RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy9321
(67 letters)
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases. Protein Kinases
(PKs), catalytic (c) domain. PKs catalyze the transfer
of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The PK family is part of a larger
superfamily that includes the catalytic domains of RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, phosphoinositide 3-kinase (PI3K), and
actin-fragmin kinase. PKs make up a large family of
serine/threonine kinases, protein tyrosine kinases
(PTKs), and dual-specificity PKs that phosphorylate both
serine/threonine and tyrosine residues of target
proteins. Majority of protein phosphorylation, about
95%, occurs on serine residues while only 1% occurs on
tyrosine residues. Protein phosphorylation is a
mechanism by which a wide variety of cellular proteins,
such as enzymes and membrane channels, are reversibly
regulated in response to certain stimuli. PKs often
function as components of signal transduction pathways
in which one kinase activates a second kinase, which in
turn, may act on other kinases; this sequential action
transmits a signal from the cell surface to target
proteins, which results in cellular responses. The PK
family is one of the largest known protein families with
more than 100 homologous yeast enzymes and 550 human
proteins. A fraction of PK family members are
pseudokinases that lack crucial residues for catalytic
activity. The mutiplicity of kinases allows for specific
regulation according to substrate, tissue distribution,
and cellular localization. PKs regulate many cellular
processes including proliferation, division,
differentiation, motility, survival, metabolism,
cell-cycle progression, cytoskeletal rearrangement,
immunity, and neuronal functions. Many kinases are
implicated in the development of various human diseases
including different types of cancer.
Length = 215
Score = 56.5 bits (137), Expect = 1e-11
Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 5/63 (7%)
Query: 6 EDWVTLYIQMQLCQI-TLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHH 64
ED LY+ M+ C+ +LK L N +LS + +++ I QI++GLEY+HS GI+H
Sbjct: 61 EDENHLYLVMEYCEGGSLKDLLKE---NEGKLS-EDEILRILLQILEGLEYLHSNGIIHR 116
Query: 65 DIK 67
D+K
Sbjct: 117 DLK 119
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain.
Length = 260
Score = 52.3 bits (126), Expect = 5e-10
Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 6/58 (10%)
Query: 11 LYIQMQLCQ-ITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ M+ C+ L +LS +E + I QI++GLEY+HS GI+H D+K
Sbjct: 73 LYLVMEYCEGGDLFDYLSRGGPLSE-----DEAKKIALQILRGLEYLHSNGIIHRDLK 125
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
domain. Phosphotransferases. Serine or
threonine-specific kinase subfamily.
Length = 254
Score = 50.6 bits (122), Expect = 2e-09
Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 6/63 (9%)
Query: 6 EDWVTLYIQMQLC-QITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHH 64
ED LY+ M+ C L L +LS + + + RQI+ LEY+HS+GIVH
Sbjct: 67 EDEDKLYLVMEYCEGGDLFDLLK----KRGRLS-EDEARFYLRQILSALEYLHSKGIVHR 121
Query: 65 DIK 67
D+K
Sbjct: 122 DLK 124
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen-Activated Protein
Kinase Kinase Kinase. Serine/threonine kinases (STKs),
mitogen-activated protein kinase (MAPK) kinase kinase
(MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MAPKKK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
MAP/ERK kinase kinases (MEKKs) in some cases. They
phosphorylate and activate MAPK kinases (MAPKKs or MKKs
or MAP2Ks), which in turn phosphorylate and activate
MAPKs during signaling cascades that are important in
mediating cellular responses to extracellular signals.
This subfamily is composed of the Apoptosis
Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
and fungal MAPKKKs. Also included in this subfamily are
the cell division control proteins Schizosaccharomyces
pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
Length = 260
Score = 48.7 bits (117), Expect = 9e-09
Identities = 15/21 (71%), Positives = 18/21 (85%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI++GL Y+HS GIVH DIK
Sbjct: 108 RQILEGLAYLHSNGIVHRDIK 128
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
Protein Kinases (PKs), STE family, catalytic (c) domain.
PKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine or tyrosine residues on
protein substrates. The STE family is part of a larger
superfamily that includes the catalytic domains of other
protein serine/threonine kinases (STKs), protein
tyrosine kinases (PTKs), RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). This family is composed of STKs, and
some dual-specificity PKs that phosphorylate both
threonine and tyrosine residues of target proteins. Most
members are kinases involved in mitogen-activated
protein kinase (MAPK) signaling cascades, acting as MAPK
kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
kinase kinase kinases (MAP4Ks). The MAPK signaling
pathways are important mediators of cellular responses
to extracellular signals. The pathways involve a triple
kinase core cascade comprising of the MAPK, which is
phosphorylated and activated by a MAPKK, which itself is
phosphorylated and activated by a MAPKKK. Each MAPK
cascade is activated either by a small GTP-binding
protein or by an adaptor protein, which transmits the
signal either directly to a MAPKKK to start the triple
kinase core cascade or indirectly through a mediator
kinase, a MAP4K. Other STE family members include
p21-activated kinases (PAKs) and class III myosins,
among others. PAKs are Rho family GTPase-regulated
kinases that serve as important mediators in the
function of Cdc42 (cell division cycle 42) and Rac.
Class III myosins are motor proteins containing an
N-terminal kinase catalytic domain and a C-terminal
actin-binding domain, which can phosphorylate several
cytoskeletal proteins, conventional myosin regulatory
light chains, as well as autophosphorylate the
C-terminal motor domain. They play an important role in
maintaining the structural integrity of photoreceptor
cell microvilli.
Length = 253
Score = 47.2 bits (113), Expect = 3e-08
Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
Query: 10 TLYIQMQLCQI-TLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
L+I M+ C +LK L + Q + Q+ Y+ +++++GLEY+HS GI+H DIK
Sbjct: 71 ELWIVMEFCSGGSLKDLLK----STNQTLTESQIAYVCKELLKGLEYLHSNGIIHRDIK 125
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
Kinase, Never In Mitosis gene A-related kinase.
Serine/Threonine Kinases (STKs), Never In Mitosis gene A
(NIMA)-related kinase (Nek) family, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. The Nek family is
composed of 11 different mammalian members (Nek1-11)
with similarity to the catalytic domain of Aspergillus
nidulans NIMA kinase, the founding member of the Nek
family which was identified in a screen for cell cycle
mutants that were prevented from entering mitosis. Neks
contain a conserved N-terminal catalytic domain and a
more divergent C-terminal regulatory region of various
sizes and structures. They are involved in the
regulation of downstream processes following the
activation of Cdc2, and many of their functions are cell
cycle-related. They play critical roles in microtubule
dynamics during ciliogenesis and mitosis.
Length = 258
Score = 46.0 bits (110), Expect = 1e-07
Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 10/63 (15%)
Query: 10 TLYIQMQLC-----QITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHH 64
L I M+ +K+ E +Q++ F Q+ L+Y+HS+ I+H
Sbjct: 73 KLCIVMEYADGGDLSQKIKKQKKEGKPFPE-----EQILDWFVQLCLALKYLHSRKILHR 127
Query: 65 DIK 67
DIK
Sbjct: 128 DIK 130
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase,
p38 Mitogen-Activated Protein Kinase. Serine/Threonine
Kinases (STKs), p38 subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The p38 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. p38 kinases are
mitogen-activated protein kinases (MAPKs), serving as
important mediators of cellular responses to
extracellular signals. They function in the regulation
of the cell cycle, cell development, cell
differentiation, senescence, tumorigenesis, apoptosis,
pain development and pain progression, and immune
responses. p38 kinases are activated by the MAPK kinases
MKK3 and MKK6, which in turn are activated by upstream
MAPK kinase kinases including TAK1, ASK1, and MLK3, in
response to cellular stresses or inflammatory cytokines.
p38 substrates include other protein kinases and factors
that regulate transcription, nuclear export, mRNA
stability and translation. p38 kinases are drug targets
for the inflammatory diseases psoriasis, rheumatoid
arthritis, and chronic pulmonary disease. Vertebrates
contain four isoforms of p38, named alpha, beta, gamma,
and delta, which show varying substrate specificity and
expression patterns. p38alpha and p38beta are
ubiquitously expressed, p38gamma is predominantly found
in skeletal muscle, and p38delta is found in the heart,
lung, testis, pancreas, and small intestine.
Length = 343
Score = 45.7 bits (109), Expect = 1e-07
Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 6/62 (9%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHD 65
ED+ +Y+ L L + C ++LS D + ++ QI++GL+YIHS GI+H D
Sbjct: 90 EDFQDVYLVTHLMGADLNNIVKC-----QKLS-DDHIQFLVYQILRGLKYIHSAGIIHRD 143
Query: 66 IK 67
+K
Sbjct: 144 LK 145
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
protein Kinase 9-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK9-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. This subfamily is
composed of CDK9 and CDK12 from higher eukaryotes, yeast
BUR1, C-type plant CDKs (CdkC), and similar proteins.
CDK9, BUR1, and CdkC are functionally equivalent. They
act as a kinase for the C-terminal domain of RNA
polymerase II and participate in regulating mutliple
steps of gene expression including transcription
elongation and RNA processing. CDK9 and CdkC associate
with T-type cyclins while BUR1 associates with the
cyclin BUR2. CDK12 is a unique CDK that contains an
arginine/serine-rich (RS) domain, which is predominantly
found in splicing factors. CDK12 interacts with cyclins
L1 and L2, and participates in regulating transcription
and alternative splicing.
Length = 287
Score = 45.2 bits (108), Expect = 2e-07
Identities = 13/29 (44%), Positives = 22/29 (75%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q+ +Q+++GL+Y+HS GI+H DIK
Sbjct: 99 ESQIKCYMKQLLEGLQYLHSNGILHRDIK 127
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
protein 7-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), (Cdc7)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Cdc7-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this subfamily include
Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
Cdc15, Arabidopsis thaliana mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
related proteins. MAPKKKs phosphorylate and activate
MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals. Fission yeast Cdc7
is essential for cell division by playing a key role in
the initiation of septum formation and cytokinesis.
Budding yeast Cdc15 functions to coordinate mitotic exit
with cytokinesis. Arabidopsis MAPKKK epsilon is required
for pollen development in the plasma membrane.
Length = 254
Score = 44.9 bits (107), Expect = 3e-07
Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 1/24 (4%)
Query: 44 YIFRQIVQGLEYIHSQGIVHHDIK 67
Y++ Q++QGL Y+H QG++H DIK
Sbjct: 104 YVY-QVLQGLAYLHEQGVIHRDIK 126
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
Kinase, p21-activated kinase. Serine/threonine kinases
(STKs), p21-activated kinase (PAK) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PAK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PAKs are Rho
family GTPase-regulated kinases that serve as important
mediators in the function of Cdc42 (cell division cycle
42) and Rac. PAKs are implicated in the regulation of
many cellular processes including growth factor
receptor-mediated proliferation, cell polarity, cell
motility, cell death and survival, and actin
cytoskeleton organization. PAK deregulation is
associated with tumor development. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
Group I PAKs contain a PBD (p21-binding domain)
overlapping with an AID (autoinhibitory domain), a
C-terminal catalytic domain, SH3 binding sites and a
non-classical SH3 binding site for PIX (PAK-interacting
exchange factor). Group II PAKs contain a PBD and a
catalytic domain, but lack other motifs found in group I
PAKs. Since group II PAKs do not contain an obvious AID,
they may be regulated differently from group I PAKs.
Group I PAKs interact with the SH3 containing proteins
Nck, Grb2 and PIX; no such binding has been demonstrated
for group II PAKs.
Length = 286
Score = 44.9 bits (107), Expect = 3e-07
Identities = 15/27 (55%), Positives = 23/27 (85%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ Y+ R+++QGLEY+HSQ ++H DIK
Sbjct: 117 QIAYVCREVLQGLEYLHSQNVIHRDIK 143
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
Kinase, Mitogen-Activated Protein Kinase.
Serine/Threonine Kinases (STKs), Mitogen-Activated
Protein Kinase (MAPK) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The MAPK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. MAPKs serve as important
mediators of cellular responses to extracellular
signals. They control critical cellular functions
including differentiation, proliferation, migration, and
apoptosis. They are also implicated in the pathogenesis
of many diseases including multiple types of cancer,
stroke, diabetes, and chronic inflammation. Typical MAPK
pathways involve a triple kinase core cascade comprising
of the MAPK, which is phosphorylated and activated by a
MAPK kinase (MAP2K or MKK), which itself is
phosphorylated and activated by a MAPK kinase kinase
(MAP3K or MKKK). Each cascade is activated either by a
small GTP-binding protein or by an adaptor protein,
which transmits the signal either directly to a MAP3K to
start the triple kinase core cascade or indirectly
through a mediator kinase, a MAP4K. There are three main
typical MAPK subfamilies: Extracellular signal-Regulated
Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
Some MAPKs are atypical in that they are not regulated
by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
Length = 330
Score = 44.1 bits (105), Expect = 6e-07
Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 5/58 (8%)
Query: 10 TLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+YI +L + L + + + + L+ D + Y QI++GL+Y+HS ++H D+K
Sbjct: 78 DVYIVTELMETDLHKVI----KSPQPLT-DDHIQYFLYQILRGLKYLHSANVIHRDLK 130
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), CMGC family, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CMGC family is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The CMGC family consists of Cyclin-Dependent
protein Kinases (CDKs), Mitogen-activated protein
kinases (MAPKs) such as Extracellular signal-regulated
kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
and similar proteins. CDKs belong to a large subfamily
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. MAPKs
serve as important mediators of cellular responses to
extracellular signals. They control critical cellular
functions including differentiation, proliferation,
migration, and apoptosis. They are also implicated in
the pathogenesis of many diseases including multiple
types of cancer, stroke, diabetes, and chronic
inflammation.
Length = 283
Score = 42.7 bits (101), Expect = 1e-06
Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ + L + + + + Q++QGL + HS GI+H D+K
Sbjct: 73 LYLVFEFMDTDLYKLIKDRQRGLPE----SLIKSYLYQLLQGLAFCHSHGILHRDLK 125
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
serine/threonine kinase-like proteins. Serine/Threonine
Kinases (STKs), Microtubule-associated serine/threonine
(MAST) kinase subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MAST kinase subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The MAST kinase subfamily
includes MAST kinases, MAST-like (MASTL) kinases, and
fungal kinases with similarity to Saccharomyces
cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
MAST kinases contain an N-terminal domain of unknown
function, a central catalytic domain, and a C-terminal
PDZ domain that mediates protein-protein interactions.
MASTL kinases carry only a catalytic domain which
contains a long insert relative to other kinases. The
fungal kinases in this subfamily harbor other domains in
addition to a central catalytic domain, which also
contains an insert relative to MAST kinases like MASTL.
Rim15 contains a C-terminal signal receiver (REC) domain
while cek1 contains an N-terminal PAS domain. MAST
kinases are cytoskeletal associated kinases of unknown
function that are also expressed at neuromuscular
junctions and postsynaptic densities. The fungal
proteins Rim15 and cek1 are involved in the regulation
of meiosis and mitosis, respectively.
Length = 265
Score = 42.6 bits (101), Expect = 2e-06
Identities = 12/24 (50%), Positives = 16/24 (66%)
Query: 44 YIFRQIVQGLEYIHSQGIVHHDIK 67
+IV LEY+HS GI+H D+K
Sbjct: 97 IYIAEIVLALEYLHSNGIIHRDLK 120
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional.
Length = 461
Score = 42.6 bits (100), Expect = 2e-06
Identities = 13/27 (48%), Positives = 20/27 (74%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
QV + RQ++ ++YIH +GI+H DIK
Sbjct: 261 QVTAVARQLLSAIDYIHGEGIIHRDIK 287
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
protein Kinase-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase (CDK)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDKs are partly
regulated by their subcellular localization, which
defines substrate phosphorylation and the resulting
specific function. CDK1, CDK2, CDK4, and CDK6 have
well-defined functions in the cell cycle, such as the
regulation of the early G1 phase by CDK4 or CDK6, the
G1/S phase transition by CDK2, or the entry of mitosis
by CDK1. They also exhibit overlapping cyclin
specificity and functions in certain conditions.
Knockout mice with a single CDK deleted remain viable
with specific phenotypes, showing that some CDKs can
compensate for each other. For example, CDK4 can
compensate for the loss of CDK6, however, double
knockout mice with both CDK4 and CDK6 deleted die in
utero. CDK8 and CDK9 are mainly involved in
transcription while CDK5 is implicated in neuronal
function. CDK7 plays essential roles in both the cell
cycle as a CDK-Activating Kinase (CAK) and in
transcription as a component of the general
transcription factor TFIIH.
Length = 282
Score = 41.7 bits (99), Expect = 3e-06
Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ + C + LK++L + I Q+++GL Y HS I+H D+K
Sbjct: 73 LYLVFEYCDMDLKKYLD----KRPGPLSPNLIKSIMYQLLRGLAYCHSHRILHRDLK 125
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
Byr2-like MAP Kinase Kinase Kinases. Serine/threonine
kinases (STKs), mitogen-activated protein kinase (MAPK)
kinase kinase (MAPKKK) subfamily, fungal Byr2-like
proteins, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MAPKKK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include the MAPKKKs
Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
and Cryptococcus neoformans Ste11, and related proteins.
They contain an N-terminal SAM (sterile alpha-motif)
domain, which mediates protein-protein interaction, and
a C-terminal catalytic domain. MAPKKKs phosphorylate and
activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
in turn phosphorylate and activate MAPKs during
signaling cascades that are important in mediating
cellular responses to extracellular signals. Fission
yeast Byr2 is regulated by Ras1. It responds to
pheromone signaling and controls mating through the MAPK
pathway. Budding yeast Ste11 functions in MAPK cascades
that regulate mating, high osmolarity glycerol, and
filamentous growth responses.
Length = 267
Score = 41.8 bits (98), Expect = 4e-06
Identities = 13/21 (61%), Positives = 19/21 (90%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI++GL Y+H++GI+H DIK
Sbjct: 113 RQILKGLNYLHNRGIIHRDIK 133
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1.
Serine/threonine kinases (STKs), plant MAP/ERK kinase
kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The plant MEKK1 subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This subfamily is
composed of plant mitogen-activated protein kinase
(MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
is a MAPKKK that phosphorylates and activates MAPK
kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals. Arabidopsis thaliana
MEKK1 activates MPK4, a MAPK that regulates systemic
acquired resistance. MEKK1 also participates in the
regulation of temperature-sensitive and tissue-specific
cell death.
Length = 258
Score = 41.6 bits (98), Expect = 4e-06
Identities = 13/21 (61%), Positives = 16/21 (76%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI+ GLEY+H + VH DIK
Sbjct: 109 RQILLGLEYLHDRNTVHRDIK 129
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
prediction only / Signal transduction mechanisms /
Transcription / DNA replication, recombination, and
repair].
Length = 384
Score = 41.7 bits (96), Expect = 4e-06
Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ M+ + L LS + ++I QI+ LEY+HS+GI+H DIK
Sbjct: 73 LYLVMEYVDGGSLEDLLKKIGRKGPLSES-EALFILAQILSALEYLHSKGIIHRDIK 128
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
Serine/Threonine Kinases, Mammalian Ste20-like protein
kinase 1 and 2. Serine/threonine kinases (STKs),
mammalian Ste20-like protein kinase 1 (MST1) and MST2
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MST1/2 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of MST1, MST2, and
related proteins including Drosophila Hippo and
Dictyostelium discoideum Krs1 (kinase responsive to
stress 1). MST1/2 and Hippo are involved in a conserved
pathway that governs cell contact inhibition, organ size
control, and tumor development. MST1 activates the
mitogen-activated protein kinases (MAPKs) p38 and c-Jun
N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
to caspase activation and apoptosis. MST1 has also been
implicated in cell proliferation and differentiation.
Krs1 may regulate cell growth arrest and apoptosis in
response to cellular stress.
Length = 256
Score = 41.5 bits (98), Expect = 5e-06
Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 15/53 (28%)
Query: 15 MQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
M++ TL + +++ I Q ++GLEY+HS +H DIK
Sbjct: 89 MKITNKTLTE---------------EEIAAILYQTLKGLEYLHSNKKIHRDIK 126
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
protein kinase 3-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), mammalian Ste20-like
protein kinase 3 (MST3)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MST3-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of MST3, MST4,
STK25, Schizosaccharomyces pombe Nak1 and Sid1,
Saccharomyces cerevisiae sporulation-specific protein 1
(SPS1), and related proteins. Nak1 is required by
fission yeast for polarizing the tips of actin
cytoskeleton and is involved in cell growth, cell
separation, cell morphology and cell-cycle progression.
Sid1 is a component in the septation initiation network
(SIN) signaling pathway, and plays a role in
cytokinesis. SPS1 plays a role in regulating proteins
required for spore wall formation. MST4 plays a role in
mitogen-activated protein kinase (MAPK) signaling during
cytoskeletal rearrangement, morphogenesis, and
apoptosis. MST3 phosphorylates the STK NDR and may play
a role in cell cycle progression and cell morphology.
STK25 may play a role in the regulation of cell
migration and polarization.
Length = 274
Score = 41.4 bits (98), Expect = 5e-06
Identities = 12/28 (42%), Positives = 20/28 (71%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ +I R+++ GLEY+H +G +H DIK
Sbjct: 98 TYIAFILREVLLGLEYLHEEGKIHRDIK 125
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed.
Length = 932
Score = 41.3 bits (97), Expect = 5e-06
Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 8/54 (14%)
Query: 21 TLKQWLSCSTYNAEQLSYD-------KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
TLK L S + E LS + + IF +I +EY+HS+G++H D+K
Sbjct: 88 TLKSLLK-SVWQKESLSKELAEKTSVGAFLSIFHKICATIEYVHSKGVLHRDLK 140
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
Serine/Threonine Kinase, Phosphoinositide-dependent
kinase 1. Serine/Threonine Kinases (STKs),
Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PDK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase (PI3K). PDK1
carries an N-terminal catalytic domain and a C-terminal
pleckstrin homology (PH) domain that binds
phosphoinositides. It phosphorylates the activation loop
of AGC kinases that are regulated by PI3K such as PKB,
SGK, and PKC, among others, and is crucial for their
activation. Thus, it contributes in regulating many
processes including metabolism, growth, proliferation,
and survival. PDK1 also has the ability to
autophosphorylate and is constitutively active in
mammalian cells. PDK1 is essential for normal embryo
development and is important in regulating cell volume.
Length = 280
Score = 41.0 bits (97), Expect = 6e-06
Identities = 12/29 (41%), Positives = 20/29 (68%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+K + +I+ LEY+HS+GI+H D+K
Sbjct: 101 EKCTRFYAAEILLALEYLHSKGIIHRDLK 129
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
protein kinase kinase kinase kinase-like Protein
Serine/Threonine Kinases. Serine/threonine kinases
(STKs), mitogen-activated protein kinase (MAPK) kinase
kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAP4K3-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily includes MAP4K3, MAP4K1,
MAP4K2, MAP4K5, and related proteins. Vertebrate members
contain an N-terminal catalytic domain and a C-terminal
citron homology (CNH) regulatory domain, similar to
MAP4K4/6. MAP4Ks are involved in some MAPK signaling
pathways that are important in mediating cellular
responses to extracellular signals by activating a MAPK
kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
cascade is activated either by a small GTP-binding
protein or by an adaptor protein, which transmits the
signal either directly to a MAP3K to start the triple
kinase core cascade or indirectly through a mediator
kinase, a MAP4K. MAP4K1, also called haematopoietic
progenitor kinase 1 (HPK1), is a hematopoietic-specific
STK involved in many cellular signaling cascades
including MAPK, antigen receptor, apoptosis, growth
factor, and cytokine signaling. It participates in the
regulation of T cell receptor signaling and T
cell-mediated immune responses. MAP4K2 was referred to
as germinal center (GC) kinase because of its preferred
location in GC B cells. MAP4K3 plays a role in the
nutrient-responsive pathway of mTOR (mammalian target of
rapamycin) signaling. It is required in the activation
of S6 kinase by amino acids and for the phosphorylation
of the mTOR-regulated inhibitor of eukaryotic initiation
factor 4E. MAP4K5, also called germinal center
kinase-related enzyme (GCKR), has been shown to activate
the MAPK c-Jun N-terminal kinase (JNK).
Length = 262
Score = 40.7 bits (96), Expect = 7e-06
Identities = 12/27 (44%), Positives = 19/27 (70%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ Y+ R+ ++GL Y+H G +H DIK
Sbjct: 102 QIAYVCRETLKGLAYLHETGKIHRDIK 128
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
dual-specificity MAP kinase kinases and similar
proteins. Protein kinases (PKs), MAP kinase kinase
(MAPKK) subfamily, Plant MAPKKs and similar proteins,
catalytic (c) domain. PKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine or
tyrosine residues on protein substrates. The MAPKK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein serine/threonine
kinases, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The mitogen-activated protein
(MAP) kinase signaling pathways are important mediators
of cellular responses to extracellular signals. The
pathways involve a triple kinase core cascade comprising
of the MAP kinase (MAPK), which is phosphorylated and
activated by a MAPK kinase (MAPKK or MKK), which itself
is phosphorylated and activated by a MAPK kinase kinase
(MAPKKK or MKKK). Members of this group include MAPKKs
from plants, kinetoplastids, alveolates, and mycetozoa.
The MAPKK, LmxPK4, from Leishmania mexicana, is
important in differentiation and virulence.
Dictyostelium discoideum MEK1 is required for proper
chemotaxis. MEK1 null mutants display severe defects in
cell polarization and directional movement. Plants
contain multiple MAPKKs like other eukaryotes. The
Arabidopsis genome encodes for 10 MAPKKs while poplar
and rice contain 13 MAPKKs each. The functions of these
proteins have not been fully elucidated. There is
evidence to suggest that MAPK cascades are involved in
plant stress responses. In Arabidopsis, MKK3 plays a
role in pathogen signaling, MKK2 is involved in cold and
salt stress signaling, MKK4/MKK5 participates in innate
immunity, and MKK7 regulates basal and systemic acquired
resistance.
Length = 264
Score = 40.7 bits (96), Expect = 8e-06
Identities = 14/30 (46%), Positives = 23/30 (76%), Gaps = 1/30 (3%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQ-GIVHHDIK 67
+ + YI RQI++GL+Y+H++ I+H DIK
Sbjct: 98 EPVLAYIARQILKGLDYLHTKRHIIHRDIK 127
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
Serine/Threonine Kinase, Group II p21-activated kinase.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) subfamily, Group II, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PAK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
Group II PAKs, also called non-conventional PAKs,
include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
(p21-binding domain) and catalytic domains, but lack
other motifs found in group I PAKs, such as an AID
(autoinhibitory domain) and SH3 binding sites. Since
group II PAKs do not contain an obvious AID, they may be
regulated differently from group I PAKs. While group I
PAKs interact with the SH3 containing proteins Nck, Grb2
and PIX, no such binding has been demonstrated for group
II PAKs. Some known substrates of group II PAKs are also
substrates of group I PAKs such as Raf, BAD, LIMK and
GEFH1. Unique group II substrates include MARK/Par-1 and
PDZ-RhoGEF. Group II PAKs play important roles in
filopodia formation, neuron extension, cytoskeletal
organization, and cell survival.
