Query         psy9320
Match_columns 183
No_of_seqs    29 out of 31
Neff          2.3 
Searched_HMMs 46136
Date          Sat Aug 17 00:22:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9320.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9320hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14084 DUF4264:  Protein of u  26.5      34 0.00073   24.2   1.0   29  144-172     2-30  (52)
  2 PF14293 YWFCY:  YWFCY protein   19.5      28  0.0006   25.4  -0.6   24  153-181     1-24  (61)
  3 PF01552 Pico_P2B:  Picornaviru  15.3   1E+02  0.0022   24.0   1.6   19  161-179    34-52  (99)
  4 PF14265 DUF4355:  Domain of un  10.8      89  0.0019   23.3   0.1   28  147-174    92-119 (125)
  5 COG3092 Uncharacterized protei   8.0 2.3E+02  0.0049   23.9   1.4   22  154-175   123-144 (149)
  6 smart00526 H15 Domain in histo   7.4 2.9E+02  0.0064   18.5   1.6   22  157-178    40-61  (66)
  7 PF00538 Linker_histone:  linke   6.0 5.5E+02   0.012   17.8   2.3   21  159-179    42-62  (77)
  8 PF07140 IFNGR1:  Interferon ga   5.5 2.9E+02  0.0063   22.4   0.8   22  153-174    88-109 (134)
  9 PF07120 DUF1376:  Protein of u   5.2 1.7E+02  0.0037   21.1  -0.6   29  155-183    40-68  (88)
 10 KOG2825|consensus                4.7 4.9E+02   0.011   24.4   1.8   33  144-176   143-177 (323)

No 1  
>PF14084 DUF4264:  Protein of unknown function (DUF4264)
Probab=26.48  E-value=34  Score=24.21  Aligned_cols=29  Identities=28%  Similarity=0.470  Sum_probs=21.9

Q ss_pred             cceeeccccccccccccchHHHHHHHHHH
Q psy9320         144 SEVLAEKDENKGENVKNLPNFVNKSLKKM  172 (183)
Q Consensus       144 ~E~IAeade~t~~dVq~~a~~~~~~~~~~  172 (183)
                      .+.||-..=+...|.-.+-||+||+||.-
T Consensus         2 leliat~~~~~~~dlYKvVDfLNktLK~~   30 (52)
T PF14084_consen    2 LELIATKEFEYNDDLYKVVDFLNKTLKDK   30 (52)
T ss_pred             eEEEEEEEecCCccHHHHHHHHhhhhhhc
Confidence            45666666666677778889999999864


No 2  
>PF14293 YWFCY:  YWFCY protein
Probab=19.52  E-value=28  Score=25.37  Aligned_cols=24  Identities=21%  Similarity=0.569  Sum_probs=16.8

Q ss_pred             ccccccccchHHHHHHHHHHHhhheeeec
Q psy9320         153 NKGENVKNLPNFVNKSLKKMVKIISIVLL  181 (183)
Q Consensus       153 ~t~~dVq~~a~~~~~~~~~~~~~~~~~~~  181 (183)
                      |++.|.|-++.+++     |.+.|||.+|
T Consensus         1 Q~eddlr~L~KImd-----f~R~iSI~~l   24 (61)
T PF14293_consen    1 QTEDDLRALRKIMD-----FMRAISILFL   24 (61)
T ss_pred             CCcHHHHHHHHHHH-----HHHHHHHHHH
Confidence            67788888877664     5666777654


No 3  
>PF01552 Pico_P2B:  Picornavirus 2B protein;  InterPro: IPR002527 Poliovirus infection leads to drastic alterations in membrane permeability late during infection. Proteins 2B and 2BC enhance membrane permeability [, ].; GO: 0000166 nucleotide binding, 0003968 RNA-directed RNA polymerase activity, 0005198 structural molecule activity, 0008233 peptidase activity, 0008234 cysteine-type peptidase activity, 0016740 transferase activity, 0016779 nucleotidyltransferase activity, 0016787 hydrolase activity, 0018144 RNA-protein covalent cross-linking, 0019012 virion
Probab=15.35  E-value=1e+02  Score=24.04  Aligned_cols=19  Identities=42%  Similarity=0.459  Sum_probs=15.2

