Diaphorina citri psyllid: psy9321

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MQWLTEDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK
ccccccccEEEEEEEccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccc
*QWLTEDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQWLTEDWVTLYIQMQLCQITLKQWLSCSTYNAEQLSYDKQVMYIFRQIVQGLEYIHSQGIVHHDIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051246 [BP]regulation of protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0004694 [MF]eukaryotic translation initiation factor 2alpha kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0004686 [MF]elongation factor-2 kinase activityprobableGO:0004683, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:2000113 [BP]negative regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0010605, GO:0019222, GO:0009890, GO:0031327, GO:0031326, GO:0031323, GO:0031324, GO:2000112, GO:0050794, GO:0050789, GO:0060255, GO:0010556, GO:0065007, GO:0008150, GO:0048519, GO:0009892, GO:0010558, GO:0048523
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009628 [BP]response to abiotic stimulusprobableGO:0050896, GO:0008150
GO:1901363 [MF]heterocyclic compound bindingprobableGO:0003674, GO:0005488
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0097159 [MF]organic cyclic compound bindingprobableGO:0003674, GO:0005488
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0006984 [BP]ER-nucleus signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G31, chain A
Confidence level:very confident
Coverage over the Query: 8-67
View the alignment between query and template
View the model in PyMOL