Length = 285
Score = 40.1 bits (94), Expect = 1e-05
Identities = 9/29 (31%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++Q+ + +++ L ++H+QG++H DIK
Sbjct: 114 EEQIATVCLAVLKALSFLHAQGVIHRDIK 142
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
Serine/Threonine Kinase, p38gamma Mitogen-Activated
Protein Kinase. Serine/Threonine Kinases (STKs),
p38gamma subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
p38gamma subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. p38 kinases are mitogen-activated protein
kinases (MAPKs), serving as important mediators of
cellular responses to extracellular signals. They are
activated by the MAPK kinases MKK3 and MKK6, which in
turn are activated by upstream MAPK kinase kinases
including TAK1, ASK1, and MLK3, in response to cellular
stresses or inflammatory cytokines. Vertebrates contain
four isoforms of p38, named alpha, beta, gamma, and
delta. p38gamma, also called MAPK12, is predominantly
expressed in skeletal muscle. Unlike p38alpha and
p38beta, p38gamma is insensitive to pyridinylimidazoles.
It displays an antagonizing function compared to
p38alpha. p38gamma inhibits, while p38alpha stimulates,
c-Jun phosphorylation and AP-1 mediated transcription.
p38gamma also plays a role in the signaling between Ras
and the estrogen receptor and has been implicated to
increase cell invasion and breast cancer progression. In
Xenopus, p38gamma is critical in the meiotic maturation
of oocytes.
Length = 343
Score = 39.9 bits (93), Expect = 2e-05
Identities = 15/34 (44%), Positives = 27/34 (79%), Gaps = 1/34 (2%)
Query: 34 EQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
E+LS D+ + ++ Q+++GL+YIH+ GI+H D+K
Sbjct: 113 EKLSEDR-IQFLVYQMLKGLKYIHAAGIIHRDLK 145
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
Kinase, Extracellular signal-Regulated Kinase 5.
Serine/Threonine Kinases (STKs), Extracellular
signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ERK5 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MAPKs are
important mediators of cellular responses to
extracellular signals. ERK5, also called Big MAPK1
(BMK1) or MAPK7, has a unique C-terminal extension,
making it approximately twice as big as other MAPKs.
This extension contains transcriptional activation
capability which is inhibited by the N-terminal half.
ERK5 is activated in response to growth factors and
stress by a cascade that leads to its phosphorylation by
the MAP2K MEK5, which in turn is regulated by the MAP3Ks
MEKK2 and MEKK3. Activated ERK5 phosphorylates its
targets including myocyte enhancer factor 2 (MEF2),
Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
cell proliferation during the G1/S phase transition.
Studies on knockout mice revealed that ERK5 is essential
for cardiovascular development and plays an important
role in angiogenesis. It is also critical for neural
differentiation and survival. The ERK5 pathway has been
implicated in the pathogenesis of many diseases
including cancer, cardiac hypertrophy, and
atherosclerosis.
Length = 334
Score = 39.2 bits (92), Expect = 2e-05
Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 5/62 (8%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHD 65
D+ +Y+ M L + L + + L+ ++ + Y Q+++GL+YIHS ++H D
Sbjct: 78 ADFKDVYVVMDLMESDLHHIIHSD----QPLT-EEHIRYFLYQLLRGLKYIHSANVIHRD 132
Query: 66 IK 67
+K
Sbjct: 133 LK 134
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
(MEKK4) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK4 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK4 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates MAPK kinases (MAPKKs or
MKKs or MAP2Ks), which in turn phosphorylate and
activate MAPKs during signaling cascades that are
important in mediating cellular responses to
extracellular signals. MEKK4 activates the c-Jun
N-terminal kinase (JNK) and p38 MAPK signaling pathways
by directly activating their respective MAPKKs,
MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
known as stress-activated MAPKs, as they are activated
in response to a variety of environmental stresses and
pro-inflammatory cytokines. MEKK4 also plays roles in
the re-polarization of the actin cytoskeleton in
response to osmotic stress, in the proper closure of the
neural tube, in cardiovascular development, and in
immune responses.
Length = 264
Score = 39.2 bits (92), Expect = 3e-05
Identities = 13/20 (65%), Positives = 17/20 (85%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
Q+++GL Y+HS GIVH DIK
Sbjct: 107 QLLEGLAYLHSHGIVHRDIK 126
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
Kinase Like Serine/Threonine Kinases. Serine/Threonine
Kinases (STKs), Cyclin-dependent protein kinase like
(CDKL) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CDKL subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. This subfamily is
composed of CDKL1-5 and similar proteins. Some CDKLs,
like CDKL1 and CDKL3, may be implicated in
transformation and others, like CDKL3 and CDKL5, are
associated with mental retardation when impaired. CDKL2
plays a role in learning and memory.
Length = 288
Score = 39.2 bits (92), Expect = 3e-05
Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ + + TL + L S L D YI+ Q++Q + Y HS I+H DIK
Sbjct: 75 LYLVFEYVERTLLELLEASPGG---LPPDAVRSYIW-QLLQAIAYCHSHNIIHRDIK 127
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
cell-Associated Kinase-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Male germ
cell-Associated Kinase (MAK)-like subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of human MAK and
MAK-related kinase (MRK), Saccharomyces cerevisiae
Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
Arabidopsis thaliana MHK, and similar proteins. These
proteins play important roles during meiosis. MAK is
highly expressed in testicular cells specifically in the
meiotic phase, but is not essential for spermatogenesis
and fertility. It functions as a coactivator of the
androgen receptor in prostate cells. MRK, also called
Intestinal Cell Kinase (ICK), is expressed ubiquitously,
with highest expression in the ovary and uterus. A
missense mutation in MRK causes
endocrine-cerebro-osteodysplasia (ECO), suggesting that
this protein plays an important role in the development
of many organs. MAK and MRK may be involved in
regulating cell cycle and cell fate. Ime2p is a
meiosis-specific kinase that is important during meiotic
initiation and during the later stages of meiosis. Mde3
functions downstream of the transcription factor Mei-4
which is essential for meiotic prophase I.
Length = 283
Score = 39.1 bits (92), Expect = 3e-05
Identities = 12/28 (42%), Positives = 16/28 (57%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ I QI+QGL +IH G H D+K
Sbjct: 99 SVIRSIIYQILQGLAHIHKHGFFHRDLK 126
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
and Hog1. Serine/Threonine Kinases (STKs), Fungal
Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
Sty1/Hog1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of the MAPKs Sty1
from Schizosaccharomyces pombe, Hog1 from Saccharomyces
cerevisiae, and similar proteins. MAPKs are important
mediators of cellular responses to extracellular
signals. Sty1 and Hog1 are stress-activated MAPKs that
partipate in transcriptional regulation in response to
stress. Sty1 is activated in response to oxidative
stress, osmotic stress, and UV radiation. Sty1 is
regulated by the MAP2K Wis1, which is activated by the
MAP3Ks Wis4 and Win1, which receive signals of the
stress condition from membrane-spanning histidine
kinases Mak1-3. Activated Sty1 stabilizes the Atf1
transcription factor and induces transcription of
Atf1-dependent genes of the core environmetal stress
response (CESR). Hog1 is the key element in the high
osmolarity glycerol (HOG) pathway and is activated upon
hyperosmotic stress. Activated Hog1 accumulates in the
nucleus and regulates stress-induced transcription. The
HOG pathway is mediated by two transmembrane
osmosensors, Sln1 and Sho1.
Length = 328
Score = 39.0 bits (91), Expect = 4e-05
Identities = 13/26 (50%), Positives = 20/26 (76%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Y QI++GL+Y+HS G+VH D+K
Sbjct: 110 IQYFLYQILRGLKYVHSAGVVHRDLK 135
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional.
Length = 357
Score = 38.7 bits (90), Expect = 5e-05
Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
Query: 30 TYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
T + L D Q + I +QI++GL Y+H+Q I+H D+K
Sbjct: 148 TKRSRPLPID-QALIIEKQILEGLRYLHAQRIIHRDVK 184
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
signal-Regulated Kinase 1 and 2-like Serine/Threonine
Kinases. Serine/Threonine Kinases (STKs), Extracellular
signal-regulated kinases 1 and 2 (ERK1/2) and Fus3
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. This
ERK1/2-like subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. This subfamily is composed of
the mitogen-activated protein kinases (MAPKs) ERK1,
ERK2, baker's yeast Fus3, and similar proteins. MAPK
pathways are important mediators of cellular responses
to extracellular signals. ERK1/2 activation is
preferentially by mitogenic factors, differentiation
stimuli, and cytokines, through a kinase cascade
involving the MAPK kinases MEK1/2 and a MAPK kinase
kinase from the Raf family. ERK1/2 have numerous
substrates, many of which are nuclear and participate in
transcriptional regulation of many cellular processes.
They regulate cell growth, cell proliferation, and cell
cycle progression from G1 to S phase. Although the
distinct roles of ERK1 and ERK2 have not been fully
determined, it is known that ERK2 can maintain most
functions in the absence of ERK1, and that the deletion
of ERK2 is embryonically lethal. The MAPK, Fus3,
regulates yeast mating processes including
mating-specific gene expression, G1 arrest, mating
projection, and cell fusion.
Length = 336
Score = 38.4 bits (90), Expect = 5e-05
Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
Query: 34 EQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ LS D + Y QI++GL+YIHS ++H D+K
Sbjct: 101 QHLSND-HIQYFLYQILRGLKYIHSANVLHRDLK 133
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
3-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
(MEKK3)-like subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MEKK3-like subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. This subfamily is composed of
MEKK3, MEKK2, and related proteins, all containing an
N-terminal PB1 domain, which mediates oligomerization,
and a C-terminal catalytic domain. MEKK2 and MEKK3 are
mitogen-activated protein kinase (MAPK) kinase kinases
(MAPKKKs or MKKKs or MAP3Ks), proteins that
phosphorylate and activate MAPK kinases (MAPKKs or MKKs
or MAP2Ks), which in turn phosphorylate and activate
MAPKs during signaling cascades that are important in
mediating cellular responses to extracellular signals.
MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
activates extracellular signal-regulated kinase 5
(ERK5). The ERK5 cascade plays roles in promoting cell
proliferation, differentiation, neuronal survival, and
neuroprotection. MEKK3 plays an essential role in
embryonic angiogenesis and early heart development.
MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
N-terminal kinase (JNK) and p38, through their
respective MAPKKs.
Length = 263
Score = 38.3 bits (89), Expect = 6e-05
Identities = 14/21 (66%), Positives = 18/21 (85%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI++G+EY+HS IVH DIK
Sbjct: 111 RQILEGVEYLHSNMIVHRDIK 131
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the
Serine/Threonine Kinase, p38beta Mitogen-Activated
Protein Kinase. Serine/Threonine Kinases (STKs),
p38beta subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
p38beta subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. p38 kinases are mitogen-activated protein
kinases (MAPKs), serving as important mediators of
cellular responses to extracellular signals. They are
activated by the MAPK kinases MKK3 and MKK6, which in
turn are activated by upstream MAPK kinase kinases
including TAK1, ASK1, and MLK3, in response to cellular
stresses or inflammatory cytokines. Vertebrates contain
four isoforms of p38, named alpha, beta, gamma, and
delta. p38beta, also called MAPK11, is widely expressed
in tissues and shows more similarity with p38alpha than
with the other isoforms. Both are sensitive to
pyridinylimidazoles and share some common substrates
such as MAPK activated protein kinase 2 (MK2) and the
transcription factors ATF2, c-Fos and, ELK-1. p38beta is
involved in regulating the activation of the
cyclooxygenase-2 promoter and the expression of
TGFbeta-induced alpha-smooth muscle cell actin.
Length = 343
Score = 38.5 bits (89), Expect = 6e-05
Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 6/62 (9%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHD 65
E++ +Y+ L L + C ++LS D+ V ++ Q+++GL+YIHS GI+H D
Sbjct: 90 ENFNEVYLVTNLMGADLNNIVKC-----QKLS-DEHVQFLIYQLLRGLKYIHSAGIIHRD 143
Query: 66 IK 67
+K
Sbjct: 144 LK 145
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
Bck1-like MAP Kinase Kinase Kinases. Serine/threonine
kinases (STKs), mitogen-activated protein kinase (MAPK)
kinase kinase (MAPKKK) subfamily, fungal Bck1-like
proteins, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MAPKKK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include the MAPKKKs
Saccharomyces cerevisiae Bck1 and Schizosaccharomyces
pombe Mkh1, and related proteins. MAPKKKs phosphorylate
and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks),
which in turn phosphorylate and activate MAPKs during
signaling cascades that are important in mediating
cellular responses to extracellular signals. Budding
yeast Bck1 is part of the cell integrity MAPK pathway,
which is activated by stresses and aggressions to the
cell wall. The MAPKKK Bck1, MAPKKs Mkk1 and Mkk2, and
the MAPK Slt2 make up the cascade that is important in
the maintenance of cell wall homeostasis. Fission yeast
Mkh1 is involved in MAPK cascades regulating cell
morphology, cell wall integrity, salt resistance, and
filamentous growth in response to stress.
Length = 272
Score = 38.2 bits (89), Expect = 6e-05
Identities = 12/26 (46%), Positives = 20/26 (76%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
V + Q+++GL Y+HS+GI+H D+K
Sbjct: 110 VRFFTEQVLEGLAYLHSKGILHRDLK 135
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the
Serine/Threonine Kinase, p38alpha Mitogen-Activated
Protein Kinase. Serine/Threonine Kinases (STKs),
p38alpha subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
p38alpha subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. p38 kinases are mitogen-activated protein
kinases (MAPKs), serving as important mediators of
cellular responses to extracellular signals. They are
activated by the MAPK kinases MKK3 and MKK6, which in
turn are activated by upstream MAPK kinase kinases
including TAK1, ASK1, and MLK3, in response to cellular
stresses or inflammatory cytokines. Vertebrates contain
four isoforms of p38, named alpha, beta, gamma, and
delta. p38alpha, also called MAPK14, is expressed in
most tissues and is the major isoform involved in the
immune and inflammatory response. It is the central p38
MAPK involved in myogenesis. It plays a role in
regulating cell cycle check-point transition and
promoting cell differentiation. p38alpha also regulates
cell proliferation and death through crosstalk with the
JNK pathway. Its substrates include MAPK activated
protein kinase 2 (MK2), MK5, and the transcription
factors ATF2 and Mitf.
Length = 345
Score = 38.1 bits (88), Expect = 6e-05
Identities = 14/29 (48%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
D V ++ QI++GL+YIHS I+H D+K
Sbjct: 119 DDHVQFLIYQILRGLKYIHSADIIHRDLK 147
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase
adapter protein. Protein Kinase family, STE20-related
kinase adapter protein (STRAD) subfamily, pseudokinase
domain. The STRAD subfamily is part of a larger
superfamily that includes the catalytic domains of
serine/threonine kinases (STKs), protein tyrosine
kinases, RIO kinases, aminoglycoside phosphotransferase,
choline kinase, and phosphoinositide 3-kinase. The
pseudokinase domain shows similarity to protein kinases
but lacks crucial residues for catalytic activity. STRAD
forms a complex with the scaffolding protein MO25, and
the STK, LKB1, resulting in the activation of the
kinase. In the complex, LKB1 phosphorylates and
activates adenosine monophosphate-activated protein
kinases (AMPKs), which regulate cell energy metabolism
and cell polarity. LKB1 is a tumor suppressor linked to
the rare inherited disease, Peutz-Jeghers syndrome,
which is characterized by a predisposition to benign
polyps and hyperpigmentation of the buccal mucosa. There
are two forms of STRAD, alpha and beta, that complex
with LKB1 and MO25. The structure of STRAD-alpha is
available and shows that this protein binds ATP, has an
ordered activation loop, and adopts a closed
conformation typical of fully active protein kinases. It
does not possess activity due to nonconservative
substitutions of essential catalytic residues. ATP
binding enhances the affinity of STRAD for MO25. The
conformation of STRAD-alpha stabilized through ATP and
MO25 may be needed to activate LKB1.
Length = 314
Score = 38.1 bits (89), Expect = 6e-05
Identities = 9/24 (37%), Positives = 17/24 (70%)
Query: 44 YIFRQIVQGLEYIHSQGIVHHDIK 67
+I + ++ L+YIHS+G +H +K
Sbjct: 105 FILKDVLNALDYIHSKGFIHRSVK 128
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
Kinase, Cell Cycle-Related Kinase. Serine/Threonine
Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CCRK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CCRK was previously called p42. It is a
Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
which is essential for the activation of CDK2. It is
indispensable for cell growth and has been implicated in
the progression of glioblastoma multiforme. In the
heart, a splice variant of CCRK with a different
C-terminal half is expressed, this variant promotes
cardiac cell growth and survival and is significantly
down-regulated during the development of heart failure.
Length = 286
Score = 38.0 bits (89), Expect = 6e-05
Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 4/57 (7%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ M+ L S + E+ + QV R +++G+ Y+H+ GI+H D+K
Sbjct: 74 FVLVMEYMPSDL----SEVLRDEERPLPEAQVKSYMRMLLKGVAYMHANGIMHRDLK 126
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
Kinase, Apoptosis signal-regulating kinase.
Serine/threonine kinases (STKs), Apoptosis
signal-regulating kinase (ASK) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ASK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Subfamily members
are mitogen-activated protein kinase (MAPK) kinase
kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals. ASK1 (also called
MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
and p38 MAPK signaling pathways by directly activating
their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
plays important roles in cytokine and stress responses,
as well as in reactive oxygen species (ROS)-mediated
cellular responses. ASK1 is implicated in various
diseases mediated by oxidative stress including
inschemic heart disease, hypertension, vessel injury,
brain ischemia, Fanconi anemia, asthma, and pulmonary
edema, among others. ASK2 (also called MAPKKK6)
functions only in a heteromeric complex with ASK1, and
can activate ASK1 by direct phosphorylation. The
function of MAPKKK15 is still unknown.
Length = 268
Score = 37.9 bits (88), Expect = 7e-05
Identities = 12/26 (46%), Positives = 20/26 (76%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
+++ +QI++GL+Y+H IVH DIK
Sbjct: 110 IIFYTKQILEGLKYLHDNQIVHRDIK 135
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), AGC (Protein Kinases A, G and C) family,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The AGC family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
this family include cAMP-dependent Protein Kinase (PKA),
cGMP-dependent Protein Kinase (PKG), Protein Kinase C
(PKC), Protein Kinase B (PKB), G protein-coupled
Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
(p70S6K or S6K), among others. AGC kinases share an
activation mechanism based on the phosphorylation of up
to three sites: the activation loop (A-loop), the
hydrophobic motif (HM) and the turn motif.
Phosphorylation at the A-loop is required of most AGC
kinases, which results in a disorder-to-order transition
of the A-loop. The ordered conformation results in the
access of substrates and ATP to the active site. A
subset of AGC kinases with C-terminal extensions
containing the HM also requires phosphorylation at this
site. Phosphorylation at the HM allows the C-terminal
extension to form an ordered structure that packs into
the hydrophobic pocket of the catalytic domain, which
then reconfigures the kinase into an active bi-lobed
state. In addition, growth factor-activated AGC kinases
such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
phosphorylation at the turn motif (also called tail or
zipper site), located N-terminal to the HM at the
C-terminal extension. AGC kinases regulate many cellular
processes including division, growth, survival,
metabolism, motility, and differentiation. Many are
implicated in the development of various human diseases.
Length = 250
Score = 37.9 bits (89), Expect = 8e-05
Identities = 11/20 (55%), Positives = 16/20 (80%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+IV LEY+HS GI++ D+K
Sbjct: 101 EIVLALEYLHSLGIIYRDLK 120
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
Serine/Threonine Kinase, p38delta Mitogen-Activated
Protein Kinase. Serine/Threonine Kinases (STKs),
p38delta subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
p38delta subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. p38 kinases are mitogen-activated protein
kinases (MAPKs), serving as important mediators of
cellular responses to extracellular signals. They are
activated by the MAPK kinases MKK3 and MKK6, which in
turn are activated by upstream MAPK kinase kinases
including TAK1, ASK1, and MLK3, in response to cellular
stresses or inflammatory cytokines. Vertebrates contain
four isoforms of p38, named alpha, beta, gamma, and
delta. p38delta, also called MAPK13, is found in
skeletal muscle, heart, lung, testis, pancreas, and
small intestine. It regulates microtubule function by
phosphorylating Tau. It activates the c-jun promoter and
plays a role in G2 cell cycle arrest. It also controls
the degration of c-Myb, which is associated with myeloid
leukemia and poor prognosis in colorectal cancer.
p38delta is the main isoform involved in regulating the
differentiation and apoptosis of keratinocytes.
Length = 342
Score = 38.0 bits (88), Expect = 8e-05
Identities = 14/29 (48%), Positives = 22/29 (75%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ +V Y+ Q++ GL+YIHS GI+H D+K
Sbjct: 116 EDKVQYLVYQMLCGLKYIHSAGIIHRDLK 144
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7;
Provisional.
Length = 566
Score = 37.8 bits (88), Expect = 9e-05
Identities = 13/23 (56%), Positives = 17/23 (73%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
I RQI+ L+ +HS GIVH D+K
Sbjct: 260 IMRQILFALDGLHSTGIVHRDVK 282
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
Provisional.
Length = 353
Score = 37.9 bits (88), Expect = 9e-05
Identities = 12/21 (57%), Positives = 16/21 (76%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI+ G+ Y+H + IVH DIK
Sbjct: 175 RQILSGIAYLHRRHIVHRDIK 195
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
Kinase, Mitogen-Activated Protein Kinase 15.
Serine/Threonine Kinases (STKs), Mitogen-Activated
Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAPK15 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MAPKs are
important mediators of cellular responses to
extracellular signals. Human MAPK15 is also called
Extracellular signal Regulated Kinase 8 (ERK8) while the
rat protein is called ERK7. ERK7 and ERK8 display both
similar and different biochemical properties. They
autophosphorylate and activate themselves and do not
require upstream activating kinases. ERK7 is
constitutively active and is not affected by
extracellular stimuli whereas ERK8 shows low basal
activity and is activated by DNA-damaging agents. ERK7
and ERK8 also have different substrate profiles. Genome
analysis shows that they are orthologs with similar gene
structures. ERK7 and ERK 8 may be involved in the
signaling of some nuclear receptor transcription
factors. ERK7 regulates hormone-dependent degradation of
estrogen receptor alpha while ERK8 down-regulates the
transcriptional co-activation androgen and
glucocorticoid receptors.
Length = 337
Score = 37.6 bits (88), Expect = 1e-04
Identities = 12/29 (41%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
D YI Q+++ L+YIHS ++H D+K
Sbjct: 106 DVHKRYIMYQLLKALKYIHSGNVIHRDLK 134
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional.
Length = 392
Score = 37.5 bits (87), Expect = 1e-04
Identities = 11/28 (39%), Positives = 21/28 (75%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+Q + I R++++ L Y+H +GI+H D+K
Sbjct: 185 EQAITIQRRLLEALAYLHGRGIIHRDVK 212
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
Serine/Threonine Kinase, Yank1. Serine/Threonine
Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Yank1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This subfamily
contains uncharacterized STKs with similarity to the
human protein designated Yank1 or STK32A.
Length = 258
Score = 37.3 bits (87), Expect = 1e-04
Identities = 15/27 (55%), Positives = 20/27 (74%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
QV + +IV LEY+HS+GI+H DIK
Sbjct: 101 QVKFWICEIVLALEYLHSKGIIHRDIK 127
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional.
Length = 793
Score = 37.4 bits (86), Expect = 1e-04
Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 4/48 (8%)
Query: 20 ITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++L+QWL N ++ + ++FRQIV+ + HSQGIV H+++
Sbjct: 64 VSLRQWLD----NPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVR 107
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 9. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek9 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek9, also called
Nercc1, is primarily a cytoplasmic protein but can also
localize in the nucleus. It is involved in modulating
chromosome alignment and splitting during mitosis. It
interacts with the gamma-tubulin ring complex and the
Ran GTPase, and is implicated in microtubule
organization. Nek9 associates with FACT (FAcilitates
Chromatin Transcription) and modulates interphase
progression. It also interacts with Nek6, and Nek7,
during mitosis, resulting in their activation.
Length = 256
Score = 37.4 bits (87), Expect = 1e-04
Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
Query: 10 TLYIQMQLCQI-TLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
TL I+M+ TL + QL ++ V++ QIV + YIH GI+H DIK
Sbjct: 73 TLLIEMEYANGGTLYDKIV---RQKGQLFEEEMVLWYLFQIVSAVSYIHKAGILHRDIK 128
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen-activated protein
kinase kinase kinase kinase 3. Serine/threonine kinases
(STKs), mitogen-activated protein kinase (MAPK) kinase
kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAP4K3 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily contain an N-terminal catalytic domain and a
C-terminal citron homology (CNH) regulatory domain,
similar to MAP4K4/6. MAP4Ks are involved in some MAPK
signaling pathways that are important in mediating
cellular responses to extracellular signals by
activating a MAPK kinase kinase (MAPKKK or MAP3K or
MKKK). Each MAPK cascade is activated either by a small
GTP-binding protein or by an adaptor protein, which
transmits the signal either directly to a MAP3K to start
the triple kinase core cascade or indirectly through a
mediator kinase, a MAP4K. MAP4K3 plays a role in the
nutrient-responsive pathway of mTOR (mammalian target of
rapamycin) signaling. MAP4K3 is required in the
activation of S6 kinase by amino acids and for the
phosphorylation of the mTOR-regulated inhibitor of
eukaryotic initiation factor 4E. mTOR regulates ribosome
biogenesis and protein translation, and is frequently
deregulated in cancer.
Length = 267
Score = 37.0 bits (85), Expect = 2e-04
Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
L+I M+ C Q Y+ + Q+ Y+ R+ +QGL Y+HS+G +H DIK
Sbjct: 81 LWICMEFCGGGSLQ----DIYHVTGPLSESQIAYVSRETLQGLYYLHSKGKMHRDIK 133
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen-activated protein
kinase kinase kinase kinase 5. Serine/threonine kinases
(STKs), mitogen-activated protein kinase (MAPK) kinase
kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAP4K5 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily contain an N-terminal catalytic domain and a
C-terminal citron homology (CNH) regulatory domain,
similar to MAP4K4/6. MAP4Ks are involved in some MAPK
signaling pathways that are important in mediating
cellular responses to extracellular signals by
activating a MAPK kinase kinase (MAPKKK or MAP3K or
MKKK). Each MAPK cascade is activated either by a small
GTP-binding protein or by an adaptor protein, which
transmits the signal either directly to a MAP3K to start
the triple kinase core cascade or indirectly through a
mediator kinase, a MAP4K. MAP4K5, also called germinal
center kinase-related enzyme (GCKR), has been shown to
activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
also facilitates Wnt signaling in B cells, and may
therefore be implicated in the control of cell fate,
proliferation, and polarity.
Length = 267
Score = 36.9 bits (85), Expect = 2e-04
Identities = 14/27 (51%), Positives = 21/27 (77%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ Y+ R+ +QGL Y+HS+G +H DIK
Sbjct: 107 QIAYVCRETLQGLAYLHSKGKMHRDIK 133
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
Serine/Threonine Kinases, Oxidative stress response
kinase and Ste20-related proline alanine-rich kinase.
Serine/threonine kinases (STKs), oxidative stress
response kinase (OSR1) and Ste20-related proline
alanine-rich kinase (SPAK) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The OSR1 and SPAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. SPAK is also referred to as STK39 or PASK
(proline-alanine-rich STE20-related kinase). OSR1 and
SPAK regulate the activity of cation-chloride
cotransporters through direct interaction and
phosphorylation. They are also implicated in
cytoskeletal rearrangement, cell differentiation,
transformation and proliferation. OSR1 and SPAK contain
a conserved C-terminal (CCT) domain, which recognizes a
unique motif ([RK]FX[VI]) present in their activating
kinases (WNK1/WNK4) and their substrates.