Q ss_pred             chHHHHHHHHHHHhhheee
Q psy9320         161 LPNFVNKSLKKMVKIISIV  179 (183)
Q Consensus       161 ~a~~~~~~~~~~~~~~~~~  179 (183)
                      ...++.|.||.++||||-+
T Consensus        34 ~~~~~~kilK~LvKiIsAl   52 (99)
T PF01552_consen   34 QDKITEKILKWLVKIISAL   52 (99)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            3457789999999999854


No 4  
>PF14265 DUF4355:  Domain of unknown function (DUF4355)
Probab=10.82  E-value=89  Score=23.28  Aligned_cols=28  Identities=32%  Similarity=0.547  Sum_probs=23.1

Q ss_pred             eeccccccccccccchHHHHHHHHHHHh
Q psy9320         147 LAEKDENKGENVKNLPNFVNKSLKKMVK  174 (183)
Q Consensus       147 IAeade~t~~dVq~~a~~~~~~~~~~~~  174 (183)
                      +....+.+..+|+.|.+++|+.+..-|+
T Consensus        92 ~g~d~e~~~~~v~~l~~~~~~~v~~~v~  119 (125)
T PF14265_consen   92 VGDDEEETKANVKALKKLFNKAVQEKVK  119 (125)
T ss_pred             hCCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4566778999999999999998877664


No 5  
>COG3092 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=8.01  E-value=2.3e+02  Score=23.89  Aligned_cols=22  Identities=14%  Similarity=0.341  Sum_probs=18.8

Q ss_pred             cccccccchHHHHHHHHHHHhh
Q psy9320         154 KGENVKNLPNFVNKSLKKMVKI  175 (183)
Q Consensus       154 t~~dVq~~a~~~~~~~~~~~~~  175 (183)
                      .|-+.|++|+++||..|++-|-
T Consensus       123 ~kP~Yq~LAdvLkrAf~qLdkt  144 (149)
T COG3092         123 EKPTYQALADVLKRAFKQLDKT  144 (149)
T ss_pred             CCCcHHHHHHHHHHHHHHHHHH
Confidence            3478999999999999998764


No 6  
>smart00526 H15 Domain in histone families 1 and 5.
Probab=7.45  E-value=2.9e+02  Score=18.48  Aligned_cols=22  Identities=23%  Similarity=0.277  Sum_probs=16.4

Q ss_pred             ccccchHHHHHHHHHHHhhhee
Q psy9320         157 NVKNLPNFVNKSLKKMVKIISI  178 (183)
Q Consensus       157 dVq~~a~~~~~~~~~~~~~~~~  178 (183)
                      +..+|...++..|+++|.--.+
T Consensus        40 ~~~~~~~~l~~~Lk~~v~~G~l   61 (66)
T smart00526       40 LPNNFRSLLKLALKKLVASGKL   61 (66)
T ss_pred             ChHHHHHHHHHHHHHHHhcCce
Confidence            4467888999999999864433


