISSKYPHFAKIISKLLDVNPKHRPSASQILLYLDER******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKILVKEPSNIFVSHDLKSVQVGDFGLACCLLPHSPHQEGHSVIPVPPRSDHPLGTRLYAAPEQLHGLCDPKSDVYSLVICDKLHELRLLGKSYKLEELQYLRELFSPIRQDIGIVLFEMLINFSTDMEKSKEITKLKMGHMPPRISSKYPHFAKIISKLLDVNPKHRPSASQILLYLDERKRLSSEDDKDGIxxxxxxxxxxxxxxxxxxxxxxxxxxxxAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZY4, chain A
Confidence level:very confident
Coverage over the Query: 1-33,57-78,114-180
View the alignment between query and template
View the model in PyMOL
Template: 3LIJ, chain A
Confidence level:very confident
Coverage over the Query: 1-36,50-78,114-223
View the alignment between query and template
View the model in PyMOL
Template: 3GNI, chain B
Confidence level:very confident
Coverage over the Query: 1-93,116-123,149-179
View the alignment between query and template
View the model in PyMOL