Length = 267
Score = 36.6 bits (85), Expect = 2e-04
Identities = 11/23 (47%), Positives = 19/23 (82%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
+ +++++GLEY+HS G +H DIK
Sbjct: 107 VLKEVLKGLEYLHSNGQIHRDIK 129
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
and similar domains. Serine/Threonine Kinases (STKs),
Chlamydomonas reinhardtii FA2-like subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Chlamydomonas
reinhardtii FA2-like subfamily belongs to the
(NIMA)-related kinase (Nek) family. The Nek family
includes seven different Chlamydomonas Neks (CNKs 1-6
and Fa2). This subfamily includes FA2 and CNK4. The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Chlamydomonas reinhardtii FA2 was discovered
in a genetic screen for deflagellation-defective
mutants. It is essential for
basal-body/centriole-associated microtubule severing,
and plays a role in cell cycle progression. No cellular
function has yet been ascribed to CNK4.
Length = 256
Score = 36.7 bits (85), Expect = 2e-04
Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)
Query: 11 LYIQMQLCQI-TLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
L I M+ + L + L L D QV F QI+ GL ++HS+ I+H DIK
Sbjct: 74 LNIVMEYAENGDLHKLLK--MQRGRPLPED-QVWRFFIQILLGLAHLHSKKILHRDIK 128
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
Protein Serine/Threonine Kinases. Serine/threonine
kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The SLK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of the subfamily include SLK, STK10
(also called LOK for lymphocyte-oriented kinase), SmSLK
(Schistosoma mansoni SLK), and related proteins. SLK
promotes apoptosis through apoptosis signal-regulating
kinase 1 (ASK1) and the mitogen-activated protein kinase
(MAPK) p38. It also plays a role in mediating actin
reorganization. STK10 is responsible in regulating the
CD28 responsive element in T cells, as well as leukocyte
function associated antigen (LFA-1)-mediated lymphocyte
adhesion. SmSLK is capable of activating the MAPK Jun
N-terminal kinase (JNK) pathway in human embryonic
kidney (HEK) cells as well as in Xenopus oocytes. It may
participate in regulating MAPK cascades during
host-parasite interactions.
Length = 280
Score = 36.6 bits (85), Expect = 3e-04
Identities = 10/27 (37%), Positives = 20/27 (74%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ Y+ RQ+++ L ++HS ++H D+K
Sbjct: 104 QIRYVCRQMLEALNFLHSHKVIHRDLK 130
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase like 2 (CDKL2) and CDKL3 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDKL2 and CDKL3
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDKL2, also called
p56 KKIAMRE, is expressed in testis, kidney, lung, and
brain. It functions mainly in mature neurons and plays
an important role in learning and memory. Inactivation
of CDKL3, also called NKIAMRE (NKIATRE in rat), by
translocation is associated with mild mental
retardation. It has been reported that CDKL3 is lost in
leukemic cells having a chromosome arm 5q deletion, and
may contribute to the transformed phenotype.
Length = 286
Score = 36.2 bits (84), Expect = 3e-04
Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
Query: 44 YIFRQIVQGLEYIHSQGIVHHDIK 67
Y+F QI++G+E+ HS I+H DIK
Sbjct: 105 YLF-QILRGIEFCHSHNIIHRDIK 127
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
myosin-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), Class III myosin-like
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
class III myosin-like subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Class III myosins are motor
proteins with an N-terminal kinase catalytic domain and
a C-terminal actin-binding motor domain. Class III
myosins are present in the photoreceptors of
invertebrates and vertebrates and in the auditory hair
cells of mammals. The kinase domain of myosin III can
phosphorylate several cytoskeletal proteins,
conventional myosin regulatory light chains, and can
autophosphorylate the C-terminal motor domain. Myosin
III may play an important role in maintaining the
structural integrity of photoreceptor cell microvilli.
It may also function as a cargo carrier during
light-dependent translocation, in photoreceptor cells,
of proteins such as transducin and arrestin. The
Drosophila class III myosin, called NinaC (Neither
inactivation nor afterpotential protein C), is critical
in normal adaptation and termination of photoresponse.
Vertebrates contain two isoforms of class III myosin,
IIIA and IIIB. This subfamily also includes mammalian
NIK-like embryo-specific kinase (NESK), Traf2- and
Nck-interacting kinase (TNIK), mitogen-activated protein
kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
some MAPK signaling pathways by activating a MAPK kinase
kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
activated either by a small GTP-binding protein or by an
adaptor protein, which transmits the signal either
directly to a MAP3K to start the triple kinase core
cascade or indirectly through a mediator kinase, a
MAP4K. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
Length = 275
Score = 36.1 bits (84), Expect = 4e-04
Identities = 11/27 (40%), Positives = 18/27 (66%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ YI R+ ++GL Y+H ++H DIK
Sbjct: 114 WIAYILRETLRGLAYLHENKVIHRDIK 140
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
Serine/Threonine Kinase, Mammalian Ste20-like protein
kinase 3. Serine/threonine kinases (STKs), mammalian
Ste20-like protein kinase 3 (MST3) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MST3 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MST3
phosphorylates the STK NDR and may play a role in cell
cycle progression and cell morphology. It may also
regulate paxillin and consequently, cell migration. MST3
is present in human placenta, where it plays an
essential role in the oxidative stress-induced apoptosis
of trophoblasts in normal spontaneous delivery.
Dysregulation of trophoblast apoptosis may result in
pregnancy complications such as preeclampsia and
intrauterine growth retardation.
Length = 277
Score = 36.2 bits (83), Expect = 4e-04
Identities = 13/29 (44%), Positives = 22/29 (75%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q+ I R+I++GL+Y+HS+ +H DIK
Sbjct: 100 ETQIATILREILKGLDYLHSEKKIHRDIK 128
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine
Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
JNK1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. JNKs are mitogen-activated protein kinases
(MAPKs) that are involved in many stress-activated
responses including those during inflammation,
neurodegeneration, apoptosis, and persistent pain
sensitization, among others. Vetebrates harbor three
different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
JNK2, is expressed in every cell and tissue type.
Initially it was thought that JNK1 and JNK2 were
functionally redundant as mice deficient in either genes
(Jnk1 or Jnk2) could survive but disruption of both
genes resulted in lethality. However, recent studies
have shown that JNK1 and JNK2 perform distinct functions
through specific binding partners and substrates. JNK1
specifically binds with JAMP (JNK1-associated membrane
protein), which regulates the duration of JNK1 activity
in response to stimuli. Specific JNK1 substrates include
Itch and SG10, which are implicated in Th2 responses and
airway inflammation, and microtubule dynamics and
axodendritic length, respectively. Mice deficient in
Jnk1 are protected against arthritis, obesity, type 2
diabetes, cardiac cell death, and non-alcoholic liver
disease, suggesting that JNK1 may play roles in the
pathogenesis of these diseases.
Length = 364
Score = 35.8 bits (82), Expect = 4e-04
Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 9/63 (14%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVM-YIFRQIVQGLEYIHSQGIVHH 64
E++ +YI M+L L Q + Q+ D + M Y+ Q++ G++++HS GI+H
Sbjct: 99 EEFQDVYIVMELMDANLCQVI--------QMELDHERMSYLLYQMLCGIKHLHSAGIIHR 150
Query: 65 DIK 67
D+K
Sbjct: 151 DLK 153
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
Protein Serine/Threonine Kinases. Serine/Threonine
Kinases (STKs), Microtubule-associated serine/threonine
(MAST) kinase subfamily, fungal Rim15-like kinases,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAST kinase
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include Saccharomyces
cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
similar fungal proteins. They contain a central
catalytic domain, which contains an insert relative to
MAST kinases. In addition, Rim15 contains a C-terminal
signal receiver (REC) domain while cek1 contains an
N-terminal PAS domain. Rim15 (or Rim15p) functions as a
regulator of meiosis. It acts as a downstream effector
of PKA and regulates entry into stationary phase (G0).
Thus, it plays a crucial role in regulating yeast
proliferation, differentiation, and aging. Cek1 may
facilitate progression of mitotic anaphase.
Length = 260
Score = 35.9 bits (83), Expect = 4e-04
Identities = 10/20 (50%), Positives = 16/20 (80%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
++V G+E +H +GI+H DIK
Sbjct: 105 EVVLGVEDLHQRGIIHRDIK 124
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase,
Nemo-Like Kinase. Serine/Threonine Kinases (STKs),
Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The NLK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Mitogen-activated protein
kinases (MAPKs) are important mediators of cellular
responses to extracellular signals. NLK is an atypical
MAPK that is not regulated by a MAPK kinase. It
functions downstream of the MAPK kinase kinase Tak1,
which also plays a role in activating the JNK and p38
MAPKs. The Tak1/NLK pathways are regulated by Wnts, a
family of secreted proteins that is critical in the
control of asymmetric division and cell polarity. NLK
can phosphorylate transcription factors from the TCF/LEF
family, inhibiting their ability to activate the
transcription of target genes. In prostate cancer cells,
NLK is involved in regulating androgen receptor-mediated
transcription and its expression is altered during
cancer progression.
Length = 372
Score = 35.9 bits (83), Expect = 4e-04
Identities = 13/20 (65%), Positives = 18/20 (90%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
QI++GL+Y+HS GI+H DIK
Sbjct: 111 QILRGLKYLHSAGILHRDIK 130
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
Serine/Threonine Kinases, TEY Mitogen-Activated Protein
Kinases from Plants. Serine/Threonine Kinases (STKs),
Plant TEY Mitogen-Activated Protein Kinase (MAPK)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The TEY
MAPK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MAPKs are important mediators of cellular
responses to extracellular signals. In plants, MAPKs are
associated with physiological, developmental, hormonal,
and stress responses. Some plants show numerous gene
duplications of MAPKs. Arabidopsis thaliana harbors at
least 20 MAPKs, named AtMPK1-20. There are two subtypes
of plant MAPKs based on the conserved phosphorylation
motif present in the activation loop, TEY and TDY. This
subfamily represents the TEY subtype and is further
subdivided into three groups (A, B, and C). Group A is
represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
(NtNTF4), among others. They are mostly involved in
environmental and hormonal responses. AtMPK3 and AtMPK6
are also key regulators for stomatal development and
patterning. Group B is represented by AtMPK4, AtMPK13,
and NtNTF6, among others. They may be involved in both
cell division and environmental stress response. AtMPK4
also participates in regulating innate immunity. Group C
is represented by AtMPK1, AtMPK2, NtNTF3, Oryza sativa
MAPK4 (OsMAPK4), among others. They may also be involved
in stress responses. AtMPK1 and AtMPK2 are activated
following mechanical injury and in the presence of
stress chemicals such as jasmonic acid, hydrogen
peroxide and abscisic acid. OsMAPK4 is also called
OsMSRMK3 for Multiple Stress-Responsive MAPK3.
Length = 337
Score = 35.8 bits (83), Expect = 5e-04
Identities = 12/29 (41%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
D Y Q+++GL+YIHS ++H D+K
Sbjct: 107 DDHCQYFLYQLLRGLKYIHSANVLHRDLK 135
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
Phosphotransferases. Tyrosine-specific kinase subfamily.
Length = 257
Score = 35.6 bits (83), Expect = 5e-04
Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%)
Query: 11 LYIQMQLC-QITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
LYI M+ L +L N +LS + + QI +G+EY+ S+ +H D+
Sbjct: 76 LYIVMEYMEGGDLLSYLR---KNRPKLSLSDLLSFAL-QIARGMEYLESKNFIHRDL 128
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
UAS Requirement 1 and similar proteins.
Serine/Threonine Kinases (STKs), Bypass UAS Requirement
1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
BUR1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. BUR1, also called
SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK)
that is functionally equivalent to mammalian CDK9. It
associates with the cyclin BUR2. BUR genes were
orginally identified in a genetic screen as factors
involved in general transcription. The BUR1/BUR2 complex
phosphorylates the C-terminal domain of RNA polymerase
II. In addition, this complex regulates histone
modification by phosporylating Rad6 and mediating the
association of the Paf1 complex with chromatin.
Length = 311
Score = 35.8 bits (83), Expect = 5e-04
Identities = 10/27 (37%), Positives = 17/27 (62%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ Q+++G+ Y+H I+H DIK
Sbjct: 116 QIKCYMLQLLEGINYLHENHILHRDIK 142
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein
Serine/Threonine Kinase, Microtubule-associated
serine/threonine kinase. Serine/Threonine Kinases
(STKs), Microtubule-associated serine/threonine (MAST)
kinase subfamily, MAST, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MAST kinase subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. MAST kinases contain an
N-terminal domain of unknown function, a central
catalytic domain, and a C-terminal PDZ domain that
mediates protein-protein interactions. There are four
mammalian MAST kinases, named MAST1-MAST4. MAST1 is also
referred to as syntrophin-associated STK (SAST), while
MAST2 is also called MAST205. MAST kinases are
cytoskeletal associated kinases of unknown function that
are also expressed at neuromuscular junctions and
postsynaptic densities. MAST1, MAST2, and MAST3 bind and
phosphorylate the tumor suppressor PTEN, and may
contribute to the regulation and stabilization of PTEN.
MAST2 is involved in the regulation of the Fc-gamma
receptor of the innate immune response in macrophages,
and may also be involved in the regulation of the Na+/H+
exchanger NHE3.
Length = 305
Score = 35.5 bits (82), Expect = 5e-04
Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
Query: 28 CSTY--NAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
C+T N L D MY F + V LEY+H+ GIVH D+K
Sbjct: 88 CATLLKNIGALPVDMARMY-FAETVLALEYLHNYGIVHRDLK 128
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
Protein Tyrosine Kinase (PTK) family, catalytic domain.
This PTKc family is part of a larger superfamily that
includes the catalytic domains of protein
serine/threonine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. They can be classified
into receptor and non-receptor tyr kinases. PTKs play
important roles in many cellular processes including,
lymphocyte activation, epithelium growth and
maintenance, metabolism control, organogenesis
regulation, survival, proliferation, differentiation,
migration, adhesion, motility, and morphogenesis.
Receptor tyr kinases (RTKs) are integral membrane
proteins which contain an extracellular ligand-binding
region, a transmembrane segment, and an intracellular
tyr kinase domain. RTKs are usually activated through
ligand binding, which causes dimerization and
autophosphorylation of the intracellular tyr kinase
catalytic domain, leading to intracellular signaling.
Some RTKs are orphan receptors with no known ligands.
Non-receptor (or cytoplasmic) tyr kinases are
distributed in different intracellular compartments and
are usually multi-domain proteins containing a catalytic
tyr kinase domain as well as various regulatory domains
such as SH3 and SH2. PTKs are usually autoinhibited and
require a mechanism for activation. In many PTKs, the
phosphorylation of tyr residues in the activation loop
is essential for optimal activity. Aberrant expression
of PTKs is associated with many development
abnormalities and cancers.
Length = 262
Score = 35.2 bits (82), Expect = 7e-04
Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
Query: 23 KQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
K + LS + + QI +G+EY+ S+ VH D+
Sbjct: 89 KSRPVFPSPEKSTLSLKDLLSFAI-QIAKGMEYLASKKFVHRDL 131
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
kinase 3-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
(MEKK3)-like subfamily, catalytic (c) domain,
functionally uncharacterized subgroup 1. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK3-like subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The MEKK3-like subfamily is
composed of MEKK3, MEKK2, and related proteins, all
containing an N-terminal PB1 domain, which mediates
oligomerization, and a C-terminal catalytic domain.
MEKK2 and MEKK3 are mitogen-activated protein kinase
(MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
proteins that phosphorylate and activate MAPK kinases
(MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
and activate MAPKs during signaling cascades that are
important in mediating cellular responses to
extracellular signals. MEKK2 and MEKK3 activate MEK5
(also called MKK5), which activates extracellular
signal-regulated kinase 5 (ERK5). The ERK5 cascade plays
roles in promoting cell proliferation, differentiation,
neuronal survival, and neuroprotection. MEKK3 plays an
essential role in embryonic angiogenesis and early heart
development. MEKK2 and MEKK3 can also activate the
MAPKs, c-Jun N-terminal kinase (JNK) and p38, through
their respective MAPKKs.
Length = 264
Score = 35.4 bits (81), Expect = 7e-04
Identities = 14/21 (66%), Positives = 17/21 (80%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI+QG+ Y+HS IVH DIK
Sbjct: 113 RQILQGVSYLHSNMIVHRDIK 133
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
and similar domains. Serine/Threonine Kinases (STKs),
Chlamydomonas reinhardtii Never In Mitosis gene A
(NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Chlamydomonas
reinhardtii CNK2-like subfamily belongs to the
(NIMA)-related kinase (Nek) family. The Nek family
includes seven different Chlamydomonas Neks (CNKs 1-6
and Fa2). This subfamily includes CNK1, and -2. The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Chlamydomonas reinhardtii CNK2 has both
cilliary and cell cycle functions. It influences
flagellar length through promoting flagellar
disassembly, and it regulates cell size, through
influencing the size threshold at which cells commit to
mitosis.
Length = 256
Score = 35.1 bits (81), Expect = 0.001
Identities = 11/23 (47%), Positives = 18/23 (78%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
IF Q+++GL+ +H Q I+H D+K
Sbjct: 108 IFIQLLRGLQALHEQKILHRDLK 130
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 6.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 6, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK6 belongs to group II. Group II PAKs contain a PBD
(p21-binding domain) and a C-terminal catalytic domain,
but do not harbor an AID (autoinhibitory domain) or SH3
binding sites. PAK6 may play a role in stress responses
through its activation by the mitogen-activated protein
kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
is highly expressed in the brain. It is not required for
viability, but together with PAK5, it is required for
normal levels of locomotion and activity, and for
learning and memory. Increased expression of PAK6 is
found in primary and metastatic prostate cancer. PAK6
may play a role in the regulation of motility.
Length = 297
Score = 35.0 bits (80), Expect = 0.001
Identities = 12/29 (41%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++Q+ + ++Q L Y+HSQG++H DIK
Sbjct: 116 EEQIATVCESVLQALCYLHSQGVIHRDIK 144
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
Serine/Threonine Kinase, Group I p21-activated kinase.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) subfamily, Group I, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PAK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs are
implicated in the regulation of many cellular processes
including growth factor receptor-mediated proliferation,
cell polarity, cell motility, cell death and survival,
and actin cytoskeleton organization. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
Group I PAKs, also called conventional PAKs, include
PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). They interact
with the SH3 domain containing proteins Nck, Grb2 and
PIX. Binding of group I PAKs to activated GTPases leads
to conformational changes that destabilize the AID,
allowing autophosphorylation and full activation of the
kinase domain. Known group I PAK substrates include
MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
Stat5a, and Aurora A, among others.
Length = 293
Score = 34.9 bits (80), Expect = 0.001
Identities = 11/29 (37%), Positives = 20/29 (68%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q+ + R+ +Q LE++HS ++H DIK
Sbjct: 114 EGQIAAVCRECLQALEFLHSNQVIHRDIK 142
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase;
Provisional.
Length = 507
Score = 34.7 bits (79), Expect = 0.001
Identities = 12/23 (52%), Positives = 16/23 (69%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
+ RQ++ GL +H GIVH DIK
Sbjct: 314 VMRQVLTGLRKLHRIGIVHRDIK 336
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine
Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The MOK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MOK, also called Renal tumor antigen 1
(RAGE-1), is widely expressed and is enriched in testis,
kidney, lung, and brain. It is expressed in
approximately 50% of renal cell carcinomas (RCC) and is
a potential target for immunotherapy. MOK is stabilized
by its association with the HSP90 molecular chaperone.
It is induced by the transcription factor Cdx2 and may
be involved in regulating intestinal epithelial
development and differentiation.
Length = 282
Score = 34.2 bits (79), Expect = 0.002
Identities = 11/29 (37%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+K+V Q+++ L+++H GI H DIK
Sbjct: 99 EKRVKSYMYQLLKSLDHMHRNGIFHRDIK 127
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 12.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 12 (CDK12) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK12 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDK12 is also called Cdc2-related protein
kinase 7 (CRK7) or Cdc2-related kinase
arginine/serine-rich (CrkRS). It is a unique CDK that
contains an arginine/serine-rich (RS) domain, which is
predominantly found in splicing factors. CDK12 is widely
expressed in tissues. It interacts with cyclins L1 and
L2, and plays roles in regulating transcription and
alternative splicing.
Length = 302
Score = 34.4 bits (79), Expect = 0.002
Identities = 9/29 (31%), Positives = 17/29 (58%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ + +Q+++GL Y H + +H DIK
Sbjct: 115 EDHIKSFMKQLLEGLNYCHKKNFLHRDIK 143
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 10.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein Kinase 10 (CDK10) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK10 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDK10, also called PISSLRE, is essential for
cell growth and proliferation, and acts through the G2/M
phase of the cell cycle. CDK10 has also been identified
as an important factor in endocrine therapy resistance
in breast cancer. CDK10 silencing increases the
transcription of c-RAF and the activation of the p42/p44
MAPK pathway, which leads to antiestrogen resistance.
Patients who express low levels of CDK10 relapse early
on tamoxifen.
Length = 309
Score = 34.3 bits (79), Expect = 0.002
Identities = 11/27 (40%), Positives = 19/27 (70%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
QV + Q+++GL+Y+H I+H D+K
Sbjct: 109 QVKCLMLQLLRGLQYLHENFIIHRDLK 135
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine
Kinases, Mitogen-Activated Protein Kinases 4 and 6.
Serine/Threonine Kinases (STKs), Mitogen-Activated
Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAPK4/6 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MAPKs are
important mediators of cellular responses to
extracellular signals. MAPK4 is also called ERK4 or
p63MAPK, while MAPK6 is also called ERK3 or p97MAPK.
MAPK4 and MAPK6 are atypical MAPKs that are not
regulated by MAP2Ks. MAPK6 is expressed ubiquitously
with highest amounts in brain and skeletal muscle. It
may be involved in the control of cell differentiation
by negatively regulating cell cycle progression in
certain conditions. It may also play a role in
glucose-induced insulin secretion. MAPK6 and MAPK4
cooperate to regulate the activity of MAPK-activated
protein kinase 5 (MK5), leading to its relocation to the
cytoplasm and exclusion from the nucleus. The MAPK6/MK5
and MAPK4/MK5 pathways may play critical roles in
embryonic and post-natal development.
Length = 342
Score = 34.0 bits (78), Expect = 0.002
Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 6/58 (10%)
Query: 10 TLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++YI + + L L + E + + MY Q+++GL+YIHS ++H D+K
Sbjct: 90 SVYIVQEYMETDLANVLEQGPLSEE---HARLFMY---QLLRGLKYIHSANVLHRDLK 141
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
Protein Serine/Threonine Kinases. Serine/threonine
kinases (STKs), Nak1 subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The Nak1 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. This subfamily is composed of
Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
Kic1p (kinase that interacts with Cdc31p) and related
proteins. Nak1 (also known as N-rich kinase 1), is
required by fission yeast for polarizing the tips of
actin cytoskeleton and is involved in cell growth, cell
separation, cell morphology and cell-cycle progression.
Kic1p is required by budding yeast for cell integrity
and morphogenesis. Kic1p interacts with Cdc31p, the
yeast homologue of centrin, and phosphorylates
substrates in a Cdc31p-dependent manner.
Length = 277
Score = 34.0 bits (78), Expect = 0.002
Identities = 11/23 (47%), Positives = 17/23 (73%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
I R+++ L+YIH G++H DIK
Sbjct: 106 IIREVLVALKYIHKVGVIHRDIK 128
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional.
Length = 501
Score = 33.9 bits (77), Expect = 0.002
Identities = 12/28 (42%), Positives = 19/28 (67%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
KQ I +Q++ +EYIH + ++H DIK
Sbjct: 267 KQTRAIMKQLLCAVEYIHDKKLIHRDIK 294
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine
Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
JNK3 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. JNKs are mitogen-activated protein kinases
(MAPKs) that are involved in many stress-activated
responses including those during inflammation,
neurodegeneration, apoptosis, and persistent pain
sensitization, among others. Vetebrates harbor three
different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is
expressed primarily in the brain, and to a lesser extent
in the heart and testis. Mice deficient in Jnk3 are
protected against kainic acid-induced seizures, stroke,
sciatic axotomy neural death, and neuronal death due to
NGF deprivation, oxidative stress, or exposure to
beta-amyloid peptide. This suggests that JNK3 may play
roles in the pathogenesis of these diseases.
Length = 355
Score = 33.5 bits (76), Expect = 0.003
Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 9/63 (14%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVM-YIFRQIVQGLEYIHSQGIVHH 64
E++ +Y+ M+L L Q + Q+ D + M Y+ Q++ G++++HS GI+H
Sbjct: 92 EEFQDVYLVMELMDANLCQVI--------QMELDHERMSYLLYQMLCGIKHLHSAGIIHR 143
Query: 65 DIK 67
D+K
Sbjct: 144 DLK 146
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
protein Kinase 4 and 6-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase 4 (CDK4) and CDK6-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK4/6-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDK4 and CDK6
partner with D-type cyclins to regulate the early G1
phase of the cell cycle. They are the first kinase
activated by mitogenic signals to release cells from the
G0 arrested state. CDK4 and CDK6 are both expressed
ubiquitously, associate with all three D cyclins (D1, D2
and D3), and phosphorylate the retinoblastoma (pRb)
protein. They are also regulated by the INK4 family of
inhibitors which associate with either the CDK alone or
the CDK/cyclin complex. CDK4 and CDK6 show differences
in subcellular localization, sensitivity to some
inhibitors, timing in activation, tumor selectivity, and
possibly substrate profiles. Although CDK4 and CDK6 seem
to show some redundancy, they also have discrete,
nonoverlapping functions. CDK6 plays an important role
in cell differentiation.
Length = 287
Score = 33.4 bits (77), Expect = 0.003
Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 3/28 (10%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
K +M RQ+++G++++HS IVH D+K
Sbjct: 110 KDLM---RQLLRGVDFLHSHRIVHRDLK 134
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2
(MEKK2) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK2 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK2 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates the MAPK kinase MEK5 (or
MKK5), which in turn phosphorylates and activates
extracellular signal-regulated kinase 5 (ERK5). The ERK5
cascade plays roles in promoting cell proliferation,
differentiation, neuronal survival, and neuroprotection.
MEKK2 also activates ERK1/2, c-Jun N-terminal kinase
(JNK) and p38 through their respective MAPKKs MEK1/2,
JNK-activating kinase 2 (JNKK2), and MKK3/6. MEKK2 plays
roles in T cell receptor signaling, immune synapse
formation, cytokine gene expression, as well as in EGF
and FGF receptor signaling.
Length = 265
Score = 33.5 bits (76), Expect = 0.003
Identities = 13/21 (61%), Positives = 17/21 (80%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI++G+ Y+HS IVH DIK
Sbjct: 113 RQILEGVSYLHSNMIVHRDIK 133
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
(MEKK3) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK3 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK3 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates the MAPK kinase MEK5 (or
MKK5), which in turn phosphorylates and activates
extracellular signal-regulated kinase 5 (ERK5). The ERK5
cascade plays roles in promoting cell proliferation,
differentiation, neuronal survival, and neuroprotection.
MEKK3 plays an essential role in embryonic angiogenesis
and early heart development. In addition, MEKK3 is
involved in interleukin-1 receptor and Toll-like
receptor 4 signaling. It is also a specific regulator of
the proinflammatory cytokines IL-6 and GM-CSF in some
immune cells. MEKK3 also regulates calcineurin, which
plays a critical role in T cell activation, apoptosis,
skeletal myocyte differentiation, and cardiac
hypertrophy.