No 7  
>PF00538 Linker_histone:  linker histone H1 and H5 family;  InterPro: IPR005818 Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication). Eukaryotic DNA wraps around a histone octamer to form a nucleosome, the first order of compaction of eukaryotic chromatin. The core histone octamer is composed of a central H3-H4 tetramer and two flanking H2A-H2B dimers. Each of the core histone contains a common structural motif, called the histone fold, which facilitates the interactions between the individual core histones. In addition to the core histones, there is a "linker histone" called H1 (or H5 in avian species). The linker histones present in all multicellular eukaryotes are the most divergent group of histones, with numerous cell type- and stage-specific variant. Linker histone H1 is an essential component of chromatin structure. H1 links nucleosomes into higher order structures. Histone H5 performs the same function as histone H1, and replaces H1 in certain cells. The structure of GH5, the globular domain of the linker histone H5 is known [, ]. The fold is similar to the DNA-binding domain of the catabolite gene activator protein, CAP, thus providing a possible model for the binding of GH5 to DNA. The linker histones, which do not contain the histone fold motif, are critical to the higher-order compaction of chromatin, because they bind to internucleosomal DNA and facilitate interactions between individual nucleosomes. In addition, H1 variants have been shown to be involved in the regulation of developmental genes. A common feature of this protein family is a tripartite structure in which a globular (H15) domain of about 80 amino acids is flanked by two less structured N- and C-terminal tails. The H15 domain is also characterised by high sequence homology among the family of linker histones. The highly conserved H15 domain is essential for the binding of H1 or H5 to the nucleosome. It consists of a three helix bundle (I-III), with a beta-hairpin at the C terminus. There is also a short three-residue stretch between helices I and II that is in the beta-strand conformation. Together with the C-terminal beta-hairpin, this strand forms the third strand of an antiparallel beta-sheet [, , , ]. Proteins known to contain a H15 domain are:  - Eukaryotic histone H1. The histones H1 constitute a family with many variants, differing in their affinity for chromatin. Several variants are simultaneously present in a single cell. For example, the nucleated erythrocytes of birds contain both H1 and H5, the latter being an extreme variant of H1.  - Eukaryotic MHYST family of histone acetyltransferase. Histone acetyltransferases transfer an acetyl group from acetyl-CoA to the epsylon- amino group of lysine within the basic NH2-termini of histones, which bind the acidic phosphates of DNA [].    This entry represents the H15 domain.; GO: 0003677 DNA binding, 0006334 nucleosome assembly, 0000786 nucleosome, 0005634 nucleus; PDB: 2LSO_A 2RQP_A 1UHM_A 1UST_A 1GHC_A 1HST_A 1YQA_A 1USS_A.
Probab=5.97  E-value=5.5e+02  Score=17.78  Aligned_cols=21  Identities=24%  Similarity=0.312  Sum_probs=16.7

Q ss_pred             ccchHHHHHHHHHHHhhheee
Q psy9320         159 KNLPNFVNKSLKKMVKIISIV  179 (183)
Q Consensus       159 q~~a~~~~~~~~~~~~~~~~~  179 (183)
                      .+|..++++.||+++.-=.++
T Consensus        42 ~~~~~~l~~aLk~~v~~G~l~   62 (77)
T PF00538_consen   42 ANFKSRLKRALKRGVEKGKLV   62 (77)
T ss_dssp             TTHHHHHHHHHHHHHHCTSEE
T ss_pred             HHHHHHHHHHHHHHHHCCcEE
Confidence            469999999999998754444


No 8  
>PF07140 IFNGR1:  Interferon gamma receptor (IFNGR1);  InterPro: IPR021126 Interferon (INF)-gamma is a dimeric glycoprotein produced by activated T cells and natural killer cells. Although originally isolated based on its antiviral activity, INF-gamma also displays powerful anti-proliferative and immuno-modulatory activities, which are essential for developing appropriate cellular defences against a variety of infectious agents. The first step in eliciting these responses is the specific high affinity interaction of INF- gamma with its cell-surface receptor (INF-gammaRalpha); the complex then interacts with at least one of a family of additional species-specific accessory factors (AF-1 or INF-gammabeta), which convey different cellular responses. One such response is the association and phosphorylation of two protein tyrosine kinases (Jak-1 and Jak-2), which in turn stimulate nuclear transcription activators [].  The human INF-gammaR, is a member of the hematopoietic cytokine receptor superfamily. It is expressed in a membrane-bound form in many cell types, and is over-expressed in tumour cells. It comprises an extracellular portion of 229 residues, a single transmembrane region, and a cytoplasmic domain of 221 residues. As with other members of its superfamily, the cytokine-binding sites are formed by a small set of closely-spaced surface loops that extend from a beta-sheet core, much like antigen-binding sites on antibodies. The extracellular INF-gammaR monomer comprises two domains (domain D1 from residue 14-102, and domain D2 from residue 114-221), each resembling an Ig fold with fibronectin type III topology []. The vaccinia virus interferon (IFN)-gamma receptor (IFN-gammaR) is a 43 kDa soluble glycoprotein that is secreted from infected cells early during infection. IFN-gammaR from vaccinia virus, cowpox virus and camelpox virus exist naturally as homodimers, whereas the cellular IFN-gammaR dimerizes only upon binding the homodimeric IFN-gamma. The existence of the virus protein as a dimer in the absence of ligand may provide an advantage to the virus in efficient binding and inhibition of IFN-gamma in solution []. ; GO: 0019955 cytokine binding, 0016020 membrane; PDB: 3BES_R 1FYH_E 1FG9_D.
Probab=5.53  E-value=2.9e+02  Score=22.44  Aligned_cols=22  Identities=32%  Similarity=0.264  Sum_probs=16.8