Length = 266
Score = 33.5 bits (76), Expect = 0.003
Identities = 13/21 (61%), Positives = 17/21 (80%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
RQI++G+ Y+HS IVH DIK
Sbjct: 113 RQILEGMSYLHSNMIVHRDIK 133
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
Serine/Threonine Kinase, STK25 or Yeast
Sps1/Ste20-related kinase 1. Serine/threonine kinases
(STKs), STK25 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The STK25 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. STK25 is also called Ste20/oxidant stress
response kinase 1 (SOK1) or yeast Sps1/Ste20-related
kinase 1 (YSK1). STK25 is localized in the Golgi
apparatus through its interaction with the Golgi matrix
protein GM130. It may play a role in the regulation of
cell migration and polarization. STK25 binds and
phosphorylates CCM3 (cerebral cavernous malformation 3),
also called PCD10 (programmed cell death 10), and may
play a role in apoptosis. Human STK25 is a candidate
gene responsible for pseudopseudohypoparathyroidism
(PPHP), a disease that shares features with the Albright
hereditary osteodystrophy (AHO) phenotype.
Length = 277
Score = 33.5 bits (76), Expect = 0.003
Identities = 12/23 (52%), Positives = 19/23 (82%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
I R+I++GL+Y+HS+ +H DIK
Sbjct: 106 ILREILKGLDYLHSERKIHRDIK 128
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 7.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 7 (CDK7) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK7 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK7
plays essential roles in the cell cycle and in
transcription. It associates with cyclin H and MAT1 and
acts as a CDK-Activating Kinase (CAK) by phosphorylating
and activating cell cycle CDKs (CDK1/2/4/6). In the
brain, it activates CDK5. CDK7 is also a component of
the general transcription factor TFIIH, which
phosphorylates the C-terminal domain (CTD) of RNA
polymerase II when it is bound with unphosphorylated
DNA, as present in the pre-initiation complex. Following
phosphorylation, the CTD dissociates from the DNA which
allows transcription initiation.
Length = 298
Score = 33.3 bits (77), Expect = 0.003
Identities = 10/20 (50%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
++GLEY+HS I+H D+K
Sbjct: 110 MTLRGLEYLHSNWILHRDLK 129
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
kinase. Serine/threonine kinases (STKs), STK10
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
STK10 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Other names for STK10 include
lymphocyte-oriented kinase (LOK) and Xenopus polo-like
kinase kinase 1 (xPlkk1). STK10 is highly expressed in
lymphocytes and is responsible in regulating leukocyte
function associated antigen (LFA-1)-mediated lymphocyte
adhesion. It plays a role in regulating the CD28
responsive element in T cells, and may also function as
a regulator of polo-like kinase 1 (Plk1), a protein
which is overexpressed in multiple tumor types.
Length = 292
Score = 33.5 bits (76), Expect = 0.003
Identities = 12/29 (41%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q+ I RQ+++ L+Y+HS I+H D+K
Sbjct: 109 EPQIQVICRQMLEALQYLHSMKIIHRDLK 137
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase,
c-Jun N-terminal Kinase. Serine/Threonine Kinases
(STKs), c-Jun N-terminal kinase (JNK) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The JNK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. JNKs are
mitogen-activated protein kinases (MAPKs) that are
involved in many stress-activated responses including
those during inflammation, neurodegeneration, apoptosis,
and persistent pain sensitization, among others. They
are also essential regulators of physiological and
pathological processes and are involved in the
pathogenesis of several diseases such as diabetes,
atherosclerosis, stroke, Parkinson's and Alzheimer's.
Vetebrates harbor three different JNK genes (Jnk1, Jnk2,
and Jnk3) that are alternatively spliced to produce at
least 10 isoforms. JNKs are specifically activated by
the MAPK kinases MKK4 and MKK7, which are in turn
activated by upstream MAPK kinase kinases as a result of
different stimuli including stresses such as ultraviolet
(UV) irradiation, hyperosmolarity, heat shock, or
cytokines. JNKs activate a large number of different
substrates based on specific stimulus, cell type, and
cellular condition, and may be implicated in seemingly
contradictory functions.
Length = 353
Score = 33.1 bits (76), Expect = 0.003
Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 9/63 (14%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVM-YIFRQIVQGLEYIHSQGIVHH 64
E++ +Y+ M+L L Q + Q+ D + M Y+ Q++ G++++HS GI+H
Sbjct: 91 EEFQDVYLVMELMDANLCQVI--------QMDLDHERMSYLLYQMLCGIKHLHSAGIIHR 142
Query: 65 DIK 67
D+K
Sbjct: 143 DLK 145
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
Serine/Threonine Kinases (STKs), Fungal
Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MPK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This subfamily is
composed of the MAPKs MPK1 from Saccharomyces
cerevisiae, Pmk1 from Schizosaccharomyces pombe, and
similar proteins. MAPKs are important mediators of
cellular responses to extracellular signals. MPK1 (also
called Slt2) and Pmk1 (also called Spm1) are
stress-activated MAPKs that regulate the cell wall
integrity (CWI) pathway, and are therefore important in
the maintainance of cell shape, cell wall construction,
morphogenesis, and ion homeostasis. MPK1 is activated in
response to cell wall stress including heat stimulation,
osmotic shock, UV irradiation, and any agents that
interfere with cell wall biogenesis such as chitin
antagonists, caffeine, or zymolase. MPK1 is regulated by
the MAP2Ks Mkk1/2, which are regulated by the MAP3K
Bck1. Pmk1 is also activated by multiple stresses
including elevated temperatures, hyper- or hypotonic
stress, glucose deprivation, exposure to cell-wall
damaging compounds, and oxidative stress. It is
regulated by the MAP2K Pek1, which is regulated by the
MAP3K Mkh1.
Length = 332
Score = 33.1 bits (76), Expect = 0.004
Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ +L + L Q + + L+ D QI+ GL+YIHS ++H D+K
Sbjct: 81 LYLYEELMEADLHQIIRSG----QPLT-DAHFQSFIYQILCGLKYIHSANVLHRDLK 132
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
Serine/Threonine Kinase, Mammalian Ste20-like protein
kinase 4. Serine/threonine kinases (STKs), mammalian
Ste20-like protein kinase 4 (MST4) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MST4 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MST4 is sometimes
referred to as MASK (MST3 and SOK1-related kinase). It
plays a role in mitogen-activated protein kinase (MAPK)
signaling during cytoskeletal rearrangement,
morphogenesis, and apoptosis. It influences cell growth
and transformation by modulating the extracellular
signal-regulated kinase (ERK) pathway. MST4 may also
play a role in tumor formation and progression. It
localizes in the Golgi apparatus by interacting with the
Golgi matrix protein GM130 and may play a role in cell
migration.
Length = 277
Score = 33.1 bits (75), Expect = 0.004
Identities = 11/27 (40%), Positives = 21/27 (77%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ + ++I++GL+Y+HS+ +H DIK
Sbjct: 102 QIATMLKEILKGLDYLHSEKKIHRDIK 128
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
Serine/Threonine Kinases, Mitogen-Activated Protein
Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine
kinases (STKs), mitogen-activated protein kinase (MAPK)
kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
(or MAP4K6) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MAP4K4/MAP4K6 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Members of this subfamily
contain an N-terminal catalytic domain and a C-terminal
citron homology (CNH) regulatory domain. MAP4Ks (or
MAPKKKKs) are involved in MAPK signaling pathways that
are important in mediating cellular responses to
extracellular signals by activating a MAPK kinase kinase
(MAPKKK or MAP3K or MKKK). Each MAPK cascade is
activated either by a small GTP-binding protein or by an
adaptor protein, which transmits the signal either
directly to a MAP3K to start the triple kinase core
cascade or indirectly through a mediator kinase, a
MAP4K. MAP4K4 is also called Nck Interacting kinase
(NIK). It facilitates the activation of the MAPKs,
extracellular signal-regulated kinase (ERK) 1, ERK2, and
c-Jun N-terminal kinase (JNK), by phosphorylating and
activating MEKK1. MAP4K4 plays a role in tumor necrosis
factor (TNF) alpha-induced insulin resistance. MAP4K4
silencing in skeletal muscle cells from type II diabetic
patients restores insulin-mediated glucose uptake.
MAP4K4, through JNK, also plays a broad role in cell
motility, which impacts inflammation, homeostasis, as
well as the invasion and spread of cancer. MAP4K4 is
found to be highly expressed in most tumor cell lines
relative to normal tissue. MAP4K6 (also called MINK for
Misshapen/NIKs-related kinase) is activated after Ras
induction and mediates activation of p38 MAPK. MAP4K6
plays a role in cell cycle arrest, cytoskeleton
organization, cell adhesion, and cell motility.
Length = 282
Score = 33.1 bits (75), Expect = 0.004
Identities = 11/26 (42%), Positives = 20/26 (76%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ YI R+I++GL ++H+ ++H DIK
Sbjct: 123 IAYICREILRGLAHLHAHKVIHRDIK 148
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 9.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 9 (CDK9) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK9 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK9
together with a cyclin partner (cyclin T1, T2a, T2b, or
K) is the main component of distinct positive
transcription elongation factors (P-TEFb), which
function as Ser2 C-terminal domain kinases of RNA
polymerase II. P-TEFb participates in multiple steps of
gene expression including transcription elongation, mRNA
synthesis, processing, export, and translation. It also
plays a role in mediating cytokine induced transcription
networks such as IL6-induced STAT3 signaling. In
addition, the CDK9/cyclin T2a complex promotes muscle
differentiation and enhances the function of some
myogenic regulatory factors.
Length = 310
Score = 33.1 bits (76), Expect = 0.004
Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
Query: 10 TLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Y+ + C+ L LS + LS K+VM + ++ GL YIH I+H D+K
Sbjct: 93 SFYLVFEFCEHDLAGLLS-NKNVKFTLSEIKKVM---KMLLNGLYYIHRNKILHRDMK 146
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 4. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek4 subfamily is
one of a family of 11 different Neks (Nek1-11). The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Neks are involved in the regulation of
downstream processes following the activation of Cdc2,
and many of their functions are cell cycle-related. They
play critical roles in microtubule dynamics during
ciliogenesis and mitosis. Nek4 is highly abundant in the
testis. Its specific function is unknown.
Length = 257
Score = 33.0 bits (75), Expect = 0.005
Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 13/70 (18%)
Query: 3 WLTEDWVTLYIQMQLCQ-----ITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIH 57
W ED + LYI M C+ LK+ +L + QV+ F QI L+Y+H
Sbjct: 68 WEGEDGL-LYIVMGFCEGGDLYHKLKE-------QKGKLLPENQVVEWFVQIAMALQYLH 119
Query: 58 SQGIVHHDIK 67
+ I+H D+K
Sbjct: 120 EKHILHRDLK 129
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
Kinase, cAMP-dependent protein kinase. Serine/Threonine
Kinases (STKs), cAMP-dependent protein kinase (PKA)
subfamily, catalytic (c) subunit. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PKA
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). This subfamily is composed of the
cAMP-dependent proteins kinases, PKA and PRKX. The
inactive PKA holoenzyme is a heterotetramer composed of
two phosphorylated and active catalytic (C) subunits
with a dimer of regulatory (R) subunits. Activation is
achieved through the binding of the important second
messenger cAMP to the R subunits, which leads to the
dissociation of PKA into the R dimer and two active C
subunits. PKA is present ubiquitously in cells and
interacts with many different downstream targets. It
plays a role in the regulation of diverse processes such
as growth, development, memory, metabolism, gene
expression, immunity, and lipolysis.
Length = 290
Score = 32.5 bits (75), Expect = 0.006
Identities = 11/20 (55%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
Q+V LEY+HS IV+ D+K
Sbjct: 109 QVVLALEYLHSLDIVYRDLK 128
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
4. Serine/threonine kinases (STKs), yeast
Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The YSK4 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. YSK4 is a
putative MAPKKK, whose mammalian gene has been isolated.
MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals.
Length = 265
Score = 32.6 bits (74), Expect = 0.006
Identities = 10/21 (47%), Positives = 16/21 (76%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
+QI+ G+ Y+H+ +VH DIK
Sbjct: 109 KQILDGVAYLHNNCVVHRDIK 129
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
Protein kinases (PKs), MAP kinase kinase (MAPKK)
subfamily, catalytic (c) domain. PKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The MAPKK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein serine/threonine kinases, protein tyrosine
kinases, RIO kinases, aminoglycoside phosphotransferase,
choline kinase, and phosphoinositide 3-kinase. The
mitogen-activated protein (MAP) kinase signaling
pathways are important mediators of cellular responses
to extracellular signals. The pathways involve a triple
kinase core cascade comprising the MAP kinase (MAPK),
which is phosphorylated and activated by a MAPK kinase
(MAPKK or MKK or MAP2K), which itself is phosphorylated
and activated by a MAPK kinase kinase (MAPKKK or MKKK or
MAP3K). MAPKKs are dual-specificity PKs that
phosphorylate their downstream targets, MAPKs, at
specific threonine and tyrosine residues. There are
three MAPK subfamilies: extracellular signal-regulated
kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
mammalian cells, there are seven MAPKKs (named MKK1-7)
and 20 MAPKKKs. Each MAPK subfamily can be activated by
at least two cognate MAPKKs and by multiple MAPKKKs.
Length = 265
Score = 32.7 bits (75), Expect = 0.006
Identities = 9/24 (37%), Positives = 16/24 (66%), Gaps = 1/24 (4%)
Query: 45 IFRQIVQGLEYIHSQ-GIVHHDIK 67
I +++GL Y+H + I+H D+K
Sbjct: 105 IAVAVLKGLTYLHEKHKIIHRDVK 128
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
Serine/Threonine Kinase, Traf2- and Nck-interacting
kinase. Serine/threonine kinases (STKs), Traf2- and
Nck-interacting kinase (TNIK) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The TNIK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily contain an N-terminal catalytic domain and a
C-terminal citron homology (CNH) regulatory domain,
similar to mitogen-activated protein kinase (MAPK),
kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks
participate in some MAPK signaling pathways by
activating a MAPK kinase kinase (MAPKKK or MAP3K or
MKKK). TNIK is an effector of Rap2, a small GTP-binding
protein from the Ras family. TNIK specifically activates
the c-Jun N-terminal kinase (JNK) pathway and plays a
role in regulating the actin cytoskeleton.
Length = 272
Score = 32.8 bits (74), Expect = 0.006
Identities = 11/29 (37%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ + YI R+I++GL ++H ++H DIK
Sbjct: 110 EEWIAYICREILRGLSHLHQHKVIHRDIK 138
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein
Tyrosine Kinases, Janus kinases. Protein Tyrosine
Kinase (PTK) family; Janus kinase (Jak) subfamily;
catalytic (c) domain (repeat 2). The Jak subfamily is
composed of Jak1, Jak2, Jak3, TYK2, and similar
proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
Jak subfamily proteins are cytoplasmic (or nonreceptor)
tyr kinases containing an N-terminal FERM domain,
followed by a Src homology 2 (SH2) domain, a
pseudokinase domain, and a C-terminal tyr kinase
catalytic domain. Most Jaks are expressed in a wide
variety of tissues, except for Jak3, which is expressed
only in hematopoietic cells. Jaks are crucial for
cytokine receptor signaling. They are activated by
autophosphorylation upon cytokine-induced receptor
aggregation, and subsequently trigger downstream
signaling events such as the phosphorylation of signal
transducers and activators of transcription (STATs).
Jaks are also involved in regulating the surface
expression of some cytokine receptors. The Jak-STAT
pathway is involved in many biological processes
including hematopoiesis, immunoregulation, host defense,
fertility, lactation, growth, and embryogenesis.
Length = 284
Score = 32.4 bits (74), Expect = 0.006
Identities = 9/35 (25%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 32 NAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
+ +Q++ + +++ QI +G++Y+ SQ +H D+
Sbjct: 102 HRDQINLKRLLLFSS-QICKGMDYLGSQRYIHRDL 135
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
(MEKK1) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK1 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates MAPK kinases (MAPKKs or
MKKs or MAP2Ks), which in turn phosphorylate and
activate MAPKs during signaling cascades that are
important in mediating cellular responses to
extracellular signals. MEKK1 activates the extracellular
signal-regulated kinase 1/2 (ERK1/2) and c-Jun
N-terminal kinase (JNK) pathways by activating their
respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
MEKK1 is important in regulating cell survival and
apoptosis. MEKK1 also plays a role in cell migration,
tissue maintenance and homeostasis, and wound healing.
Length = 268
Score = 32.5 bits (74), Expect = 0.007
Identities = 9/21 (42%), Positives = 15/21 (71%)
Query: 47 RQIVQGLEYIHSQGIVHHDIK 67
Q+++GL Y+H I+H D+K
Sbjct: 110 EQLLRGLSYLHENQIIHRDVK 130
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
dual-specificity MAP kinase kinases. Protein kinases
(PKs), MAP kinase kinase(MAPKK) subfamily, fungal
Pek1-like proteins, catalytic (c) domain. PKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The MAPKK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein serine/threonine kinases, protein tyrosine
kinases, RIO kinases, aminoglycoside phosphotransferase,
choline kinase, and phosphoinositide 3-kinase. The
mitogen-activated protein (MAP) kinase signaling
pathways are important mediators of cellular responses
to extracellular signals. The pathways involve a triple
kinase core cascade comprising of the MAP kinase (MAPK),
which is phosphorylated and activated by a MAPK kinase
(MAPKK or MKK), which itself is phosphorylated and
activated by a MAPK kinase kinase (MAPKKK or MKKK).
Members of this group include the MAPKKs Pek1/Skh1 from
Schizosaccharomyces pombe and MKK2 from Saccharomyces
cerevisiae, and related proteins. Both fission yeast
Pek1 and baker's yeast MKK2 are components of the cell
integrity MAPK pathway. In fission yeast, Pek1
phosphorylates and activates the MAPK Pmk1/Spm1 and is
regulated by the MAPKKK Mkh1. In baker's yeast, the
pathway involves the MAPK Slt2, the MAPKKs MKK1 and
MKK2, and the MAPKKK Bck1. The cell integrity MAPK
cascade is activated by multiple stress conditions, and
is essential in cell wall construction, morphogenesis,
cytokinesis, and ion homeostasis.
Length = 287
Score = 32.4 bits (74), Expect = 0.007
Identities = 10/19 (52%), Positives = 16/19 (84%)
Query: 49 IVQGLEYIHSQGIVHHDIK 67
+++GL Y+HS+ I+H DIK
Sbjct: 114 VLKGLSYLHSRKIIHRDIK 132
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 5.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 5, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK5 belongs to group II. Group II PAKs contain a PBD
(p21-binding domain) and a C-terminal catalytic domain,
but do not harbor an AID (autoinhibitory domain) or SH3
binding sites. PAK5 is mainly expressed in the brain. It
is not required for viability, but together with PAK6,
it is required for normal levels of locomotion and
activity, and for learning and memory. PAK5 cooperates
with Inca (induced in neural crest by AP2) in the
regulation of cell adhesion and cytoskeletal
organization in the embryo and in neural crest cells
during craniofacial development. PAK5 may also play a
role in controlling the signaling of Raf-1, an effector
of Ras, at the mitochondria.
Length = 292
Score = 32.3 bits (73), Expect = 0.007
Identities = 10/29 (34%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++Q+ + +++ L Y+H+QG++H DIK
Sbjct: 117 EEQIATVCLSVLRALSYLHNQGVIHRDIK 145
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine
Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
JNK2 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. JNKs are mitogen-activated protein kinases
(MAPKs) that are involved in many stress-activated
responses including those during inflammation,
neurodegeneration, apoptosis, and persistent pain
sensitization, among others. Vetebrates harbor three
different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
JNK2, is expressed in every cell and tissue type.
Initially it was thought that JNK1 and JNK2 were
functionally redundant as mice deficient in either genes
(Jnk1 or Jnk2) could survive but disruption of both
genes resulted in lethality. However, recent studies
have shown that JNK1 and JNK2 perform distinct functions
through specific binding partners and substrates. JNK2
is specifically translocated to the mitochondria during
dopaminergic cell death. Specific substrates include the
microtubule-associated proteins DCX and Tau, as well as
TIF-IA which is involved in ribosomal RNA synthesis
regulation. Mice deficient in Jnk2 show protection
against arthritis, type 1 diabetes, atherosclerosis,
abdominal aortic aneurysm, cardiac cell death,
TNF-induced liver damage, and tumor growth, indicating
that JNK2 may play roles in the pathogenesis of these
diseases.
Length = 359
Score = 32.3 bits (73), Expect = 0.007
Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 9/63 (14%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVM-YIFRQIVQGLEYIHSQGIVHH 64
E++ +Y+ M+L L Q + + D + M Y+ Q++ G++++HS GI+H
Sbjct: 96 EEFQDVYLVMELMDANLCQVI--------HMELDHERMSYLLYQMLCGIKHLHSAGIIHR 147
Query: 65 DIK 67
D+K
Sbjct: 148 DLK 150
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
Serine/Threonine Kinases, Never In Mitosis gene
A-related kinase 6 and 7. Serine/Threonine Kinases
(STKs), Never In Mitosis gene A (NIMA)-related kinase 6
(Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The Nek6/7 subfamily is part of a family of 11 different
Neks (Nek1-11) that are involved in cell cycle control.
The Nek family is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Nek6 and Nek7 are the shortest Neks,
consisting only of the catalytic domain and a very short
N-terminal extension. They show distinct expression
patterns and both appear to be downstream substrates of
Nek9. They are required for mitotic spindle formation
and cytokinesis. They may also be regulators of the p70
ribosomal S6 kinase.
Length = 267
Score = 32.4 bits (74), Expect = 0.008
Identities = 11/29 (37%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ + F Q+ LE++HS+ I+H DIK
Sbjct: 105 ERTIWKYFVQLCSALEHMHSKRIMHRDIK 133
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 6.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase 6 (CDK6) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK6 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK6
is regulated by D-type cyclins and INK4 inhibitors. It
is active towards the retinoblastoma (pRb) protein,
implicating it to function in regulating the early G1
phase of the cell cycle. It is expressed ubiquitously
and is localized in the cytoplasm. It is also present in
the ruffling edge of spreading fibroblasts and may play
a role in cell spreading. It binds to the p21 inhibitor
without any effect on its own activity and it is
overexpressed in squamous cell carcinomas and
neuroblastomas. CDK6 has also been shown to inhibit cell
differentiation in many cell types.
Length = 290
Score = 32.3 bits (73), Expect = 0.009
Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 3/28 (10%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
K +M+ Q+++GL+++HS +VH D+K
Sbjct: 113 KDMMF---QLLRGLDFLHSHRVVHRDLK 137
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 1.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 1, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK1 belongs to group I. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). PAK1 is
important in the regulation of many cellular processes
including cytoskeletal dynamics, cell motility, growth,
and proliferation. Although PAK1 has been regarded
mainly as a cytosolic protein, recent reports indicate
that PAK1 also exists in significant amounts in the
nucleus, where it is involved in transcription
modulation and in cell cycle regulatory events. PAK1 is
also involved in transformation and tumorigenesis. Its
overexpression, hyperactivation and increased nuclear
accumulation is correlated to breast cancer invasiveness
and progression. Nuclear accumulation is also linked to
tamoxifen resistance in breast cancer cells.
Length = 296
Score = 32.0 bits (72), Expect = 0.009
Identities = 11/27 (40%), Positives = 19/27 (70%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ + R+ +Q LE++HS ++H DIK
Sbjct: 117 QIAAVCRECLQALEFLHSNQVIHRDIK 143
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase like 1 (CDKL1) and CDKL4 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDKL1 and CDKL4
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDKL1, also called
p42 KKIALRE, is a glial protein that is upregulated in
gliosis. It is present in neuroblastoma and A431 human
carcinoma cells, and may be implicated in neoplastic
transformation. The function of CDKL4 is unknown.
Length = 286
Score = 32.0 bits (73), Expect = 0.010
Identities = 7/29 (24%), Positives = 14/29 (48%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ + I Q +Q + + H +H D+K
Sbjct: 99 EHLIKKIIWQTLQAVNFCHKHNCIHRDVK 127
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 2.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 2, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK2 belongs to group I. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). PAK2 plays a
role in pro-apoptotic signaling. It is cleaved and
activated by caspases leading to morphological changes
during apoptosis. PAK2 is also activated in response to
a variety of stresses including DNA damage,
hyperosmolarity, serum starvation, and contact
inhibition, and may play a role in coordinating the
stress response. PAK2 also contributes to cancer cell
invasion through a mechanism distinct from that of PAK1.
Length = 296
Score = 32.0 bits (72), Expect = 0.012
Identities = 10/29 (34%), Positives = 20/29 (68%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q+ + R+ +Q LE++H+ ++H DIK
Sbjct: 114 EAQIAAVCRECLQALEFLHANQVIHRDIK 142
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
Serine/Threonine Kinase, cGMP-dependent protein kinase.
Serine/Threonine Kinases (STKs), cGMP-dependent protein
kinase (cGK or PKG) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The cGK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Mammals have two cGK isoforms
from different genes, cGKI and cGKII. cGKI exists as two
splice variants, cGKI-alpha and cGKI-beta. cGK consists
of an N-terminal regulatory domain containing a
dimerization and an autoinhibitory pseudosubstrate
region, two cGMP-binding domains, and a C-terminal
catalytic domain. Binding of cGMP to both binding sites
releases the inhibition of the catalytic center by the
pseudosubstrate region, allowing autophosphorylation and
activation of the kinase. cGKI is a soluble protein
expressed in all smooth muscles, platelets, cerebellum,
and kidney. It is also expressed at lower concentrations
in other tissues. cGKII is a membrane-bound protein that
is most abundantly expressed in the intestine. It is
also present in the brain nuclei, adrenal cortex,
kidney, lung, and prostate. cGKI is involved in the
regulation of smooth muscle tone, smooth cell
proliferation, and platelet activation. cGKII plays a
role in the regulation of secretion, such as renin
secretion by the kidney and aldosterone secretion by the
adrenal. It also regulates bone growth and the circadian
rhythm.
Length = 262
Score = 31.4 bits (72), Expect = 0.013
Identities = 8/20 (40%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+V EY+H++GI++ D+K
Sbjct: 101 CVVLAFEYLHNRGIIYRDLK 120
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
Phosphotransferases. The specificity of this class of
kinases can not be predicted. Possible dual-specificity
Ser/Thr/Tyr kinase.
Length = 258
Score = 31.4 bits (72), Expect = 0.014
Identities = 8/19 (42%), Positives = 14/19 (73%)
Query: 48 QIVQGLEYIHSQGIVHHDI 66
QI +G+EY+ S+ +H D+
Sbjct: 111 QIARGMEYLESKNFIHRDL 129
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
Serine/Threonine Kinase, Microtubule-associated
serine/threonine-like kinase. Serine/Threonine Kinases
(STKs), Microtubule-associated serine/threonine (MAST)
kinase subfamily, MAST-like (MASTL) kinases, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAST kinase
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MAST kinases contain an N-terminal domain of
unknown function, a central catalytic domain, and a
C-terminal PDZ domain that mediates protein-protein
interactions. The MASTL kinases in this group carry only
a catalytic domain, which contains a long insertion
relative to MAST kinases. The human MASTL gene has also
been labelled FLJ14813. A missense mutation in FLJ14813
is associated with autosomal dominant thrombocytopenia.
To date, the function of MASTL is unknown.
Length = 669
Score = 31.8 bits (72), Expect = 0.014
Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
V YI ++ L+Y+H GI+H D+K
Sbjct: 107 VKYI-SEVALALDYLHRHGIIHRDLK 131
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
Kinases, Cyclin-Dependent protein Kinase 2 and 3.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK2/3 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDK2 is regulated by cyclin E or cyclin A.
Upon activation by cyclin E, it phosphorylates the
retinoblastoma (pRb) protein which activates E2F
mediated transcription and allows cells to move into S
phase. The CDK2/cyclin A complex plays a role in
regulating DNA replication. CDK2, together with CDK4,
also regulates embryonic cell proliferation. Despite
these important roles, mice deleted for the cdk2 gene
are viable and normal except for being sterile. This may
be due to compensation provided by CDK1 (also called
Cdc2), which can also bind cyclin E and drive the G1 to
S phase transition. CDK3 is regulated by cyclin C and it
phosphorylates pRB specifically during the G0/G1
transition. This phosphorylation is required for cells
to exit G0 efficiently and enter the G1 phase.
Length = 284
Score = 31.7 bits (72), Expect = 0.015
Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ + LK+++ S + L K Y+F Q++QGL + HS ++H D+K
Sbjct: 74 LYLVFEFLHQDLKKFMDASPLSGIPLPLIKS--YLF-QLLQGLAFCHSHRVLHRDLK 127
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 5. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek5 subfamily is
one of a family of 11 different Neks (Nek1-11). The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Neks are involved in the regulation of
downstream processes following the activation of Cdc2,
and many of their functions are cell cycle-related. They
play critical roles in microtubule dynamics during
ciliogenesis and mitosis. The specific function of Nek5
is unknown.
Length = 257
Score = 31.5 bits (71), Expect = 0.016
Identities = 13/29 (44%), Positives = 20/29 (68%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q++ F QI GL++IH + I+H DIK
Sbjct: 100 EDQILSWFVQISLGLKHIHDRKILHRDIK 128
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein
Serine/Threonine Kinase, G protein-coupled Receptor
Kinase 1. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily, GRK1
isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The GRK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. GRKs phosphorylate and regulate G
protein-coupled receptors (GPCRs), the largest
superfamily of cell surface receptors, which regulate
some part of nearly all physiological functions.
Phosphorylated GPCRs bind to arrestins, which prevents
further G protein signaling despite the presence of
activating ligand. There are seven types of GRKs, named
GRK1 to GRK7. GRK1, also called rhodopsin kinase,
belongs to the visual group of GRKs and is expressed in
retinal cells. It phosphorylates rhodopsin in rod cells,
which leads to termination of the phototransduction
cascade. Mutations in GRK1 are associated to a
recessively inherited form of stationary nightblindness
called Oguchi disease.
Length = 280
Score = 31.4 bits (71), Expect = 0.016
Identities = 9/20 (45%), Positives = 16/20 (80%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
QI+ GLE++H + I++ D+K
Sbjct: 105 QIISGLEHLHQRRIIYRDLK 124
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein
Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine
Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic
(c) domain (repeat 2). The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Tyk2 is a member of the
Janus kinase (Jak) subfamily of proteins, which are
cytoplasmic (or nonreceptor) tyr kinases containing an
N-terminal FERM domain, followed by a Src homology 2
(SH2) domain, a pseudokinase domain, and a C-terminal
tyr kinase catalytic domain. Jaks are crucial for
cytokine receptor signaling. They are activated by
autophosphorylation upon cytokine-induced receptor
aggregation, and subsequently trigger downstream
signaling events such as the phosphorylation of signal
transducers and activators of transcription (STATs).
Tyk2 is widely expressed in many tissues. It is involved
in signaling via the cytokine receptors IFN-alphabeta,
IL-6, IL-10, IL-12, IL-13, and IL-23. It mediates cell
surface urokinase receptor (uPAR) signaling and plays a
role in modulating vascular smooth muscle cell (VSMC)
functional behavior in response to injury. Tyk2 is also
important in dendritic cell function and T helper (Th)1
cell differentiation. A homozygous mutation of Tyk2 was
found in a patient with hyper-IgE syndrome (HIES), a
primary immunodeficiency characterized by recurrent skin
abscesses, pneumonia, and elevated serum IgE. This
suggests that Tyk2 may play important roles in multiple
cytokine signaling involved in innate and adaptive
immunity.
Length = 283
Score = 31.4 bits (71), Expect = 0.017
Identities = 10/26 (38%), Positives = 18/26 (69%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDI 66
Q++ +QI +G+ Y+HSQ +H D+
Sbjct: 108 QLLLFAQQICEGMAYLHSQHYIHRDL 133
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
Length = 294
Score = 31.3 bits (71), Expect = 0.018
Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ + + LK+ + S A+ K +Y QI++G+ Y HS ++H D+K
Sbjct: 76 LYLVFEYLDLDLKKHMDSSPDFAKNPRLIKTYLY---QILRGIAYCHSHRVLHRDLK 129
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase.
Length = 258
Score = 30.9 bits (71), Expect = 0.020
Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
Query: 32 NAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
+ E+L+ + QI +G+EY+ S+ VH D+
Sbjct: 95 HGEKLTLKDLLQMA-LQIAKGMEYLESKNFVHRDL 128
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional.
Length = 267
Score = 31.0 bits (71), Expect = 0.021
Identities = 11/23 (47%), Positives = 16/23 (69%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
I RQ+V+ L +H I+H+DIK
Sbjct: 114 IIRQLVEALNDLHKHNIIHNDIK 136
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine
Kinase, Thousand-and-one amino acids proteins.
Serine/threonine kinases (STKs), thousand-and-one amino
acids (TAO) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. They activate the MAPKs, p38 and c-Jun
N-terminal kinase (JNK), by phosphorylating and
activating the respective MAP/ERK kinases (MEKs, also
known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK
signaling cascades are important in mediating cellular
responses to extracellular signals. Vertebrates contain
three TAO subfamily members, named TAO1, TAO2, and TAO3.
Length = 307
Score = 30.9 bits (70), Expect = 0.021
Identities = 11/23 (47%), Positives = 14/23 (60%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
I +QGL Y+HS +H DIK
Sbjct: 120 ICHGALQGLAYLHSHERIHRDIK 142
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to
tyrosine kinase). Protein Tyrosine Kinase (PTK) family;
Receptor related to tyrosine kinase (Ryk); pseudokinase
domain. The PTKc (catalytic domain) family to which this
subfamily belongs, is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Ryk is a
receptor tyr kinase (RTK) containing an extracellular
region with two leucine-rich motifs, a transmembrane
segment, and an intracellular inactive pseudokinase
domain. The extracellular region of Ryk shows homology
to the N-terminal domain of Wnt inhibitory factor-1
(WIF) and serves as the ligand (Wnt) binding domain of
Ryk. Ryk is expressed in many different tissues both
during development and in adults, suggesting a
widespread function. It acts as a chemorepulsive axon
guidance receptor of Wnt glycoproteins and is
responsible for the establishment of axon tracts during
the development of the central nervous system. In
addition, studies in mice reveal that Ryk is essential
in skeletal, craniofacial, and cardiac development.
Thus, it appears Ryk is involved in signal transduction
despite its lack of kinase activity. Ryk may function as
an accessory protein that modulates the signals coming
from catalytically active partner RTKs such as the Eph
receptors.
Length = 280
Score = 30.8 bits (70), Expect = 0.022
Identities = 9/19 (47%), Positives = 14/19 (73%)
Query: 48 QIVQGLEYIHSQGIVHHDI 66
QI G+ Y+H +G++H DI
Sbjct: 125 QIACGMSYLHKRGVIHKDI 143
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 1. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek1 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek1 is
associated with centrosomes throughout the cell cycle.
It is involved in the formation of primary cilium and in
the maintenance of centrosomes. It cycles through the
nucleus and may be capable of relaying signals between
the cilium and the nucleus. Nek1 is implicated in the
development of polycystic kidney disease, which is
characterized by benign polycystic tumors formed by
abnormal overgrowth of renal epithelial cells. It
appears also to be involved in DNA damage response, and
may be important for both correct DNA damage checkpoint
activation and DNA repair.
Length = 256
Score = 31.0 bits (70), Expect = 0.023
Identities = 11/29 (37%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q++ F QI L+++H + I+H DIK
Sbjct: 100 EDQILDWFVQICLALKHVHDRKILHRDIK 128
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 4.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 4, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK4 belongs to group II. Group II PAKs contain a PBD
(p21-binding domain) and a C-terminal catalytic domain,
but do not harbor an AID (autoinhibitory domain) or SH3
binding sites. PAK4 regulates cell morphology and
cytoskeletal organization. It is essential for embryonic
viability and proper neural development. Mice lacking
PAK4 die due to defects in the fetal heart. In addition,
their spinal cord motor neurons showed failure to
differentiate and migrate. PAK4 also plays a role in
cell survival and tumorigenesis. It is overexpressed in
many primary tumors including colon, esophageal, and
mammary tumors. PAK4 has also been implicated in viral
and bacterial infection pathways.
Length = 292
Score = 31.1 bits (70), Expect = 0.023
Identities = 9/29 (31%), Positives = 20/29 (68%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++Q+ + +++ L +H+QG++H DIK
Sbjct: 115 EEQIAAVCLAVLKALSVLHAQGVIHRDIK 143
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 3.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 3, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK3 belongs to group I. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). PAK3 is
highly expressed in the brain. It is implicated in
neuronal plasticity, synapse formation, dendritic spine
morphogenesis, cell cycle progression, neuronal
migration, and apoptosis. Inactivating mutations in the
PAK3 gene cause X-linked non-syndromic mental
retardation, the severity of which depends on the site
of the mutation.
Length = 297
Score = 30.8 bits (69), Expect = 0.025
Identities = 10/27 (37%), Positives = 19/27 (70%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Q+ + R+ +Q L+++HS ++H DIK
Sbjct: 116 QIAAVCRECLQALDFLHSNQVIHRDIK 142
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), cAMP-dependent protein kinase (PKA) subfamily,
PRKX-like kinases, catalytic (c) subunit. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PKA
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include human PRKX (X
chromosome-encoded protein kinase), Drosophila DC2, and
similar proteins. PRKX is present in many tissues
including fetal and adult brain, kidney, and lung. The
PRKX gene is located in the Xp22.3 subregion and has a
homolog called PRKY on the Y chromosome. An abnormal
interchange between PRKX aand PRKY leads to the sex
reversal disorder of XX males and XY females. PRKX is
implicated in granulocyte/macrophage lineage
differentiation, renal cell epithelial migration, and
tubular morphogenesis in the developing kidney.
Length = 291
Score = 30.9 bits (70), Expect = 0.026
Identities = 11/20 (55%), Positives = 16/20 (80%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+IV LEY+HS+ IV+ D+K
Sbjct: 109 EIVCALEYLHSKEIVYRDLK 128
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
protein Kinase 8-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK8-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. This subfamily is
composed of CDK8, CDC2L6, and similar proteins. CDK8
functions as a negative or positive regulator of
transcription, depending on the scenario. Together with
its regulator, cyclin C, it reversibly associates with
the multi-subunit core Mediator complex, a cofactor that
is involved in regulating RNA polymerase II (RNAP
II)-dependent transcription. CDC2L6 also associates with
Mediator in complexes lacking CDK8. In VP16-dependent
transcriptional activation, CDK8 and CDC2L6 exerts
opposing effects by positive and negative regulation,
respectively, in similar conditions.
Length = 316
Score = 30.7 bits (70), Expect = 0.027
Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 3/28 (10%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
K +++ QI+ G+ Y+HS ++H D+K
Sbjct: 111 KSLLW---QILNGVHYLHSNWVLHRDLK 135
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine
Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases
(STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PFTAIRE-2 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PFTAIRE-2 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PFTAIRE-2 is also
referred to as ALS2CR7 (amyotrophic lateral sclerosis 2
(juvenile) chromosome region candidate 7). It may be
associated with amyotrophic lateral sclerosis 2 (ALS2),
an autosomal recessive form of juvenile ALS. The
function of PFTAIRE-2 is not yet known.
Length = 291
Score = 30.7 bits (69), Expect = 0.028
Identities = 12/26 (46%), Positives = 17/26 (65%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
V Q+++GL YIH Q I+H D+K
Sbjct: 105 VRLFMFQLLRGLAYIHGQHILHRDLK 130
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
Kinase, Protein Kinase B. Serine/Threonine Kinases
(STKs), Protein Kinase B (PKB) or Akt subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase (PI3K). There are
three PKB isoforms from different genes, PKB-alpha (or
Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. It is activated
downstream of PI3K and plays important roles in diverse
cellular functions including cell survival, growth,
proliferation, angiogenesis, motility, and migration.
PKB also has a central role in a variety of human
cancers, having been implicated in tumor initiation,
progression, and metastasis.
Length = 323
Score = 30.9 bits (70), Expect = 0.028
Identities = 9/20 (45%), Positives = 14/20 (70%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+IV L Y+HS +V+ D+K
Sbjct: 103 EIVSALGYLHSCDVVYRDLK 122
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
Serine/Threonine Kinase, Protein Kinase B beta.
Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. There are three
PKB isoforms from different genes, PKB-alpha (or Akt1),
PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. PKB-beta is the
predominant PKB isoform expressed in insulin-responsive
tissues. It plays a critical role in the regulation of
glucose homeostasis. It is also implicated in muscle
cell differentiation. Mice deficient in PKB-beta display
normal growth weights but exhibit severe insulin
resistance and diabetes, accompanied by lipoatrophy and
B-cell failure.
Length = 323
Score = 30.7 bits (69), Expect = 0.029
Identities = 11/20 (55%), Positives = 16/20 (80%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+IV LEY+HS+ +V+ DIK
Sbjct: 103 EIVSALEYLHSRDVVYRDIK 122
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 5.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 5 (CDK5) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK5 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK5
is unusual in that it is regulated by non-cyclin
proteins, p35 and p39. It is highly expressed in the
nervous system and is critical in normal neural
development and function. It plays a role in neuronal
migration and differentiation, and is also important in
synaptic plasticity and learning. CDK5 also participates
in protecting against cell death and promoting
angiogenesis. Impaired CDK5 activity is implicated in
Alzheimer's disease, amyotrophic lateral sclerosis,
Parkinson's disease, Huntington's disease and acute
neuronal injury.
Length = 284
Score = 30.5 bits (69), Expect = 0.031
Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
Query: 11 LYIQMQLCQITLKQWL-SCSTYNAEQLSYDKQVMYIFR-QIVQGLEYIHSQGIVHHDIK 67
L + + C LK++ SC+ D +++ F Q+++GL + HS ++H D+K
Sbjct: 74 LTLVFEYCDQDLKKYFDSCNGD------IDPEIVKSFMFQLLKGLAFCHSHNVLHRDLK 126
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase,
Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK)
family; Focal Adhesion Kinase (FAK); catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FAK is a
cytoplasmic (or nonreceptor) tyr kinase that contains an
autophosphorylation site and a FERM domain at the
N-terminus, a central tyr kinase domain, proline-rich
regions, and a C-terminal FAT (focal adhesion targeting)
domain. FAK activity is dependent on integrin-mediated
cell adhesion, which facilitates N-terminal
autophosphorylation. Full activation is achieved by the
phosphorylation of its two adjacent A-loop tyrosines.
FAK is important in mediating signaling initiated at
sites of cell adhesions and at growth factor receptors.
Through diverse molecular interactions, FAK functions as
a biosensor or integrator to control cell motility. It
is a key regulator of cell survival, proliferation,
migration and invasion, and thus plays an important role
in the development and progression of cancer. Src binds
to autophosphorylated FAK forming the FAK-Src dual
kinase complex, which is activated in a wide variety of
tumor cells and generates signals promoting growth and
metastasis. FAK is being developed as a target for
cancer therapy.
Length = 270
Score = 30.5 bits (69), Expect = 0.032
Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 5/57 (8%)
Query: 11 LYIQMQLCQI-TLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
++I M+L + L+ +L N L ++Y + Q+ L Y+ S+ VH DI
Sbjct: 81 VWIVMELAPLGELRSYL---QVNKYSLDLASLILYSY-QLSTALAYLESKRFVHRDI 133
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
Length = 335
Score = 30.5 bits (69), Expect = 0.032
Identities = 10/28 (35%), Positives = 15/28 (53%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
+ QV I QI+ GL +H +H D+
Sbjct: 118 ESQVKCILLQILNGLNVLHKWYFMHRDL 145
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related
kinase adapter protein alpha. Protein Kinase family,
STE20-related kinase adapter protein (STRAD) alpha
subfamily, pseudokinase domain. The STRAD alpha
subfamily is part of a larger superfamily that includes
the catalytic domains of serine/threonine kinases
(STKs), protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The pseudokinase domain shows
similarity to protein kinases but lacks crucial residues
for catalytic activity. STRAD forms a complex with the
scaffolding protein MO25, and the STK, LKB1, resulting
in the activation of the kinase. In the complex, LKB1
phosphorylates and activates adenosine
monophosphate-activated protein kinases (AMPKs), which
regulate cell energy metabolism and cell polarity. LKB1
is a tumor suppressor linked to the rare inherited
disease, Peutz-Jeghers syndrome, which is characterized
by a predisposition to benign polyps and
hyperpigmentation of the buccal mucosa. There are two
forms of STRAD, alpha and beta, that complex with LKB1
and MO25. The structure of STRAD-alpha is available and
shows that this protein binds ATP, has an ordered
activation loop, and adopts a closed conformation
typical of fully active protein kinases. It does not
possess activity due to nonconservative substitutions of
essential catalytic residues. ATP binding enhances the
affinity of STRAD for MO25. The conformation of
STRAD-alpha, stabilized through ATP and MO25, may be
needed to activate LKB1. A mutation which results in a
truncation of a C-terminal part of the human STRAD-alpha
pseudokinase domain and disrupts its association with
LKB1, leads to PMSE (polyhydramnios, megalencephaly,
symptomatic epilepsy) syndrome. Several splice variants
of STRAD-alpha exist which exhibit different effects on
the localization and activation of LKB1.
Length = 327
Score = 30.3 bits (68), Expect = 0.037
Identities = 10/26 (38%), Positives = 17/26 (65%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ YI + +++ L+YIH G VH +K
Sbjct: 103 IAYILQGVLKALDYIHHMGYVHRSVK 128
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 4.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase 4 (CDK4) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK4 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK4
partners with all three D-type cyclins (D1, D2, and D3)
and is also regulated by INK4 inhibitors. It is active
towards the retinoblastoma (pRb) protein and plays a
role in regulating the early G1 phase of the cell cycle.
It is expressed ubiquitously and is localized in the
nucleus. CDK4 also shows kinase activity towards Smad3,
a signal transducer of transforming growth factor
(TGF)-beta signaling which modulates transcription and
plays a role in cell proliferation and apoptosis. CDK4
is inhibited by the p21 inhibitor and is specifically
mutated in human melanoma.
Length = 288
Score = 30.3 bits (68), Expect = 0.039
Identities = 10/23 (43%), Positives = 18/23 (78%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
+ RQ ++GL+++H+ IVH D+K
Sbjct: 113 LMRQFLRGLDFLHANCIVHRDLK 135
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
protein Kinase 1-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. This subfamily is composed of CDK1 from higher
eukaryotes, plants, and yeasts, as well as CDK2 and
CDK3. CDK1 is also called Cell division control protein
2 (Cdc2) or p34 protein kinase, and is regulated by
cyclins A, B, and E. The CDK1/cyclin A complex controls
G2 phase entry and progression while the CDK1/cyclin B
complex is critical for G2 to M phase transition. CDK2
is regulated by cyclin E or cyclin A. Upon activation by
cyclin E, it phosphorylates the retinoblastoma (pRb)
protein which activates E2F mediated transcription and
allows cells to move into S phase. The CDK2/cyclin A
complex plays a role in regulating DNA replication.
Studies in knockout mice revealed that CDK1 can
compensate for the loss of the cdk2 gene as it can also
bind cyclin E and drive G1 to S phase transition. CDK3
is regulated by cyclin C and it phosphorylates pRB
specifically during the G0/G1 transition. This
phosphorylation is required for cells to exit G0
efficiently and enter the G1 phase.
Length = 283
Score = 30.4 bits (69), Expect = 0.040
Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 3/28 (10%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
K +Y Q++QG+ Y HS ++H D+K
Sbjct: 102 KSYLY---QLLQGIAYCHSHRVLHRDLK 126
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional.
Length = 391
Score = 30.3 bits (68), Expect = 0.040
Identities = 9/26 (34%), Positives = 18/26 (69%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ I R +++ ++Y+H I+H DIK
Sbjct: 184 ILAIERSVLRAIQYLHENRIIHRDIK 209
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
Kinase, G protein-coupled Receptor Kinase.
Serine/Threonine Kinases (STKs), G protein-coupled
Receptor Kinase (GRK) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The GRK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. GRKs phosphorylate and
regulate G protein-coupled receptors (GPCRs), the
largest superfamily of cell surface receptors, which
regulate some part of nearly all physiological
functions. Phosphorylated GPCRs bind to arrestins, which
prevents further G protein signaling despite the
presence of activating ligand. GRKs contain a central
catalytic domain, flanked by N- and C-terminal
extensions. The N-terminus contains an RGS (regulator of
G protein signaling) homology (RH) domain and several
motifs. The C-terminus diverges among different groups
of GRKs. There are seven types of GRKs, named GRK1 to
GRK7. They are subdivided into three main groups: visual
(GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
widespread while GRK1/4/7 show a limited tissue
distribution. The substrate spectrum of the widely
expressed GRKs partially overlaps. GRKs play important
roles in the cardiovascular, immune, respiratory,
skeletal, and nervous systems.
Length = 277
Score = 30.2 bits (68), Expect = 0.044
Identities = 12/38 (31%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
Query: 31 YNAEQLSYDK-QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
YN + + + + ++ QI+ GLE++H + IV+ D+K
Sbjct: 85 YNVGEPGFPEARAIFYAAQIICGLEHLHQRRIVYRDLK 122
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
Phototropin-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Phototropin-like
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
phototropin-like subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Included in this subfamily
are plant phototropins and predominantly uncharacterized
fungal STKs whose catalytic domains resemble the
phototropin kinase domain. One protein from Neurospora
crassa is called nrc-2. Phototropins are blue-light
receptors that control responses such as phototropism,
stromatal opening, and chloroplast movement in order to
optimize the photosynthetic efficiency of plants. They
are light-activated STKs that contain an N-terminal
photosensory domain and a C-terminal catalytic domain.
The N-terminal domain contains two LOV (Light, Oxygen or
Voltage) domains that binds FMN. Photoexcitation of the
LOV domains results in autophosphorylation at multiple
sites and activation of the catalytic domain. Neurospora
crassa nrc-2 plays a role in growth and development by
controlling entry into the conidiation program.
Length = 316
Score = 29.9 bits (68), Expect = 0.046
Identities = 9/20 (45%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+++ LEY+H GIV+ D+K
Sbjct: 111 EVLLALEYLHLLGIVYRDLK 130
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C theta.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), theta isoform, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The nPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. nPKCs are calcium-independent,
but require DAG (1,2-diacylglycerol) and
phosphatidylserine (PS) for activity. There are four
nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta
is selectively expressed in T-cells and plays an
important and non-redundant role in several aspects of
T-cell biology. Although T-cells also express other PKC
isoforms, PKC-theta is unique in that upon antigen
stimulation, it is translocated to the plasma membrane
at the immunological synapse, where it mediates signals
essential for T-cell activation. It is essential for
TCR-induced proliferation, cytokine production, T-cell
survival, and the differentiation and effector function
of T-helper (Th) cells, particularly Th2 and Th17.
PKC-theta is being developed as a therapeutic target for
Th2-mediated allergic inflammation and Th17-mediated
autoimmune diseases.
Length = 316
Score = 30.3 bits (68), Expect = 0.046
Identities = 10/20 (50%), Positives = 18/20 (90%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+I+ GL+++HS+GIV+ D+K
Sbjct: 104 EIICGLQFLHSKGIVYRDLK 123
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
Serine/Threonine Kinases, TDY Mitogen-Activated Protein
Kinases from Plants. Serine/Threonine Kinases (STKs),
Plant TDY Mitogen-Activated Protein Kinase (MAPK)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The TDY
MAPK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MAPKs are important mediators of cellular
responses to extracellular signals. In plants, MAPKs are
associated with physiological, developmental, hormonal,
and stress responses. Some plants show numerous gene
duplications of MAPKs. Arabidopsis thaliana harbors at
least 20 MAPKs, named AtMPK1-20. Oryza sativa contains
at least 17 MAPKs. There are two subtypes of plant MAPKs
based on the conserved phosphorylation motif present in
the activation loop, TEY and TDY. Arabidopsis thaliana
contains more TEY-type MAPKs than TDY-type, whereas the
reverse is true for Oryza sativa. This subfamily
represents the TDY subtype and is composed of Group D
plant MAPKs including Arabidopsis thaliana MPK18
(AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
(OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
Zea mays MPK6, and the Medicago sativa TDY1 gene
product. OsBWMK1 enhances resistance to pathogenic
infections. It mediates stress-activated defense
responses by activating a transcription factor that
affects the expression of stress-related genes. AtMPK18
is involved in microtubule-related functions.
Length = 338
Score = 30.1 bits (68), Expect = 0.053
Identities = 8/20 (40%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
Q+++ L+YIH+ + H D+K
Sbjct: 111 QLLRALKYIHTANVFHRDLK 130
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), PCTAIRE-like subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The PCTAIRE-like subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily share sequence similarity with
Cyclin-Dependent Kinases (CDKs), which belong to a large
family of STKs that are regulated by their cognate
cyclins. Together, CDKs and cyclins are involved in the
control of cell-cycle progression, transcription, and
neuronal function. The association of PCTAIRE-like
proteins with cyclins has not been widely studied,
although PFTAIRE-1 has been shown to function as a CDK
which is regulated by cyclin D3 as well as the
membrane-associated cyclin Y. PCTAIRE-like proteins show
unusual expression patterns with high levels in
post-mitotic tissues, suggesting that they may be
involved in regulating post-mitotic cellular events.
Length = 291
Score = 30.0 bits (68), Expect = 0.053
Identities = 8/20 (40%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
Q+++GL Y H + ++H D+K
Sbjct: 111 QLLRGLAYCHQRRVLHRDLK 130
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine
Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases
(STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PFTAIRE-1 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PFTAIRE-1 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PFTAIRE-1 is
widely expressed except in the spleen and thymus. It is
highly expressed in the brain, heart, pancreas, testis,
and ovary, and is localized in the cytoplasm. It is
regulated by cyclin D3 and is inhibited by the p21 cell
cycle inhibitor. It has also been shown to interact with
the membrane-associated cyclin Y, which recruits the
protein to the plasma membrane.
Length = 303
Score = 29.7 bits (66), Expect = 0.065
Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 12/66 (18%)
Query: 5 TEDWVTL---YIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGI 61
T++ +TL Y+ LCQ K + L + +++F Q+++GL YIH + I
Sbjct: 74 TKETLTLVFEYVHTDLCQYMDK--------HPGGLHPENVKLFLF-QLLRGLSYIHQRYI 124
Query: 62 VHHDIK 67
+H D+K
Sbjct: 125 LHRDLK 130
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
Serine/Threonine Kinase, Classical Protein Kinase C.
Serine/Threonine Kinases (STKs), Classical (or
Conventional) Protein Kinase C (cPKC) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The cPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, cPKCs depend on calcium, DAG
(1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. cPKCs contain a
calcium-binding C2 region in their regulatory domain.
There are four cPKC isoforms, named alpha, betaI,
betaII, and gamma. cPKCs are potent kinases for
histones, myelin basic protein, and protamine. PKC-gamma
is mainly expressed in neuronal tissues. It plays a role
in protection from ischemia.