Q ss_pred             ccccccccchHHHHHHHHHHHh
Q psy9320         153 NKGENVKNLPNFVNKSLKKMVK  174 (183)
Q Consensus       153 ~t~~dVq~~a~~~~~~~~~~~~  174 (183)
                      .+.+|+|++-+.+.|||...+|
T Consensus        88 Kk~n~~~~~~~~lpksl~svv~  109 (134)
T PF07140_consen   88 KKKNDFKRKKIKLPKSLLSVVK  109 (134)
T ss_dssp             -SGGGHHHHHHHHHHHHHHHS-
T ss_pred             ecCcccchhchhccHHHHHHHh
Confidence            4568999999999999876654


No 9  
>PF07120 DUF1376:  Protein of unknown function (DUF1376);  InterPro: IPR010781 This entry is represented by Bacteriophage PBC5 (Sinorhizobium phage PBC5), Orf49. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown.
Probab=5.20  E-value=1.7e+02  Score=21.06  Aligned_cols=29  Identities=24%  Similarity=0.322  Sum_probs=23.0

Q ss_pred             ccccccchHHHHHHHHHHHhhheeeeccC
Q psy9320         155 GENVKNLPNFVNKSLKKMVKIISIVLLKF  183 (183)
Q Consensus       155 ~~dVq~~a~~~~~~~~~~~~~~~~~~~~~  183 (183)
                      ..|-+.+|.+.+-|.++..++...+|-.|
T Consensus        40 p~d~~~Lar~~~~s~~~~~~a~~~ll~~f   68 (88)
T PF07120_consen   40 PDDDKRLARICGCSTKEWRKALDFLLREF   68 (88)
T ss_pred             CCCHHHHHHHHCcCHHHHHHHHHHHHHhC
Confidence            35677889999999999888888777554


No 10 
>KOG2825|consensus
Probab=4.74  E-value=4.9e+02  Score=24.35  Aligned_cols=33  Identities=18%  Similarity=0.351  Sum_probs=21.2

Q ss_pred             cceeeccccccccc--cccchHHHHHHHHHHHhhh
Q psy9320         144 SEVLAEKDENKGEN--VKNLPNFVNKSLKKMVKII  176 (183)
Q Consensus       144 ~E~IAeade~t~~d--Vq~~a~~~~~~~~~~~~~~  176 (183)
                      |-.|-=--+-||--  .-+||+++.|+|.|+.++-
T Consensus       143 F~~vVFDTAPTGHTLRlL~fP~~lek~lgKl~~l~  177 (323)
T KOG2825|consen  143 FDVVVFDTAPTGHTLRLLQFPTTLEKGLGKLLSLK  177 (323)
T ss_pred             cceEEeccCCCcceehhhccchHHHHHHHHHHHHH
Confidence            33333333344443  4589999999999988764


Done!