Length = 324
Score = 29.7 bits (67), Expect = 0.070
Identities = 9/20 (45%), Positives = 16/20 (80%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+I GL ++HS+GI++ D+K
Sbjct: 109 EIAIGLFFLHSKGIIYRDLK 128
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine
Kinase, Plant B-type Cyclin-Dependent protein Kinase.
Serine/Threonine Kinases (STKs), Plant B-type
Cyclin-Dependent protein Kinase (CdkB) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CdkB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. The plant-specific B-type CDKs are expressed
from the late S to the M phase of the cell cycle. They
are characterized by the cyclin binding motif
PPT[A/T]LRE. They play a role in controlling mitosis and
integrating developmental pathways, such as stomata and
leaf development. CdkB has been shown to associate with
both cyclin B, which controls G2/M transition, and
cyclin D, which acts as a mediator in linking
extracellular signals to the cell cycle.
Length = 295
Score = 29.4 bits (66), Expect = 0.087
Identities = 13/58 (22%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFR-QIVQGLEYIHSQGIVHHDIK 67
LY+ + LK+++ S + + F Q+++G+ + H G++H D+K
Sbjct: 81 LYLVFEYLDSDLKKFMD-SNGRGPGRPLPAKTIKSFMYQLLKGVAHCHKHGVMHRDLK 137
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 7. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek7 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek7 is required
for mitotic spindle formation and cytokinesis. It is
enriched in the centrosome and is critical for
microtubule nucleation. Nek7 is activated by Nek9 during
mitosis, and may regulate the p70 ribosomal S6 kinase.
Length = 267
Score = 29.2 bits (65), Expect = 0.11
Identities = 12/29 (41%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+K V F Q+ LE++HS+ ++H DIK
Sbjct: 105 EKTVWKYFVQLCSALEHMHSRRVMHRDIK 133
>gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional.
Length = 294
Score = 29.1 bits (65), Expect = 0.11
Identities = 12/23 (52%), Positives = 15/23 (65%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
I + ++ LEYIH GI H DIK
Sbjct: 131 IMKDMLTTLEYIHEHGISHGDIK 153
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein
Serine/Threonine Kinase, 70 kDa ribosomal protein S6
kinase. Serine/Threonine Kinases (STKs), 70 kDa
ribosomal protein S6 kinase (p70S6K) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The p70S6K subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. p70S6K (or S6K)
contains only one catalytic kinase domain, unlike p90
ribosomal S6 kinases (RSKs). It acts as a downstream
effector of the STK mTOR (mammalian Target of Rapamycin)
and plays a role in the regulation of the translation
machinery during protein synthesis. p70S6K also plays a
pivotal role in regulating cell size and glucose
homeostasis. Its targets include S6, the translation
initiation factor eIF3, and the insulin receptor
substrate IRS-1, among others. Mammals contain two
isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta).
Length = 323
Score = 29.0 bits (65), Expect = 0.12
Identities = 9/20 (45%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+I LE++H QGI++ D+K
Sbjct: 108 EISLALEHLHQQGIIYRDLK 127
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled
Receptor Kinase 4-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), G protein-coupled
Receptor Kinase (GRK) subfamily, GRK4-like group,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The GRK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. GRKs
phosphorylate and regulate G protein-coupled receptors
(GPCRs), the largest superfamily of cell surface
receptors which regulate some part of nearly all
physiological functions. Phosphorylated GPCRs bind to
arrestins, which prevents further G protein signaling
despite the presence of activating ligand. There are
seven types of GRKs, named GRK1 to GRK7. Members of the
GRK4-like group include GRK4, GRK5, GRK6, and similar
GRKs. GRKs in this group contain an N-terminal RGS
homology (RH) domain and a catalytic domain, but lack a
G protein betagamma-subunit binding domain. They are
localized to the plasma membrane through
post-translational lipid modification or direct binding
to PIP2.
Length = 285
Score = 28.6 bits (64), Expect = 0.14
Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
Query: 31 YNAEQLSYDKQ-VMYIFRQIVQGLEYIHSQGIVHHDIK 67
YN +D++ ++ +I GLE +H + IV+ D+K
Sbjct: 92 YNMGNPGFDEERAVFYAAEITCGLEDLHRERIVYRDLK 129
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein
Serine/Threonine Kinase, G protein-coupled Receptor
Kinase 5. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily, GRK5
isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The GRK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. GRKs phosphorylate and regulate G
protein-coupled receptors (GPCRs), the largest
superfamily of cell surface receptors which regulate
some part of nearly all physiological functions.
Phosphorylated GPCRs bind to arrestins, which prevents
further G protein signaling despite the presence of
activating ligand. There are seven types of GRKs, named
GRK1 to GRK7. GRK5 is widely expressed in many tissues.
It associates with the membrane though an N-terminal
PIP2 binding domain and also binds phospholipids via its
C-terminus. GRK5 deficiency is associated with early
Alzheimer's disease in humans and mouse models. GRK5
also plays a crucial role in the pathogenesis of
sporadic Parkinson's disease. It participates in the
regulation and desensitization of PDGFRbeta, a receptor
tyrosine kinase involved in a variety of downstream
cellular effects including cell growth, chemotaxis,
apoptosis, and angiogenesis. GRK5 also regulates
Toll-like receptor 4, which is involved in innate and
adaptive immunity.
Length = 285
Score = 28.8 bits (64), Expect = 0.14
Identities = 8/29 (27%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+++ ++ +I+ GLE +H + V+ D+K
Sbjct: 101 EERALFYAAEILCGLEDLHRENTVYRDLK 129
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine
Kinase, Protein Kinase N. Serine/Threonine Kinases
(STKs), Protein Kinase N (PKN) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKN subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKN has a
C-terminal catalytic domain that is highly homologous to
PKCs. Its unique N-terminal regulatory region contains
antiparallel coiled-coil (ACC) domains. In mammals,
there are three PKN isoforms from different genes
(designated PKN-alpha, beta, and gamma), which show
different enzymatic properties, tissue distribution, and
varied functions. PKN can be activated by the small
GTPase Rho, and by fatty acids such as arachidonic and
linoleic acids. It is involved in many biological
processes including cytokeletal regulation, cell
adhesion, vesicle transport, glucose transport,
regulation of meiotic maturation and embryonic cell
cycles, signaling to the nucleus, and tumorigenesis.
Length = 324
Score = 28.9 bits (65), Expect = 0.14
Identities = 9/19 (47%), Positives = 14/19 (73%)
Query: 49 IVQGLEYIHSQGIVHHDIK 67
+V GL+Y+H IV+ D+K
Sbjct: 110 VVLGLQYLHENKIVYRDLK 128
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein.
This model represents proteins of 1350 in length, in
multiple species of Burkholderia, in Acidovorax avenae
subsp. citrulli AAC00-1 and Delftia acidovorans SPH-1,
and in multiple copies in Sorangium cellulosum, in
genomic neighborhoods that include a
cyclodehydratase/docking scaffold fusion protein
(TIGR03882) and a member of the thiazole/oxazole
modified metabolite (TOMM) precursor family TIGR03795.
It has a kinase domain in the N-terminal 300 amino
acids, followed by a cyclase homology domain, followed
by regions without named domain definitions. It is a
probable bacteriocin-like metabolite biosynthesis
protein [Cellular processes, Toxin production and
resistance].
Length = 1266
Score = 28.7 bits (64), Expect = 0.14
Identities = 10/20 (50%), Positives = 14/20 (70%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
Q++ L H+QGIVH D+K
Sbjct: 87 QVLDALACAHNQGIVHRDLK 106
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine
Kinase, Ste20-like kinase. Serine/threonine kinases
(STKs), Ste20-like kinase (SLK) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The SLK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. SLK promotes
apoptosis through apoptosis signal-regulating kinase 1
(ASK1) and the mitogen-activated protein kinase (MAPK)
p38. It acts as a MAPK kinase kinase (MAPKKK) by
phosphorylating ASK1, resulting in the phosphorylation
of p38. SLK also plays a role in mediating actin
reorganization. It is part of a microtubule-associated
complex that is targeted at adhesion sites, and is
required in focal adhesion turnover and in regulating
cell migration.
Length = 282
Score = 28.8 bits (64), Expect = 0.15
Identities = 9/29 (31%), Positives = 18/29 (62%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ Q+ + +Q ++ L Y+H I+H D+K
Sbjct: 102 EPQIRVVCKQTLEALNYLHENKIIHRDLK 130
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
Kinase, Protein Kinase C. Serine/Threonine Kinases
(STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, classical PKCs depend on
calcium, DAG (1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. Novel PKCs are
calcium-independent, but require DAG and PS for
activity, while atypical PKCs only require PS. PKCs
phosphorylate and modify the activities of a wide
variety of cellular proteins including receptors,
enzymes, cytoskeletal proteins, transcription factors,
and other kinases. They play a central role in signal
transduction pathways that regulate cell migration and
polarity, proliferation, differentiation, and apoptosis.
Also included in this subfamily are the PKC-like
proteins, called PKNs.
Length = 318
Score = 28.5 bits (64), Expect = 0.16
Identities = 9/20 (45%), Positives = 17/20 (85%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+IV GL+++H +GI++ D+K
Sbjct: 104 EIVLGLQFLHERGIIYRDLK 123
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 8. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek8 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek8 contains an
N-terminal kinase catalytic domain and a C-terminal RCC1
(regulator of chromosome condensation) domain. A double
point mutation in Nek8 causes cystic kidney disease in
mice that genetically resembles human autosomal
recessive polycystic kidney disease (ARPKD). Nek8 is
also associated with a rare form of juvenile renal
cystic disease, nephronophthisis type 9. It has been
suggested that a defect in the ciliary localization of
Nek8 contributes to the development of cysts manifested
by these diseases.
Length = 256
Score = 28.7 bits (64), Expect = 0.16
Identities = 9/29 (31%), Positives = 20/29 (68%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ +++ F QI+ L ++H++ I+H D+K
Sbjct: 100 EDTILHFFVQILLALHHVHTKLILHRDLK 128
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 11. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 11 (Nek11)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
Nek11 subfamily is one of a family of 11 different Neks
(Nek1-11) that are involved in cell cycle control. The
Nek family is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Nek11 is involved, through direct
phosphorylation, in regulating the degradation of Cdc25A
(Cell Division Cycle 25 homolog A), which plays a role
in cell cycle progression and in activating cyclin
dependent kinases. Nek11 is activated by CHK1
(CHeckpoint Kinase 1) and may be involved in the G2/M
checkpoint. Nek11 may also play a role in the S-phase
checkpoint as well as in DNA replication and genotoxic
stress responses.
Length = 260
Score = 28.7 bits (64), Expect = 0.16
Identities = 11/35 (31%), Positives = 20/35 (57%)
Query: 33 AEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ + QV F Q++ G+ Y+H + I+H D+K
Sbjct: 99 TGKTLSENQVCEWFIQLLLGVHYMHQRRILHRDLK 133
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 10. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 10 (Nek10)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
Nek10 subfamily is one of a family of 11 different Neks
(Nek1-11) that are involved in cell cycle control. The
Nek family is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. No function has yet been ascribed to Nek10.
The gene encoding Nek10 is a putative causative gene for
breast cancer; it is located within a breast cancer
susceptibility loci on chromosome 3p24.
Length = 269
Score = 28.6 bits (64), Expect = 0.17
Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 17/66 (25%)
Query: 11 LYIQMQLCQ--------ITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQG-I 61
LYI M L + +LK+ +Q ++++ IF Q+V L Y+H + I
Sbjct: 84 LYIVMDLIEGAPLGEHFNSLKE--------KKQRFTEERIWNIFVQMVLALRYLHKEKRI 135
Query: 62 VHHDIK 67
VH D+
Sbjct: 136 VHRDLT 141
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C delta.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), delta isoform, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The nPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. nPKCs are calcium-independent,
but require DAG (1,2-diacylglycerol) and
phosphatidylserine (PS) for activity. There are four
nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta
plays a role in cell cycle regulation and programmed
cell death in many cell types. It slows down cell
proliferation, inducing cell cycle arrest and enhancing
cell differentiation. PKC-delta is also involved in the
regulation of transcription as well as immune and
inflammatory responses. It plays a central role in the
genotoxic stress response that leads to DNA
damaged-induced apoptosis.
Length = 316
Score = 28.8 bits (64), Expect = 0.17
Identities = 10/20 (50%), Positives = 18/20 (90%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+IV GL+++HS+GI++ D+K
Sbjct: 104 EIVCGLQFLHSKGIIYRDLK 123
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein
Serine/Threonine Kinases, Novel Protein Kinase C theta
and delta. Serine/Threonine Kinases (STKs), Novel
Protein Kinase C (nPKC), theta and delta-like isoforms,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The nPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
nPKCs are calcium-independent, but require DAG
(1,2-diacylglycerol) and phosphatidylserine (PS) for
activity. There are four nPKC isoforms, delta, epsilon,
eta, and theta. PKC-theta is selectively expressed in
T-cells and plays an important and non-redundant role in
several aspects of T-cell biology. PKC-delta plays a
role in cell cycle regulation and programmed cell death
in many cell types.
Length = 316
Score = 28.2 bits (63), Expect = 0.19
Identities = 8/20 (40%), Positives = 17/20 (85%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+I+ GL+++H +GI++ D+K
Sbjct: 104 EIICGLQFLHKKGIIYRDLK 123
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
Serine/Threonine Kinase, Thousand-and-one amino acids 1.
Serine/threonine kinases (STKs), thousand-and-one amino
acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
TAO1 is sometimes referred to as prostate-derived
sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
MAPK through direct interaction with and activation of
MEK3. TAO1 is highly expressed in the brain and may play
a role in neuronal apoptosis. TAO1 interacts with the
checkpoint proteins BubR1 and Mad2, and plays an
important role in regulating mitotic progression, which
is required for both chromosome congression and
checkpoint-induced anaphase delay. TAO1 may play a role
in protecting genomic stability.
Length = 317
Score = 28.5 bits (63), Expect = 0.20
Identities = 11/27 (40%), Positives = 17/27 (62%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ I +QGL Y+HS ++H DIK
Sbjct: 126 EIAAITHGALQGLAYLHSHNMIHRDIK 152
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
kinase-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Rho-associated
coiled-coil containing protein kinase (ROCK) and Nuclear
Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ROCK- and NDR-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this subfamily include ROCK and
ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
as NDR and NDR-like proteins such as LATS, CBK1 and
Sid2p. ROCK and CRIK are effectors of the small GTPase
Rho, while MRCK is an effector of the small GTPase
Cdc42. NDR and NDR-like kinases contain an N-terminal
regulatory (NTR) domain and an insert within the
catalytic domain that contains an auto-inhibitory
sequence. Proteins in this subfamily are involved in
regulating many cellular functions including
contraction, motility, division, proliferation,
apoptosis, morphogenesis, and cytokinesis.
Length = 350
Score = 28.4 bits (64), Expect = 0.21
Identities = 8/19 (42%), Positives = 12/19 (63%)
Query: 49 IVQGLEYIHSQGIVHHDIK 67
+V L+ +H G +H DIK
Sbjct: 110 LVLALDSVHKLGFIHRDIK 128
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
Kinases, Tropomyosin Related Kinases. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
subfamily; catalytic (c) domain. The Trk subfamily
consists of TrkA, TrkB, TrkC, and similar proteins. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Trk
subfamily members are receptor tyr kinases (RTKs)
containing an extracellular region with arrays of
leucine-rich motifs flanked by two cysteine-rich
clusters followed by two immunoglobulin-like domains, a
transmembrane segment, and an intracellular catalytic
domain. Binding to their ligands, the nerve growth
factor (NGF) family of neutrotrophins, leads to Trk
receptor oligomerization and activation of the catalytic
domain. Trk receptors are mainly expressed in the
peripheral and central nervous systems. They play
important roles in cell fate determination, neuronal
survival and differentiation, as well as in the
regulation of synaptic plasticity. Altered expression of
Trk receptors is associated with many human diseases.
Length = 280
Score = 28.2 bits (63), Expect = 0.23
Identities = 11/26 (42%), Positives = 16/26 (61%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDI 66
Q++ I QI G+ Y+ SQ VH D+
Sbjct: 123 QLLQIAVQIASGMVYLASQHFVHRDL 148
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional.
Length = 496
Score = 28.3 bits (63), Expect = 0.24
Identities = 8/23 (34%), Positives = 17/23 (73%)
Query: 45 IFRQIVQGLEYIHSQGIVHHDIK 67
+F Q++ + ++HS+ ++H DIK
Sbjct: 148 LFIQVLLAVHHVHSKHMIHRDIK 170
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
Serine/Threonine Kinase, Rho-associated coiled-coil
containing protein kinase. Serine/Threonine Kinases
(STKs), Rho-associated coiled-coil containing protein
kinase (ROCK) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The ROCK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. ROCK is also referred to as Rho-associated
kinase or simply as Rho kinase. It contains an
N-terminal extension, a catalytic kinase domain, and a
long C-terminal extension, which contains a coiled-coil
region encompassing a Rho-binding domain (RBD) and a
pleckstrin homology (PH) domain. ROCK is auto-inhibited
by the RBD and PH domain interacting with the catalytic
domain. It is activated via interaction with Rho GTPases
and is involved in many cellular functions including
contraction, adhesion, migration, motility,
proliferation, and apoptosis. The ROCK subfamily
consists of two isoforms, ROCK1 and ROCK2, which may be
functionally redundant in some systems, but exhibit
different tissue distributions. Both isoforms are
ubiquitously expressed in most tissues, but ROCK2 is
more prominent in brain and skeletal muscle while ROCK1
is more pronounced in the liver, testes, and kidney.
Studies in knockout mice result in different phenotypes,
suggesting that the two isoforms do not compensate for
each other during embryonic development.
Length = 370
Score = 28.2 bits (63), Expect = 0.24
Identities = 9/20 (45%), Positives = 14/20 (70%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
++V L+ IHS G +H D+K
Sbjct: 150 EVVLALDAIHSMGFIHRDVK 169
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase Like 5.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase like 5 (CDKL5) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDKL5 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. Mutations in the gene encoding CDKL5,
previously called STK9, are associated with early onset
epilepsy and severe mental retardation [X-linked
infantile spasm syndrome (ISSX) or West syndrome]. In
addition, CDKL5 mutations also sometimes cause a
phenotype similar to Rett syndrome (RTT), a progressive
neurodevelopmental disorder. These pathogenic mutations
are located in the N-terminal portion of the protein
within the kinase domain.
Length = 287
Score = 28.0 bits (62), Expect = 0.28
Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+K YI+ Q+++ + + H IVH DIK
Sbjct: 100 EKVRSYIY-QLIKAIHWCHKNDIVHRDIK 127
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine
Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases
(STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PCTAIRE-3 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PCTAIRE-3 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PCTAIRE-3 shows a
restricted pattern of expression and is present in
brain, kidney, and intestine. It is elevated in
Alzheimer's disease (AD) and has been shown to associate
with paired helical filaments (PHFs) and stimulate Tau
phosphorylation. As AD progresses, phosphorylated Tau
aggregates and forms PHFs, which leads to the formation
of neurofibrillary tangles (NFTs). In human glioma
cells, PCTAIRE-3 induces cell cycle arrest and cell
death.
Length = 288
Score = 28.1 bits (62), Expect = 0.28
Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
Query: 22 LKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LKQ+L N L V Q+++GL Y H + I+H D+K
Sbjct: 89 LKQYLD----NCGNLMSMHNVKIFMFQLLRGLSYCHKRKILHRDLK 130
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein
Serine/Threonine Kinase, G protein-coupled Receptor
Kinase 7. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily, GRK7
isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The GRK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. GRKs phosphorylate and regulate G
protein-coupled receptors (GPCRs), the largest
superfamily of cell surface receptors, which regulate
some part of nearly all physiological functions.
Phosphorylated GPCRs bind to arrestins, which prevents
further G protein signaling despite the presence of
activating ligand. There are seven types of GRKs, named
GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs
to the visual group of GRKs. It is primarily found in
the retina and plays a role in the regulation of opsin
light receptors. GRK7 is located in retinal cone outer
segments and plays an important role in regulating
photoresponse of the cones.
Length = 277
Score = 28.0 bits (62), Expect = 0.28
Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
Query: 31 YNAEQLSYD-KQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
YN + + ++V++ QI G+ ++HS IV+ D+K
Sbjct: 85 YNVGERGLEMERVIHYSAQITCGILHLHSMDIVYRDMK 122
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen and stress-activated
kinase 2. Serine/Threonine Kinases (STKs), Mitogen and
stress-activated kinase (MSK) subfamily, MSK2,
N-terminal catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The MSK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MSKs contain an N-terminal kinase domain (NTD)
from the AGC family and a C-terminal kinase domain (CTD)
from the CAMK family, similar to 90 kDa ribosomal
protein S6 kinases (RSKs). MSKs are activated by two
major signaling cascades, the Ras-MAPK and p38 stress
kinase pathways, which trigger phosphorylation in the
activation loop (A-loop) of the CTD of MSK. The active
CTD phosphorylates the hydrophobic motif (HM) of NTD,
which facilitates the phosphorylation of the A-loop and
activates the NTD, which in turn phosphorylates
downstream targets. MSK2 and MSK1 play nonredundant
roles in activating histone H3 kinases, which play
pivotal roles in compaction of the chromatin fiber. MSK2
is the required H3 kinase in response to stress stimuli
and activation of the p38 MAPK pathway. MSK2 also plays
a role in the pathogenesis of psoriasis.
Length = 332
Score = 28.0 bits (62), Expect = 0.29
Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Query: 31 YNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Y + S D+ Y +I+ LE++H GIV+ DIK
Sbjct: 97 YQRDNFSEDEVRFYS-GEIILALEHLHKLGIVYRDIK 132
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
Serine/Threonine Kinase, Thousand-and-one amino acids 3.
Serine/threonine kinases (STKs), thousand-and-one amino
acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
(kinase from chicken). It specifically activates c-Jun
N-terminal kinase (JNK), presumably by phosphorylating
and activating MKK4/MKK7. In Saccharomyces cerevisiae,
TAO3 is a component of the RAM (regulation of Ace2p
activity and cellular morphogenesis) signaling pathway.
TAO3 is upregulated in retinal ganglion cells after
axotomy, and may play a role in apoptosis.
Length = 313
Score = 27.7 bits (61), Expect = 0.32
Identities = 10/18 (55%), Positives = 14/18 (77%)
Query: 50 VQGLEYIHSQGIVHHDIK 67
+QGL Y+HS ++H DIK
Sbjct: 131 LQGLAYLHSHNMIHRDIK 148
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine
Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine
Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4);
pseudokinase domain. The PTKc (catalytic domain) family,
to which this subfamily belongs, includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. CCK4,
also called protein tyrosine kinase 7 (PTK7), is an
orphan receptor tyr kinase (RTK) containing an
extracellular region with seven immunoglobulin domains,
a transmembrane segment, and an intracellular inactive
pseudokinase domain. Studies in mice reveal that CCK4 is
essential for neural development. Mouse embryos
containing a truncated CCK4 die perinatally and display
craniorachischisis, a severe form of neural tube defect.
The mechanism of action of the CCK4 pseudokinase is
still unknown. Other pseudokinases such as HER3 rely on
the activity of partner RTKs.
Length = 275
Score = 27.8 bits (62), Expect = 0.36
Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
Query: 22 LKQWLSCSTYNAEQLSYD----KQVMYIFRQIVQGLEYIHSQGIVHHDI 66
LKQ+L + E+L KQ + + QI G++++ + VH D+
Sbjct: 95 LKQFLRATKSKDEKLKPPPLSTKQKVALCTQIALGMDHLSNARFVHRDL 143
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
Length = 478
Score = 27.7 bits (61), Expect = 0.37
Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 34 EQLSYDK-QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
E L + + +V +F QIV L+ +HS+ ++H D+K
Sbjct: 162 EHLPFQEYEVGLLFYQIVLALDEVHSRKMMHRDLK 196
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein
Serine/Threonine Kinase, Class IIIA myosin.
Serine/threonine kinases (STKs), class IIIA myosin
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
class III myosin subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Class III myosins are motor
proteins containing an N-terminal kinase catalytic
domain and a C-terminal actin-binding domain. Class III
myosins may play an important role in maintaining the
structural integrity of photoreceptor cell microvilli.
In photoreceptor cells, they may also function as cargo
carriers during light-dependent translocation of
proteins such as transducin and arrestin. Class IIIA
myosin is highly expressed in retina and in inner ear
hair cells. It is localized to the distal ends of
actin-bundled structures. Mutations in human myosin IIIA
are responsible for progressive nonsyndromic hearing
loss. Human myosin IIIA possesses ATPase and kinase
activities, and the ability to move actin filaments in a
motility assay. It may function as a cellular
transporter capable of moving along actin bundles in
sensory cells.
Length = 286
Score = 27.7 bits (61), Expect = 0.39
Identities = 8/26 (30%), Positives = 16/26 (61%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ YI + + GL+++H +H D+K
Sbjct: 126 IAYILHEALMGLQHLHVNKTIHRDVK 151
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 1 from higher
eukaryotes-like. Serine/Threonine Kinases (STKs),
Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. This subfamily is composed of CDK1 from higher
eukaryotes. CDK1 is also called Cell division control
protein 2 (Cdc2) or p34 protein kinase, and is regulated
by cyclins A, B, and E. The CDK1/cyclin A complex
controls G2 phase entry and progression. CDK1/cyclin A2
has also been implicated as an important regulator of S
phase events. The CDK1/cyclin B complex is critical for
G2 to M phase transition. It induces mitosis by
activating nuclear enzymes that regulate chromatin
condensation, nuclear membrane degradation,
mitosis-specific microtubule and cytoskeletal
reorganization. CDK1 also associates with cyclin E and
plays a role in the entry into S phase. CDK1
transcription is stable throughout the cell cycle but is
modulated in some pathological conditions. It may play a
role in regulating apoptosis under these conditions. In
breast cancer cells, HER2 can mediate apoptosis by
inactivating CDK1. Activation of CDK1 may contribute to
HIV-1 induced apoptosis and neuronal apoptosis in
neurodegenerative diseases.
Length = 285
Score = 27.4 bits (61), Expect = 0.41
Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
Query: 11 LYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LY+ + + LK++L S + + + Y++ QI+QG+ + HS+ ++H D+K
Sbjct: 74 LYLIFEFLSMDLKKYLD-SLPKGQYMDAELVKSYLY-QILQGILFCHSRRVLHRDLK 128
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
Serine/Threonine Kinase, beta-adrenergic receptor
kinase. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily,
beta-adrenergic receptor kinase (beta-ARK) group,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The GRK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. GRKs
phosphorylate and regulate G protein-coupled receptors
(GPCRs), the largest superfamily of cell surface
receptors which regulate some part of nearly all
physiological functions. Phosphorylated GPCRs bind to
arrestins, which prevents further G protein signaling
despite the presence of activating ligand. There are
seven types of GRKs, named GRK1 to GRK7. The beta-ARK
group is composed of GRK2, GRK3, and similar proteins.
GRK2 and GRK3 are both widely expressed in many tissues,
although GRK2 is present at higher levels. They contain
an N-terminal RGS homology (RH) domain, a central
catalytic domain, and C-terminal pleckstrin homology
(PH) domain that mediates PIP2 and G protein
betagamma-subunit translocation to the membrane. GRK2
(also called beta-ARK or beta-ARK1) is important in
regulating several cardiac receptor responses. It plays
a role in cardiac development and in hypertension.
Deletion of GRK2 in mice results in embryonic lethality,
caused by hypoplasia of the ventricular myocardium. GRK2
also plays important roles in the liver (as a regulator
of portal blood pressure), in immune cells, and in the
nervous system. Altered GRK2 expression has been
reported in several disorders including major
depression, schizophrenia, bipolar disorder, and
Parkinsonism.
Length = 278
Score = 27.6 bits (61), Expect = 0.43
Identities = 8/29 (27%), Positives = 21/29 (72%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ ++ + +I+ GLE++H++ +V+ D+K
Sbjct: 96 EAEMRFYAAEIILGLEHMHNRFVVYRDLK 124
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 2. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 2 (FGFR2); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR2 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. There are many splice
variants of FGFR2 which show differential expression and
binding to FGF ligands. Disruption of either FGFR2 or
FGFR2b is lethal in mice, due to defects in the placenta
or severe impairment of tissue development including
lung, limb, and thyroid, respectively. Disruption of
FGFR2c in mice results in defective bone and skull
development. Genetic alterations of FGFR2 are associated
with many human skeletal disorders including Apert
syndrome, Crouzon syndrome, Jackson-Weiss syndrome, and
Pfeiffer syndrome.
Length = 304
Score = 27.3 bits (60), Expect = 0.46
Identities = 11/33 (33%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
Query: 34 EQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
EQ+++ K ++ Q+ +G+EY+ SQ +H D+
Sbjct: 132 EQMTF-KDLVSCTYQVARGMEYLASQKCIHRDL 163
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 3. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 3 (FGFR3); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR3 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Many FGFR3 splice
variants have been reported with the IIIb and IIIc
isoforms being the predominant forms. FGFR3 IIIc is the
isoform expressed in chondrocytes, the cells affected in
dwarfism, while IIIb is expressed in epithelial cells.
FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and
FGF23. It is a negative regulator of long bone growth.
In the cochlear duct and in the lens, FGFR3 is involved
in differentiation while it appears to have a role in
cell proliferation in epithelial cells. Germline
mutations in FGFR3 are associated with skeletal
disorders including several forms of dwarfism. Some
missense mutations are associated with multiple myeloma
and carcinomas of the bladder and cervix. Overexpression
of FGFR3 is found in thyroid carcinoma.
Length = 334
Score = 27.3 bits (60), Expect = 0.46
Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
Query: 34 EQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
EQL++ K ++ Q+ +G+EY+ SQ +H D+
Sbjct: 129 EQLTF-KDLVSCAYQVARGMEYLASQKCIHRDL 160
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
Provisional.
Length = 329
Score = 27.1 bits (60), Expect = 0.49
Identities = 8/20 (40%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
++V EY+HS+ I++ D+K
Sbjct: 126 ELVLAFEYLHSKDIIYRDLK 145
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
Serine/Threonine Kinase, Thousand-and-one amino acids 2.
Serine/threonine kinases (STKs), thousand-and-one amino
acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
Human TAO2 is also known as prostate-derived Ste20-like
kinase (PSK) and was identified in a screen for
overexpressed RNAs in prostate cancer. TAO2 activates
both p38 and c-Jun N-terminal kinase (JNK), by
phosphorylating and activating the respective MAP/ERK
kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
and MKK4/MKK7. TAO2 contains a long C-terminal extension
with autoinhibitory segments. It is activated by the
release of this inhibition and the phosphorylation of
its activation loop serine. TAO2 functions as a
regulator of actin cytoskeletal and microtubule
organization. In addition, it regulates the transforming
growth factor-activated kinase 1 (TAK1), which is a
MAPKKK that plays an essential role in the signaling
pathways of tumor necrosis factor (TNF), interleukin 1
(IL-1), and Toll-like receptor (TLR).
Length = 308
Score = 27.3 bits (60), Expect = 0.50
Identities = 9/27 (33%), Positives = 17/27 (62%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ + +QGL Y+HS ++H D+K
Sbjct: 116 EIAAVTHGALQGLAYLHSHNMIHRDVK 142
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 6. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek6 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek6 is required
for the transition from metaphase to anaphase. It also
plays important roles in mitotic spindle formation and
cytokinesis. Activated by Nek9 during mitosis, Nek6
phosphorylates Eg5, a kinesin that is important for
spindle bipolarity. Nek6 localizes to spindle
microtubules during metaphase and anaphase, and to the
midbody during cytokinesis.
Length = 267
Score = 27.3 bits (60), Expect = 0.55
Identities = 10/29 (34%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ V F Q+ +E++HS+ ++H DIK
Sbjct: 105 ERTVWKYFVQLCSAVEHMHSRRVMHRDIK 133
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine
Kinase, Tropomyosin Related Kinase C. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase C
(TrkC); catalytic (c) domain. The PTKc family is part of
a larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. TrkC is a member of the
Trk subfamily of proteins, which are receptor tyr
kinases (RTKs) containing an extracellular region with
arrays of leucine-rich motifs flanked by two
cysteine-rich clusters followed by two
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. Binding of TrkC
to its ligand, neurotrophin 3 (NT3), results in receptor
oligomerization and activation of the catalytic domain.
TrkC is broadly expressed in the nervous system and in
some non-neural tissues including the developing heart.
NT3/TrkC signaling plays an important role in the
innervation of the cardiac conducting system and the
development of smooth muscle cells. Mice deficient with
NT3 and TrkC have multiple heart defects. NT3/TrkC
signaling is also critical for the development and
maintenance of enteric neurons that are important for
the control of gut peristalsis.
Length = 291
Score = 27.3 bits (60), Expect = 0.57
Identities = 11/26 (42%), Positives = 17/26 (65%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDI 66
Q+++I QI G+ Y+ SQ VH D+
Sbjct: 124 QMLHIASQIASGMVYLASQHFVHRDL 149
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional.
Length = 440
Score = 27.3 bits (60), Expect = 0.58
Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Query: 6 EDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHD 65
E + L + M+ T+ +++ N L +Y + Q+ + L YIHS+ I H D
Sbjct: 137 EKNIFLNVVMEFIPQTVHKYMKHYARNNHALPLFLVKLYSY-QLCRALAYIHSKFICHRD 195
Query: 66 IK 67
+K
Sbjct: 196 LK 197
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine
Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases
(STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PCTAIRE-2 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PCTAIRE-2 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PCTAIRE-2 is
specifically expressed in neurons in the central nervous
system, mainly in terminally differentiated neurons. It
associates with Trap (Tudor repeat associator with
PCTAIRE-2) and could play a role in regulating
mitochondrial function in neurons.
Length = 309
Score = 26.9 bits (59), Expect = 0.63
Identities = 9/20 (45%), Positives = 15/20 (75%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
QI++GL Y H + ++H D+K
Sbjct: 112 QILRGLAYCHRRKVLHRDLK 131
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
kinase-like Protein Tyrosine Kinases. Protein Tyrosine
Kinase (PTK) family; C-terminal Src kinase (Csk)
subfamily; catalytic (c) domain. The Csk subfamily is
composed of Csk, Chk, and similar proteins. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Csk
subfamily kinases are cytoplasmic (or nonreceptor) tyr
kinases containing the Src homology domains, SH3 and
SH2, N-terminal to the catalytic tyr kinase domain. They
negatively regulate the activity of Src kinases that are
anchored to the plasma membrane. To inhibit Src kinases,
Csk and Chk are translocated to the membrane via binding
to specific transmembrane proteins, G-proteins, or
adaptor proteins near the membrane. Csk catalyzes the
tyr phosphorylation of the regulatory C-terminal tail of
Src kinases, resulting in their inactivation. Chk
inhibit Src kinases using a noncatalytic mechanism by
simply binding to them. As negative regulators of Src
kinases, Csk and Chk play important roles in cell
proliferation, survival, and differentiation, and
consequently, in cancer development and progression.
Length = 256
Score = 27.0 bits (60), Expect = 0.64
Identities = 6/20 (30%), Positives = 12/20 (60%)
Query: 47 RQIVQGLEYIHSQGIVHHDI 66
+ +G+EY+ + VH D+
Sbjct: 109 LDVCEGMEYLEEKNFVHRDL 128
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine
Kinase, Tropomyosin Related Kinase B. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase B
(TrkB); catalytic (c) domain. The PTKc family is part of
a larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. TrkB is a member of the
Trk subfamily of proteins, which are receptor tyr
kinases (RTKs) containing an extracellular region with
arrays of leucine-rich motifs flanked by two
cysteine-rich clusters followed by two
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. Binding of TrkB
to its ligands, brain-derived neurotrophic factor (BDNF)
or neurotrophin 4 (NT4), results in receptor
oligomerization and activation of the catalytic domain.
TrkB is broadly expressed in the nervous system and in
some non-neural tissues. It plays important roles in
cell proliferation, differentiation, and survival.
BDNF/Trk signaling plays a key role in regulating
activity-dependent synaptic plasticity. TrkB also
contributes to protection against gp120-induced neuronal
cell death. TrkB overexpression is associated with poor
prognosis in neuroblastoma (NB) and other human cancers.
It acts as a suppressor of anoikis (detachment-induced
apoptosis) and contributes to tumor metastasis.
Length = 288
Score = 27.0 bits (59), Expect = 0.65
Identities = 11/26 (42%), Positives = 18/26 (69%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDI 66
Q+++I +QI G+ Y+ SQ VH D+
Sbjct: 121 QMLHIAQQIAAGMVYLASQHFVHRDL 146
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein
Serine/Threonine Kinase, Classical Protein Kinase C
beta. Serine/Threonine Kinases (STKs), Classical
Protein Kinase C (cPKC) subfamily, beta isoforms,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The cPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, cPKCs depend on calcium, DAG
(1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. There are four
cPKC isoforms, named alpha, betaI, betaII, and gamma.
The PKC beta isoforms (I and II), generated by
alternative splicing of a single gene, are
preferentially activated by hyperglycemia-induced DAG in
retinal tissues. This is implicated in diabetic
microangiopathy such as ischemia, neovascularization,
and abnormal vasodilator function. PKC-beta also plays
an important role in VEGF signaling. In addition,
glucose regulates proliferation in retinal endothelial
cells via PKC-betaI. PKC-beta is also being explored as
a therapeutic target in cancer. It contributes to tumor
formation and is involved in the tumor host mechanisms
of inflammation and angiogenesis.
Length = 323
Score = 26.9 bits (59), Expect = 0.67
Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
Query: 31 YNAEQLSYDKQVMYIF--RQIVQGLEYIHSQGIVHHDIK 67
Y +Q+ K+ +F +I GL ++HS+GI++ D+K
Sbjct: 90 YQIQQVGRFKEPHAVFYAAEIAIGLFFLHSKGIIYRDLK 128
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen and stress-activated
kinase 1. Serine/Threonine Kinases (STKs), Mitogen and
stress-activated kinase (MSK) subfamily, MSK1,
N-terminal catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The MSK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MSKs contain an N-terminal kinase domain (NTD)
from the AGC family and a C-terminal kinase domain (CTD)
from the CAMK family, similar to 90 kDa ribosomal
protein S6 kinases (RSKs). MSKs are activated by two
major signaling cascades, the Ras-MAPK and p38 stress
kinase pathways, which trigger phosphorylation in the
activation loop (A-loop) of the CTD of MSK. The active
CTD phosphorylates the hydrophobic motif (HM) of NTD,
which facilitates the phosphorylation of the A-loop and
activates the NTD, which in turn phosphorylates
downstream targets. MSK1 plays a role in the regulation
of translational control and transcriptional activation.
It phosphorylates the transcription factors, CREB and
NFkappaB. It also phosphorylates the nucleosomal
proteins H3 and HMG-14. Increased phosphorylation of
MEK1 is associated with the development of cerebral
ischemic/hypoxic preconditioning.
Length = 290
Score = 26.9 bits (59), Expect = 0.70
Identities = 11/29 (37%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+++V +IV LE++H GI++ DIK
Sbjct: 104 EQEVQIYSGEIVLALEHLHKLGIIYRDIK 132
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein
Serine/Threonine Kinase, Rho-associated coiled-coil
containing protein kinase 2. Serine/Threonine Kinases
(STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ROCK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. ROCK contains an
N-terminal extension, a catalytic kinase domain, and a
C-terminal extension, which contains a coiled-coil
region encompassing a Rho-binding domain (RBD) and a
pleckstrin homology (PH) domain. ROCK is auto-inhibited
by the RBD and PH domain interacting with the catalytic
domain, and is activated via interaction with Rho
GTPases. ROCK2 was the first identified target of
activated RhoA, and was found to play a role in stress
fiber and focal adhesion formation. It is prominently
expressed in the brain, heart, and skeletal muscles. It
is implicated in vascular and neurological disorders,
such as hypertension and vasospasm of the coronary and
cerebral arteries. ROCK2 is also activated by caspase-2
cleavage, resulting in thrombin-induced microparticle
generation in response to cell activation. Mice
deficient in ROCK2 show intrauterine growth retardation
and embryonic lethality because of placental
dysfunction.
Length = 370
Score = 26.9 bits (59), Expect = 0.74
Identities = 10/29 (34%), Positives = 18/29 (62%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+K + ++V L+ IHS G++H D+K
Sbjct: 141 EKWAKFYTAEVVLALDAIHSMGLIHRDVK 169
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
Serine/Threonine Kinases (STKs), Pho85 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Pho85 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Pho85 is a
multifunctional Cyclin-Dependent protein Kinase (CDK) in
yeast. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. Pho85 is regulated
by 10 different cyclins (Pcls) and plays a role in G1
progression, cell polarity, phosphate and glycogen
metabolism, gene expression, and in signaling changes in
the environment. It is not essential for yeast viability
and is the functional homolog of mammalian CDK5, which
plays a role in central nervous system development.
Length = 284
Score = 26.7 bits (59), Expect = 0.76
Identities = 7/27 (25%), Positives = 15/27 (55%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
V Q+++G+ + H ++H D+K
Sbjct: 101 TVKSFTYQLLKGIAFCHENRVLHRDLK 127
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein
Serine/Threonine Kinase, Class IIIB myosin.
Serine/threonine kinases (STKs), class IIIB myosin
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
class III myosin subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Class III myosins are motor
proteins containing an N-terminal kinase catalytic
domain and a C-terminal actin-binding domain. Class III
myosins may play an important role in maintaining the
structural integrity of photoreceptor cell microvilli.
They may also function as cargo carriers during
light-dependent translocation, in photoreceptor cells,
of proteins such as transducin and arrestin. Class IIIB
myosin is expressed highly in retina. It is also present
in the brain and testis. The human class IIIB myosin
gene maps to a region that overlaps the locus for
Bardet-Biedl syndrome, which is characterized by
dysmorphic extremities, retinal dystrophy, obesity, male
hypogenitalism, and renal abnormalities.
Length = 291
Score = 26.5 bits (58), Expect = 0.85
Identities = 9/26 (34%), Positives = 17/26 (65%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
+ YI + GL+++H+ I+H D+K
Sbjct: 130 ISYILYGALLGLQHLHNNRIIHRDVK 155
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases
(STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PCTAIRE-1 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PCTAIRE-1 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PCTAIRE-1 is
expressed ubiquitously and is localized in the
cytoplasm. Its kinase activity is cell cycle dependent
and peaks at the S and G2 phases. PCTAIRE-1 is highly
expressed in the brain and may play a role in regulating
neurite outgrowth. It can also associate with Trap
(Tudor repeat associator with PCTAIRE-2), a
physiological partner of PCTAIRE-2; with p11, a small
dimeric protein with similarity to S100; and with 14-3-3
proteins, mediators of phosphorylation-dependent
interactions in many different proteins.
Length = 301
Score = 26.5 bits (58), Expect = 0.89
Identities = 9/25 (36%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
Query: 43 MYIFRQIVQGLEYIHSQGIVHHDIK 67
+++F Q+++GL Y H + ++H D+K
Sbjct: 108 LFLF-QLLRGLNYCHRRKVLHRDLK 131
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
Kinase, Activated Cdc42-associated kinase. Protein
Tyrosine Kinase (PTK) family; Activated Cdc42-associated
kinase (Ack) subfamily; catalytic (c) domain. Ack
subfamily members include Ack1, thirty-eight-negative
kinase 1 (Tnk1), and similar proteins. The PTKc family
is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Ack
subfamily members are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal catalytic domain, an
SH3 domain, a Cdc42-binding CRIB domain, and a
proline-rich region. They are mainly expressed in brain
and skeletal tissues and are involved in the regulation
of cell adhesion and growth, receptor degradation, and
axonal guidance. Ack1 is also associated with
androgen-independent prostate cancer progression. Tnk1
regulates TNFalpha signaling and may play an important
role in cell death.
Length = 257
Score = 26.6 bits (59), Expect = 0.90
Identities = 7/19 (36%), Positives = 12/19 (63%)
Query: 48 QIVQGLEYIHSQGIVHHDI 66
QI G+ Y+ S+ +H D+
Sbjct: 105 QIANGMRYLESKRFIHRDL 123
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
Serine/Threonine Kinase, Protein Kinase B gamma.
Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. There are three
PKB isoforms from different genes, PKB-alpha (or Akt1),
PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. PKB-gamma is
predominantly expressed in neuronal tissues. Mice
deficient in PKB-gamma show a reduction in brain weight
due to the decreases in cell size and cell number.
PKB-gamma has also been shown to be upregulated in
estrogen-deficient breast cancer cells,
androgen-independent prostate cancer cells, and primary
ovarian tumors. It acts as a key mediator in the genesis
of ovarian cancer.
Length = 328
Score = 26.6 bits (58), Expect = 0.90
Identities = 11/34 (32%), Positives = 21/34 (61%)
Query: 34 EQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
E++ + + + +IV L+Y+HS IV+ D+K
Sbjct: 89 ERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLK 122
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein
Serine/Threonine Kinase, G protein-coupled Receptor
Kinase 3. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily, GRK3
isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The GRK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. GRKs phosphorylate and regulate G
protein-coupled receptors (GPCRs), the largest
superfamily of cell surface receptors which regulate
some part of nearly all physiological functions.
Phosphorylated GPCRs bind to arrestins, which prevents
further G protein signaling despite the presence of
activating ligand. There are seven types of GRKs, named
GRK1 to GRK7. GRK3 (also known as beta-adrenergic
receptor kinase 2) is widely expressed in many tissues.
GRK3-deficient mice show a lack of olfactory receptor
desensitization and altered regulation of the M2
muscarinic airway. GRK3 is involved in modulating the
cholinergic response of airway smooth muscles. It also
plays a role in dopamine receptor regulation. GRK3
promoter polymorphisms may be associated with bipolar
disorder.
Length = 279
Score = 26.5 bits (58), Expect = 0.94
Identities = 9/29 (31%), Positives = 22/29 (75%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+K++ + +I+ GLE++H++ +V+ D+K
Sbjct: 96 EKEMRFYATEIILGLEHMHNRFVVYRDLK 124
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen and stress-activated
kinase. Serine/Threonine Kinases (STKs), Mitogen and
stress-activated kinase (MSK) subfamily, N-terminal
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MSK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MSKs contain an
N-terminal kinase domain (NTD) from the AGC family and a
C-terminal kinase domain (CTD) from the CAMK family,
similar to 90 kDa ribosomal protein S6 kinases (RSKs).
MSKs are activated by two major signaling cascades, the
Ras-MAPK and p38 stress kinase pathways, in response to
various stimuli such as growth factors, hormones,
neurotransmitters, cellular stress, and pro-inflammatory
cytokines. This triggers phosphorylation in the
activation loop (A-loop) of the CTD of MSK. The active
CTD phosphorylates the hydrophobic motif (HM) in the
C-terminal extension of NTD, which facilitates the
phosphorylation of the A-loop and activates the NTD,
which in turn phosphorylates downstream targets. MSKs
are predominantly nuclear proteins. They are widely
expressed in many tissues including heart, brain, lung,
liver, kidney, and pancreas. There are two isoforms of
MSK, called MSK1 and MSK2.
Length = 288
Score = 26.3 bits (58), Expect = 0.98
Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
Query: 31 YNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
Y E + + +YI +IV L+++H GI++ DIK
Sbjct: 97 YQREHFTESEVRVYI-AEIVLALDHLHQLGIIYRDIK 132
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 4. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 4 (FGFR4); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR4 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Unlike other FGFRs,
there is only one splice form of FGFR4. It binds FGF1,
FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective
ligand for FGFR4. Although disruption of FGFR4 in mice
causes no obvious phenotype, in vivo inhibition of FGFR4
in cultured skeletal muscle cells resulted in an arrest
of muscle progenitor differentiation. FGF6 and FGFR4 are
uniquely expressed in myofibers and satellite cells.
FGF6/FGFR4 signaling appears to play a key role in the
regulation of muscle regeneration. A polymorphism in
FGFR4 is found in head and neck squamous cell carcinoma.
Length = 314
Score = 26.5 bits (58), Expect = 0.99
Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
Query: 34 EQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
EQLS+ V + Q+ +G+EY+ S+ +H D+
Sbjct: 129 EQLSFKDLVSCAY-QVARGMEYLESRRCIHRDL 160
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
Serine/Threonine Kinase, Rho-associated coiled-coil
containing protein kinase 1. Serine/Threonine Kinases
(STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ROCK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. ROCK contains an
N-terminal extension, a catalytic kinase domain, and a
C-terminal extension, which contains a coiled-coil
region encompassing a Rho-binding domain (RBD) and a
pleckstrin homology (PH) domain. ROCK is auto-inhibited
by the RBD and PH domain interacting with the catalytic
domain, and is activated via interaction with Rho
GTPases. ROCK1 is preferentially expressed in the liver,
lung, spleen, testes, and kidney. It mediates signaling
from Rho to the actin cytoskeleton. It is implicated in
the development of cardiac fibrosis, cardiomyocyte
apoptosis, and hyperglycemia. Mice deficient with ROCK1
display eyelids open at birth (EOB) and omphalocele
phenotypes due to the disorganization of actin filaments
in the eyelids and the umbilical ring.
Length = 371
Score = 26.5 bits (58), Expect = 1.0
Identities = 9/20 (45%), Positives = 14/20 (70%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
++V L+ IHS G +H D+K
Sbjct: 150 EVVLALDAIHSMGFIHRDVK 169
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase,
Cell Division Cycle 2-like 6. Serine/Threonine Kinases
(STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDC2L6 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDC2L6 is also called CDK8-like and was
previously referred to as CDK11. However, this is a
confusing nomenclature as CDC2L6 is distinct from
CDC2L1, which is represented by the two protein products
from its gene, called CDK11(p110) and CDK11(p58), as
well as the caspase-processed CDK11(p46). CDK11(p110),
CDK11(p58), and CDK11(p46)do not belong to this
subfamily. CDC2L6 is an associated protein of Mediator,
a multiprotein complex that provides a platform to
connect transcriptional and chromatin regulators and
cofactors, in order to activate and mediate RNA
polymerase II transcription. CDC2L6 is localized mainly
in the nucleus amd exerts an opposing effect to CDK8 in
VP16-dependent transcriptional activation by being a
negative regulator.
Length = 317
Score = 26.2 bits (57), Expect = 1.2
Identities = 9/26 (34%), Positives = 17/26 (65%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
V + QI+ G+ Y+H+ ++H D+K
Sbjct: 110 VKSLLYQILDGIHYLHANWVLHRDLK 135
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 8.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 8 (CDK8) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK8 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK8
can act as a negative or positive regulator of
transcription, depending on the scenario. Together with
its regulator, cyclin C, it reversibly associates with
the multi-subunit core Mediator complex, a cofactor that
is involved in regulating RNA polymerase II (RNAP
II)-dependent transcription. CDK8 phosphorylates cyclin
H, a subunit of the general transcription factor TFIIH,
which results in the inhibition of TFIIH-dependent
phosphorylation of the C-terminal domain (CTD) of RNAP
II, facilitating the inhibition of transcription. It has
also been shown to promote transcription by a mechanism
that is likely to involve RNAP II phosphorylation. CDK8
also functions as a stimulus-specific positive
coregulator of p53 transcriptional responses.
Length = 317
Score = 26.2 bits (57), Expect = 1.2
Identities = 9/26 (34%), Positives = 17/26 (65%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDIK 67
V + QI+ G+ Y+H+ ++H D+K
Sbjct: 110 VKSLLYQILDGIHYLHANWVLHRDLK 135
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine
Kinase, Platelet Derived Growth Factor Receptor beta.
Protein Tyrosine Kinase (PTK) family; Platelet Derived
Growth Factor Receptor (PDGFR) beta; catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. PDGFR
beta is a receptor tyr kinase (RTK) containing an
extracellular ligand-binding region with five
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. The binding to
its ligands, the PDGFs, leads to receptor dimerization,
trans phosphorylation and activation, and intracellular
signaling. PDGFR beta forms homodimers or heterodimers
with PDGFR alpha, depending on the nature of the PDGF
ligand. PDGF-BB and PDGF-DD induce PDGFR beta
homodimerization. PDGFR signaling plays many roles in
normal embryonic development and adult physiology. PDGFR
beta signaling leads to a variety of cellular effects
including the stimulation of cell growth and chemotaxis,
as well as the inhibition of apoptosis and GAP
junctional communication. It is critical in normal
angiogenesis as it is involved in the recruitment of
pericytes and smooth muscle cells essential for vessel
stability. Aberrant PDGFR beta expression is associated
with some human cancers. The continuously-active fusion
proteins of PDGFR beta with COL1A1 and TEL are
associated with dermatofibrosarcoma protuberans (DFSP)
and a subset of chronic myelomonocytic leukemia (CMML),
respectively.
Length = 401
Score = 26.1 bits (57), Expect = 1.2
Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
Query: 36 LSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
LSY V + + Q+ G+E++ S+ VH D+
Sbjct: 236 LSYMDLVGFSY-QVANGMEFLASKNCVHRDL 265
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 3. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek3 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek3 is primarily
localized in the cytoplasm and shows no cell
cycle-dependent changes in its activity. It is present
in the axons of neurons and affects morphogenesis and
polarity through its regulation of microtubule
acetylation. Nek3 modulates the signaling of the
prolactin receptor through its activation of Vav2 and
contributes to prolactin-mediated motility of breast
cancer cells.
Length = 255
Score = 26.1 bits (57), Expect = 1.3
Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
Query: 11 LYIQMQLCQI-TLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
LYI M+ C L Q + +L + ++ F Q+ G+++IH + ++H DIK
Sbjct: 73 LYIVMEYCDGGDLMQKIK---LQRGKLFPEDTILQWFVQMCLGVQHIHEKRVLHRDIK 127
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
Protein Kinases, MAP kinase kinases 3 and 6. Protein
kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
subfamily, catalytic (c) domain. PKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The MKK3 and MKK6 subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein serine/threonine kinases, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The mitogen-activated protein (MAP) kinase
signaling pathways are important mediators of cellular
responses to extracellular signals. The pathways involve
a triple kinase core cascade comprising the MAP kinase
(MAPK), which is phosphorylated and activated by a MAPK
kinase (MAPKK or MKK), which itself is phosphorylated
and activated by a MAPK kinase kinase (MAPKKK or MKKK).
MKK3 and MKK6 are dual-specificity PKs that
phosphorylate and activate their downstream target, p38
MAPK, on specific threonine and tyrosine residues.
MKK3/6 plays roles in the regulation of cell cycle
progression, cytokine- and stress-induced apoptosis,
oncogenic transformation, and adult tissue regeneration.
In addition, MKK6 plays a critical role in osteoclast
survival in inflammatory disease while MKK3 is
associated with tumor invasion, progression, and poor
patient survival in glioma.
Length = 283
Score = 25.8 bits (57), Expect = 1.6
Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 1/20 (5%)
Query: 49 IVQGLEYIHSQ-GIVHHDIK 67
IV+ LEY+HS+ ++H D+K
Sbjct: 112 IVKALEYLHSKLSVIHRDVK 131
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the
Protein Tyrosine Kinases, Janus kinases 2 and 3.
Protein Tyrosine Kinase (PTK) family; Janus kinase 2
(Jak2) and Jak3; catalytic (c) domain (repeat 2). The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Jak2 and
Jak3 are members of the Janus kinase (Jak) subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal FERM domain, followed
by a Src homology 2 (SH2) domain, a pseudokinase domain,
and a C-terminal catalytic tyr kinase domain. Jaks are
crucial for cytokine receptor signaling. They are
activated by autophosphorylation upon cytokine-induced
receptor aggregation, and subsequently trigger
downstream signaling events such as the phosphorylation
of signal transducers and activators of transcription
(STATs). Jak2 is widely expressed in many tissues while
Jak3 is expressed only in hematopoietic cells. Jak2 is
essential for the signaling of hormone-like cytokines
such as growth hormone, erythropoietin, thrombopoietin,
and prolactin, as well as some IFNs and cytokines that
signal through the IL-3 and gp130 receptors. Jak3 binds
the shared receptor subunit common gamma chain and thus,
is essential in the signaling of cytokines that use it
such as IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21.
Disruption of Jak2 in mice results in an embryonic
lethal phenotype with multiple defects including
erythropoietic and cardiac abnormalities. It is the only
Jak gene that results in a lethal phenotype when
disrupted in mice. A mutation in the pseudokinase domain
of Jak2, V617F, is present in many myeloproliferative
diseases, including almost all patients with
polycythemia vera, and 50% of patients with essential
thrombocytosis and myelofibrosis. Jak3 is important in
lymphoid development and myeloid cell differentiation.
Inactivating mutations in Jak3 have been reported in
humans with severe combined immunodeficiency (SCID).
Length = 284
Score = 25.9 bits (57), Expect = 1.7
Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 32 NAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
+ E+L + K ++Y QI +G+EY+ S+ VH D+
Sbjct: 101 HRERLDHRKLLLYA-SQICKGMEYLGSKRYVHRDL 134
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine
Kinases, Receptor tyrosine kinase-like Orphan Receptors.
Protein Tyrosine Kinase (PTK) family; Receptor tyrosine
kinase-like Orphan Receptor (Ror) subfamily; catalytic
(c) domain. The Ror subfamily consists of Ror1, Ror2,
and similar proteins. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Ror proteins are orphan
receptor tyr kinases (RTKs) containing an extracellular
region with immunoglobulin-like, cysteine-rich, and
kringle domains, a transmembrane segment, and an
intracellular catalytic domain. Ror RTKs are unrelated
to the nuclear receptor subfamily called
retinoid-related orphan receptors (RORs). RTKs are
usually activated through ligand binding, which causes
dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. Ror kinases
are expressed in many tissues during development. They
play important roles in bone and heart formation.
Mutations in human Ror2 result in two different bone
development genetic disorders, recessive Robinow
syndrome and brachydactyly type B. Drosophila Ror is
expressed only in the developing nervous system during
neurite outgrowth and neuronal differentiation,
suggesting a role for Drosophila Ror in neural
development. More recently, mouse Ror1 and Ror2 have
also been found to play an important role in regulating
neurite growth in central neurons. Ror1 and Ror2 are
believed to have some overlapping and redundant
functions.
Length = 283
Score = 25.5 bits (56), Expect = 1.9
Identities = 10/24 (41%), Positives = 15/24 (62%)
Query: 43 MYIFRQIVQGLEYIHSQGIVHHDI 66
++I QI G+EY+ S VH D+
Sbjct: 127 LHIAIQIAAGMEYLSSHHFVHRDL 150
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine
Kinase, Receptor tyrosine kinase-like Orphan Receptor 2.
Protein Tyrosine Kinase (PTK) family; Receptor tyrosine
kinase-like Orphan Receptor 2 (Ror2); catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Ror
proteins are orphan receptor tyr kinases (RTKs)
containing an extracellular region with
immunoglobulin-like, cysteine-rich, and kringle domains,
a transmembrane segment, and an intracellular catalytic
domain. Ror RTKs are unrelated to the nuclear receptor
subfamily called retinoid-related orphan receptors
(RORs). RTKs are usually activated through ligand
binding, which causes dimerization and
autophosphorylation of the intracellular tyr kinase
catalytic domain. Ror2 plays important roles in skeletal
and heart formation. Ror2-deficient mice show widespread
bone abnormalities, ventricular defects in the heart,
and respiratory dysfunction. Mutations in human Ror2
result in two different bone development genetic
disorders, recessive Robinow syndrome and brachydactyly
type B. Ror2 is also implicated in neural development.
Length = 283
Score = 25.8 bits (56), Expect = 1.9
Identities = 9/24 (37%), Positives = 16/24 (66%)
Query: 43 MYIFRQIVQGLEYIHSQGIVHHDI 66
++I QI G+E++ S +VH D+
Sbjct: 127 VHIVTQIAAGMEFLSSHHVVHKDL 150
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, 90 kDa ribosomal protein S6
kinase. Serine/Threonine Kinases (STKs), 90 kDa
ribosomal protein S6 kinase (RSK) subfamily, N-terminal
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The RSK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. RSKs contain an
N-terminal kinase domain (NTD) from the AGC family and a
C-terminal kinase domain (CTD) from the CAMK family.
They are activated by signaling inputs from
extracellular regulated kinase (ERK) and
phosphoinositide dependent kinase 1 (PDK1). ERK
phosphorylates and activates the CTD of RSK, serving as
a docking site for PDK1, which phosphorylates and
activates the NTD, which in turn phosphorylates all
known RSK substrates. RSKs act as downstream effectors
of mitogen-activated protein kinase (MAPK) and play key
roles in mitogen-activated cell growth, differentiation,
and survival. Mammals possess four RSK isoforms (RSK1-4)
from distinct genes. RSK proteins are also referred to
as MAP kinase-activated protein kinases (MAPKAPKs),
p90-RSKs, or p90S6Ks.
Length = 318
Score = 25.5 bits (56), Expect = 1.9
Identities = 8/29 (27%), Positives = 19/29 (65%)
Query: 39 DKQVMYIFRQIVQGLEYIHSQGIVHHDIK 67
++ V + ++ L+++HS GI++ D+K
Sbjct: 97 EEDVKFYLAELALALDHLHSLGIIYRDLK 125
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine
Kinases, Fibroblast Growth Factor Receptors. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor (FGFR) subfamily; catalytic (c) domain. The
FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4,
and similar proteins. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K).PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. FGFR subfamily members
are receptor tyr kinases (RTKs) containing an
extracellular ligand-binding region with three
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. The binding of
FGFRs to their ligands, the FGFs, and to heparin/heparan
sulfate (HS) results in the formation of a ternary
complex, which leads to receptor dimerization and
activation, and intracellular signaling. There are at
least 23 FGFs and four types of FGFRs. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. FGF/FGFR signaling is
important in the regulation of embryonic development,
homeostasis, and regenerative processes. Depending on
the cell type and stage, FGFR signaling produces diverse
cellular responses including proliferation, growth
arrest, differentiation, and apoptosis. Aberrant
signaling leads to many human diseases such as skeletal,
olfactory, and metabolic disorders, as well as cancer.
Length = 293
Score = 25.5 bits (56), Expect = 2.0
Identities = 6/19 (31%), Positives = 14/19 (73%)
Query: 48 QIVQGLEYIHSQGIVHHDI 66
Q+ +G+E++ S+ +H D+
Sbjct: 140 QVARGMEFLASKKCIHRDL 158
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
Serine/Threonine Kinase, Classical Protein Kinase C
alpha. Serine/Threonine Kinases (STKs), Classical
Protein Kinase C (cPKC) subfamily, alpha isoform,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The cPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, cPKCs depend on calcium, DAG
(1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. There are four
cPKC isoforms, named alpha, betaI, betaII, and gamma.
PKC-alpha is expressed in many tissues and is associated
with cell proliferation, apoptosis, and cell motility.
It plays a role in the signaling of the growth factors
PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
have been detected in many transformed cell lines and
several human tumors. In addition, PKC-alpha is required
for HER2 dependent breast cancer invasion.
Length = 323
Score = 25.3 bits (55), Expect = 2.1
Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
Query: 31 YNAEQLSYDKQVMYIF--RQIVQGLEYIHSQGIVHHDIK 67
Y+ +Q+ K+ +F +I GL ++H +GI++ D+K
Sbjct: 90 YHIQQVGKFKEPQAVFYAAEISVGLFFLHRRGIIYRDLK 128
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 1. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 1 (FGFR1); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR1 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Alternative splicing of
FGFR1 transcripts produces a variety of isoforms, which
are differentially expressed in cells. FGFR1 binds the
ligands, FGF1 and FGF2, with high affinity and has also
been reported to bind FGF4, FGF6, and FGF9. FGFR1
signaling is critical in the control of cell migration
during embryo development. It promotes cell
proliferation in fibroblasts. Nuclear FGFR1 plays a role
in the regulation of transcription. Mutations,
insertions or deletions of FGFR1 have been identified in
patients with Kallman's syndrome (KS), an inherited
disorder characterized by hypogonadotropic hypogonadism
and loss of olfaction. Aberrant FGFR1 expression has
been found in some human cancers including 8P11
myeloproliferative syndrome (EMS), breast cancer, and
pancreatic adenocarcinoma.
Length = 307
Score = 25.4 bits (55), Expect = 2.6
Identities = 10/37 (27%), Positives = 20/37 (54%)
Query: 30 TYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
T E+ K ++ Q+ +G+EY+ S+ +H D+
Sbjct: 130 TQVPEEQLSFKDLVSCAYQVARGMEYLASKKCIHRDL 166
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase
adapter protein beta. Protein Kinase family,
STE20-related kinase adapter protein (STRAD) beta
subfamily, pseudokinase domain. The STRAD-beta subfamily
is part of a larger superfamily that includes the
catalytic domains of serine/threonine kinases (STKs),
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The pseudokinase domain shows similarity to
protein kinases but lacks crucial residues for catalytic
activity. STRAD forms a complex with the scaffolding
protein MO25, and the STK, LKB1, resulting in the
activation of the kinase. In the complex, LKB1
phosphorylates and activates adenosine
monophosphate-activated protein kinases (AMPKs), which
regulate cell energy metabolism and cell polarity. LKB1
is a tumor suppressor linked to the rare inherited
disease, Peutz-Jeghers syndrome, which is characterized
by a predisposition to benign polyps and
hyperpigmentation of the buccal mucosa. There are two
forms of STRAD, alpha and beta, that complex with LKB1
and MO25. STRAD-beta is also referred to as ALS2CR2
(Amyotrophic lateral sclerosis 2 chromosomal region
candidate gene 2 protein), since the human gene encoding
it is located within the juvenile ALS2 critical region
on chromosome 2q33-q34. It is not linked to the
development of ALS2.
Length = 328
Score = 25.3 bits (55), Expect = 2.8
Identities = 8/18 (44%), Positives = 13/18 (72%)
Query: 50 VQGLEYIHSQGIVHHDIK 67
++GL Y+H G +H +IK
Sbjct: 111 LRGLNYLHQNGYIHRNIK 128
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C eta.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), eta isoform, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
nPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. nPKCs are calcium-independent,
but require DAG (1,2-diacylglycerol) and
phosphatidylserine (PS) for activity. There are four
nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta
is predominantly expressed in squamous epithelia, where
it plays a crucial role in the signaling of cell-type
specific differentiation. It is also expressed in pro-B
cells and early-stage thymocytes, and acts as a key
regulator in early B-cell development. PKC-eta increases
glioblastoma multiforme (GBM) proliferation and
resistance to radiation, and is being developed as a
therapeutic target for the management of GBM.
Length = 320
Score = 25.2 bits (55), Expect = 2.9
Identities = 7/20 (35%), Positives = 14/20 (70%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+I L ++H +GI++ D+K
Sbjct: 104 EITSALMFLHDKGIIYRDLK 123
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
Serine/Threonine Kinase, Large Tumor Suppressor.
Serine/Threonine Kinases (STKs), Large Tumor Suppressor
(LATS) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
LATS subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. LATS was originally identified in Drosophila
using a screen for genes whose inactivation led to
overproliferation of cells. In tetrapods, there are two
LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
mice results in the development of various tumors,
including sarcomas and ovarian cancer. LATS functions as
a tumor suppressor and is implicated in cell cycle
regulation.
Length = 376
Score = 25.2 bits (55), Expect = 2.9
Identities = 7/20 (35%), Positives = 12/20 (60%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
++ +E +H G +H DIK
Sbjct: 109 ELTCAIESVHKMGFIHRDIK 128
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
Kinase, Cell Division Cycle 2-like 1. Serine/Threonine
Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CDC2L1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDC2L1, also
called PITSLRE, exists in different isoforms which are
named using the alias CDK11(p). The CDC2L1 gene produces
two protein products, CDK11(p110) and CDK11(p58). CDC2L1
is also represented by the caspase-processed CDK11(p46).
CDK11(p110), the major isoform, associates with cyclin L
and is expressed throughout the cell cycle. It is
involved in RNA processing and the regulation of
transcription. CDK11(p58) associates with cyclin D3 and
is expressed during the G2/M phase of the cell cycle. It
plays roles in spindle morphogenesis, centrosome
maturation, sister chromatid cohesion, and the
completion of mitosis. CDK11(p46) is formed from the
larger isoforms by caspases during TNFalpha- and
Fas-induced apoptosis. It functions as a downstream
effector kinase in apoptotic signaling pathways and
interacts with eukaryotic initiation factor 3f (eIF3f),
p21-activated kinase (PAK1), and Ran-binding protein
(RanBPM).
Length = 293
Score = 24.9 bits (55), Expect = 3.2
Identities = 8/27 (29%), Positives = 17/27 (62%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDIK 67
+V + Q++ G+ ++H I+H D+K
Sbjct: 107 EVKCLMLQLLSGVAHLHDNWILHRDLK 133
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein
Tyrosine Kinase, Janus kinase 1. Protein Tyrosine
Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic
(c) domain (repeat 2). The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Jak1 is a member of the
Janus kinase (Jak) subfamily of proteins, which are
cytoplasmic (or nonreceptor) tyr kinases containing an
N-terminal FERM domain, followed by a Src homology 2
(SH2) domain, a pseudokinase domain, and a C-terminal
tyr kinase domain. Jaks are crucial for cytokine
receptor signaling. They are activated by
autophosphorylation upon cytokine-induced receptor
aggregation, and subsequently trigger downstream
signaling events such as the phosphorylation of signal
transducers and activators of transcription (STATs).
Jak1 is widely expressed in many tissues. Many cytokines
are dependent on Jak1 for signaling, including those
that use the shared receptor subunits common gamma chain
(IL-2, IL-4, IL-7, IL-9, IL-15, IL-21) and gp130 (IL-6,
IL-11, oncostatin M, G-CSF, and IFNs, among others). The
many varied interactions of Jak1 and its ubiquitous
expression suggest many biological roles. Jak1 is
important in neurological development, as well as in
lymphoid development and function. It also plays a role
in the pathophysiology of cardiac hypertrophy and heart
failure. A mutation in the ATP-binding site of Jak1 was
identified in a human uterine leiomyosarcoma cell line,
resulting in defective cytokine induction and antigen
presentation, thus allowing the tumor to evade the
immune system.
Length = 284
Score = 24.9 bits (54), Expect = 3.4
Identities = 10/27 (37%), Positives = 17/27 (62%)
Query: 40 KQVMYIFRQIVQGLEYIHSQGIVHHDI 66
KQ + QI +G++Y+ S+ VH D+
Sbjct: 109 KQQLKYAVQICKGMDYLGSRQYVHRDL 135
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein
Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family;
Src kinase subfamily; catalytic (c) domain. Src
subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr,
Fyn, Yrk, and Yes. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
Src (or c-Src) proteins are cytoplasmic (or
non-receptor) tyr kinases which are anchored to the
plasma membrane. They contain an N-terminal SH4 domain
with a myristoylation site, followed by SH3 and SH2
domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr. They are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
Src proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival, and
differentiation. They were identified as the first
proto-oncogene products, and they regulate cell
adhesion, invasion, and motility in cancer cells and
tumor vasculature, contributing to cancer progression
and metastasis. Src kinases are overexpressed in a
variety of human cancers, making them attractive targets
for therapy. They are also implicated in acute
inflammatory responses and osteoclast function. Src,
Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
Hck, Fgr, and Lyn show a limited expression pattern.
Length = 261
Score = 25.0 bits (55), Expect = 3.6
Identities = 8/26 (30%), Positives = 17/26 (65%)
Query: 41 QVMYIFRQIVQGLEYIHSQGIVHHDI 66
Q++ + QI +G+ Y+ S+ +H D+
Sbjct: 104 QLVDMAAQIAEGMAYLESRNYIHRDL 129
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine
Kinases, Discoidin Domain Receptors. Protein Tyrosine
Kinase (PTK) family; Discoidin Domain Receptor (DDR)
subfamily; catalytic (c) domain. The DDR subfamily
consists of homologs of mammalian DDR1, DDR2, and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
DDR subfamily members are receptor tyr kinases (RTKs)
containing an extracellular discoidin homology domain, a
transmembrane segment, an extended juxtamembrane region,
and an intracellular catalytic domain. The binding of
the ligand, collagen, to DDRs results in a slow but
sustained receptor activation. DDRs regulate cell
adhesion, proliferation, and extracellular matrix
remodeling. They have been linked to a variety of human
cancers including breast, colon, ovarian, brain, and
lung. There is no evidence showing that DDRs act as
transforming oncogenes. They are more likely to play a
role in the regulation of tumor growth and metastasis.
Length = 296
Score = 24.6 bits (54), Expect = 4.3
Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
Query: 31 YNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDI 66
N++ LS+ ++Y+ QI G+ Y+ S VH D+
Sbjct: 122 CNSKSLSF-STLLYMATQIASGMRYLESLNFVHRDL 156
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine
Kinases, Met and Ron. Protein Tyrosine Kinase (PTK)
family; Met and Ron; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Met and
Ron are receptor tyr kinases (RTKs) composed of an
alpha-beta heterodimer. The extracellular alpha chain is
disulfide linked to the beta chain, which contains an
extracellular ligand-binding region with a sema domain,
a PSI domain and four IPT repeats, a transmembrane
segment, and an intracellular catalytic domain. Binding
to their ligands leads to receptor dimerization,
autophosphorylation, activation, and intracellular
signaling. Met binds to the ligand, hepatocyte growth
factor/scatter factor (HGF/SF), and is also called the
HGF receptor. HGF/Met signaling plays a role in growth,
transformation, cell motility, invasion, metastasis,
angiogenesis, wound healing, and tissue regeneration.
Aberrant expression of Met through mutations or gene
amplification is associated with many human cancers
including hereditary papillary renal and gastric
carcinomas. The ligand for Ron is macrophage stimulating
protein (MSP). Ron signaling is important in regulating
cell motility, adhesion, proliferation, and apoptosis.
Aberrant Ron expression is implicated in tumorigenesis
and metastasis.
Length = 262
Score = 24.7 bits (54), Expect = 4.3
Identities = 8/19 (42%), Positives = 14/19 (73%)
Query: 48 QIVQGLEYIHSQGIVHHDI 66
Q+ +G+EY+ S+ VH D+
Sbjct: 106 QVAKGMEYLASKKFVHRDL 124
>gnl|CDD|235448 PRK05414, PRK05414, urocanate hydratase; Provisional.
Length = 556
Score = 24.7 bits (55), Expect = 4.5
Identities = 7/9 (77%), Positives = 7/9 (77%)
Query: 55 YIHSQGIVH 63
YI SQGIV
Sbjct: 139 YIGSQGIVQ 147
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein
Serine/Threonine Kinase, Atypical Protein Kinase C.
Serine/Threonine Kinases (STKs), Atypical Protein Kinase
C (aPKC) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
aPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. aPKCs only require
phosphatidylserine (PS) for activation. They contain a
C2-like region, instead of a calcium-binding (C2) region
found in classical PKCs, in their regulatory domain.
There are two aPKC isoforms, zeta and iota. aPKCs are
involved in many cellular functions including
proliferation, migration, apoptosis, polarity
maintenance and cytoskeletal regulation. They also play
a critical role in the regulation of glucose metabolism
and in the pathogenesis of type 2 diabetes.
Length = 329
Score = 24.4 bits (53), Expect = 5.1
Identities = 7/20 (35%), Positives = 14/20 (70%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+I L ++H +GI++ D+K
Sbjct: 104 EISLALNFLHERGIIYRDLK 123
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth
Factor Receptor-like Protein Tyrosine Kinases. Protein
Tyrosine Kinase (PTK) family; Epidermal Growth Factor
Receptor (EGFR) subfamily; catalytic (c) domain. EGFR
(HER, ErbB) subfamily members include EGFR (HER1,
ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
The EGFR proteins are receptor tyr kinases (RTKs)
containing an extracellular EGF-related ligand-binding
region, a transmembrane helix, and a cytoplasmic region
with a tyr kinase domain and a regulatory C-terminal
tail. Unlike other tyr kinases, phosphorylation of the
activation loop of EGFR proteins is not critical to
their activation. Instead, they are activated by
ligand-induced dimerization, resulting in the
phosphorylation of tyr residues in the C-terminal tail,
which serve as binding sites for downstream signaling
molecules. Collectively, they can recognize a variety of
ligands including EGF, TGFalpha, and neuregulins, among
others. All four subfamily members can form homo- or
heterodimers. HER3 contains an impaired kinase domain
and depends on its heterodimerization partner for
activation. EGFR subfamily members are involved in
signaling pathways leading to a broad range of cellular
responses including cell proliferation, differentiation,
migration, growth inhibition, and apoptosis. Gain of
function alterations, through their overexpression,
deletions, or point mutations in their kinase domains,
have been implicated in various cancers. These receptors
are targets of many small molecule inhibitors and
monoclonal antibodies used in cancer therapy.
Length = 279
Score = 24.3 bits (53), Expect = 5.4
Identities = 7/20 (35%), Positives = 13/20 (65%)
Query: 47 RQIVQGLEYIHSQGIVHHDI 66
QI +G+ Y+ + +VH D+
Sbjct: 116 VQIAKGMSYLEEKRLVHRDL 135
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine
Kinase, Discoidin Domain Receptor 2. Protein Tyrosine
Kinase (PTK) family; mammalian Discoidin Domain Receptor
2 (DDR2) and homologs; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. DDR2 is a
member of the DDR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular discoidin
homology domain, a transmembrane segment, an extended
juxtamembrane region, and an intracellular catalytic
domain. The binding of the ligand, collagen, to DDRs
results in a slow but sustained receptor activation.
DDR2 binds mostly to fibrillar collagens. More recently,
it has been reported to also bind collagen X. DDR2 is
widely expressed in many tissues with the highest levels
found in skeletal muscle, skin, kidney and lung. It is
important in cell proliferation and development. Mice,
with a deletion of DDR2, suffer from dwarfism and
delayed healing of epidermal wounds. DDR2 also
contributes to collagen (type I) regulation by
inhibiting fibrillogenesis and altering the morphology
of collagen fibers. It is also expressed in immature
dendritic cells (DCs), where it plays a role in DC
activation and function.
Length = 296
Score = 24.1 bits (52), Expect = 6.4
Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 13/63 (20%)
Query: 17 LCQIT-------LKQWLSCSTYNAEQLSYDK------QVMYIFRQIVQGLEYIHSQGIVH 63
LC IT L Q+LS D ++++ QI G++Y+ S VH
Sbjct: 94 LCMITEYMENGDLNQFLSRHEPQEAAEKADVVTISYSTLIFMATQIASGMKYLSSLNFVH 153
Query: 64 HDI 66
D+
Sbjct: 154 RDL 156
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear
Dbf2-Related kinase-like Protein Serine/Threonine
Kinases. Serine/Threonine Kinases (STKs), NDR kinase
subfamily, fungal NDR-like proteins, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The NDR subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This group is
composed of fungal NDR-like proteins including
Saccharomyces cerevisiae CBK1 (or CBK1p),
Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago
maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like
NDR kinase, group members contain an N-terminal
regulatory (NTR) domain and an insert within the
catalytic domain that contains an auto-inhibitory
sequence. CBK1 is an essential component in the RAM
(regulation of Ace2p activity and cellular
morphogenesis) network. CBK1 and Orb6 play similar roles
in coordinating cell morphology with cell cycle
progression. Ukc1 is involved in morphogenesis,
pathogenicity, and pigment formation. Cot1 plays a role
in polar tip extension.
Length = 377
Score = 24.0 bits (52), Expect = 7.6
Identities = 8/20 (40%), Positives = 12/20 (60%)
Query: 48 QIVQGLEYIHSQGIVHHDIK 67
+ V +E +H G +H DIK
Sbjct: 109 ECVLAIEAVHKLGFIHRDIK 128
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain
Receptor-like Protein Tyrosine Kinases. Protein
Tyrosine Kinase (PTK) family; Discoidin Domain Receptor
(DDR)-like proteins; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. DDR-like
proteins are members of the DDR subfamily, which are
receptor tyr kinases (RTKs) containing an extracellular
discoidin homology domain, a transmembrane segment, an
extended juxtamembrane region, and an intracellular
catalytic domain. The binding of the ligand, collagen,
to DDRs results in a slow but sustained receptor
activation. DDRs regulate cell adhesion, proliferation,
and extracellular matrix remodeling. They have been
linked to a variety of human cancers including breast,
colon, ovarian, brain, and lung. There is no evidence
showing that DDRs act as transforming oncogenes. They
are more likely to play a role in the regulation of
tumor growth and metastasis.
Length = 295
Score = 23.8 bits (51), Expect = 8.1
Identities = 9/25 (36%), Positives = 16/25 (64%)
Query: 42 VMYIFRQIVQGLEYIHSQGIVHHDI 66
++Y+ QI G++Y+ S VH D+
Sbjct: 131 LLYMAVQIASGMKYLASLNFVHRDL 155
>gnl|CDD|176917 cd08908, START_STARD12-like, C-terminal lipid-binding START
domain of mammalian STARD12 and related proteins, which
also have an N-terminal Rho GTPase-activating protein
(RhoGAP) domain. This subgroup includes the
steroidogenic acute regulatory protein (StAR)-related
lipid transfer (START) domains of STARD12 (also known
as DLC-1, Arhgap7, and p122-RhoGAP) and related
proteins. It belongs to the START domain family, and in
turn to the SRPBCC
(START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain
superfamily of proteins that bind hydrophobic ligands.
SRPBCC domains have a deep hydrophobic ligand-binding
pocket. Proteins belonging to this subgroup also have
an N-terminal SAM (sterile alpha motif) domain and a
RhoGAP domain, and have a SAM-RhoGAP-START domain
organization. The precise function of the START domain
in this subgroup is unclear.
Length = 204
Score = 23.8 bits (51), Expect = 9.0
Identities = 9/19 (47%), Positives = 11/19 (57%)
Query: 22 LKQWLSCSTYNAEQLSYDK 40
K W+S ST +LSY K
Sbjct: 26 FKGWVSYSTSEQAELSYKK 44
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.326 0.135 0.440
Gapped
Lambda K H
0.267 0.0807 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,313,461
Number of extensions: 215577
Number of successful extensions: 490
Number of sequences better than 10.0: 1
Number of HSP's gapped: 489
Number of HSP's successfully gapped: 217
Length of query: 67
Length of database: 10,937,602
Length adjustment: 38
Effective length of query: 29
Effective length of database: 9,252,150
Effective search space: 268312350
Effective search space used: 268312350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (24.0 bits)