Query         psy9336
Match_columns 99
No_of_seqs    105 out of 253
Neff          5.0 
Searched_HMMs 46136
Date          Sat Aug 17 00:42:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9336.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9336hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2157|consensus               99.0 2.7E-10 5.9E-15   95.6   4.3   70   25-99     72-143 (497)
  2 KOG2156|consensus               98.8 1.2E-09 2.6E-14   92.9   1.3   71   22-99    190-261 (662)
  3 KOG2158|consensus               93.8  0.0068 1.5E-07   51.8  -2.4   35   57-97    151-185 (565)
  4 PF11193 DUF2812:  Protein of u  78.9     4.7  0.0001   26.8   4.3   49   24-73     33-90  (115)
  5 PF06399 GFRP:  GTP cyclohydrol  70.1     3.7 8.1E-05   27.5   2.0   35   30-64     45-79  (83)
  6 PF14847 Ras_bdg_2:  Ras-bindin  63.4     1.7 3.8E-05   29.8  -0.6   48   38-95     25-77  (105)
  7 KOG2155|consensus               60.3     9.2  0.0002   33.3   3.0   62   28-96    305-366 (631)
  8 PRK13999 potassium-transportin  53.2     7.3 0.00016   29.9   1.2   18    7-24     86-103 (201)
  9 PRK13995 potassium-transportin  44.9      12 0.00027   28.7   1.3   18    7-24     84-101 (203)
 10 TIGR00681 kdpC K+-transporting  42.6      14  0.0003   28.1   1.2   18    7-24     73-90  (187)
 11 PRK00315 potassium-transportin  41.9      14 0.00031   28.1   1.2   18    7-24     75-92  (193)
 12 PF00919 UPF0004:  Uncharacteri  41.4      30 0.00065   23.0   2.6   30   39-69     18-47  (98)
 13 PRK13998 potassium-transportin  38.6      16 0.00034   27.8   1.0   17    8-24     81-97  (186)
 14 PF05382 Amidase_5:  Bacterioph  37.8      26 0.00057   25.3   2.0   21   39-60     55-75  (145)
 15 PRK14000 potassium-transportin  37.3      18 0.00039   27.4   1.1   17    8-24     82-98  (185)
 16 PF15337 Vasculin:  Vascular pr  34.5      27 0.00058   24.1   1.5   14   41-54     13-26  (97)
 17 PRK14001 potassium-transportin  33.9      19 0.00042   27.3   0.8   18    7-24     74-91  (189)
 18 TIGR01619 hyp_HI0040 conserved  31.6      26 0.00056   27.6   1.2   40   28-69     91-133 (249)
 19 TIGR02695 azurin azurin. Azuri  29.8      24 0.00052   25.2   0.7   15   83-97    105-119 (125)
 20 PRK13994 potassium-transportin  29.8      30 0.00064   27.0   1.2   18    7-24    100-117 (222)
 21 PRK14003 potassium-transportin  29.1      27 0.00058   26.6   0.9   18    7-24     82-99  (194)
 22 PRK14002 potassium-transportin  27.3      29 0.00064   26.3   0.8   16    9-24     72-87  (186)
 23 PRK02813 putative aminopeptida  27.1      48   0.001   27.7   2.1   21   40-61     28-48  (428)
 24 PF02669 KdpC:  K+-transporting  27.0      33 0.00072   26.0   1.1   16    9-24     76-91  (188)
 25 PF02127 Peptidase_M18:  Aminop  25.3      46   0.001   27.9   1.7   21   40-61     15-35  (432)
 26 PTZ00371 aspartyl aminopeptida  24.7      57  0.0012   27.5   2.2   21   40-61     29-49  (465)
 27 PRK13996 potassium-transportin  23.6      39 0.00084   25.8   0.9   18    7-24     80-97  (197)
 28 PF01585 G-patch:  G-patch doma  23.2      58  0.0013   18.7   1.4   16   37-52      2-17  (45)
 29 COG0505 CarA Carbamoylphosphat  23.2 1.3E+02  0.0027   25.3   3.8   46    2-51    159-204 (368)
 30 PRK10562 putative acetyltransf  23.0 2.1E+02  0.0046   18.8   4.4   36   28-63     99-136 (145)
 31 PF01427 Peptidase_M15:  D-ala-  22.5 1.1E+02  0.0024   22.8   3.2   34   39-74    161-194 (198)
 32 COG2156 KdpC K+-transporting A  22.1      50  0.0011   25.2   1.2   18    7-24     76-93  (190)
 33 KOG3490|consensus               22.1      22 0.00048   25.0  -0.6   17   81-97     65-82  (111)
 34 KOG3347|consensus               21.2      85  0.0018   23.7   2.3   29   25-53     91-119 (176)
 35 COG1724 Predicted RNA binding   21.1      76  0.0016   20.4   1.7   14   40-53     12-25  (66)
 36 TIGR01579 MiaB-like-C MiaB-lik  20.4   1E+02  0.0022   24.8   2.8   30   39-69     15-44  (414)
 37 PF08373 RAP:  RAP domain;  Int  20.1      35 0.00077   19.7   0.0   22   40-61     23-44  (58)

No 1  
>KOG2157|consensus
Probab=99.01  E-value=2.7e-10  Score=95.60  Aligned_cols=70  Identities=36%  Similarity=0.714  Sum_probs=56.4

Q ss_pred             CCCceEEEecCCch-HHHHHHHhcCCEEccCCCCCceEEecccccccccccccccCCCCCC-CeecCCCCccccccC
Q psy9336          25 RQNKIYYCTDLDKS-VLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFSLELGYRMNDN-QIINHFPNHYELTNL   99 (99)
Q Consensus        25 ~~~~i~f~~~~~~t-vv~~vl~~rGW~ev~~~~~dWnl~W~d~~~~~~~f~~~~~~~L~~~-QrVNHFPn~yELTRK   99 (99)
                      ...+|.|+++..+. +|.+.+.++||.++.....+|||+|+.++.+...+.     .+.++ |+|||||+++|||||
T Consensus        72 ~k~~i~y~~~~~~~~~i~~~~~~~G~l~~~~~~~~~~f~w~~~~~~~~~~~-----~~~p~~~~~~~~p~~~~L~rk  143 (497)
T KOG2157|consen   72 GKHKIKYRTQEKEPKLLNNFLNREGWLQFTESAEDWNFYWRGYEGIDFDFS-----WLAPYNQVVNHFPRRKELTRK  143 (497)
T ss_pred             CCCceEEEecccchHHHHHHHhhcceeeecccccceEEEEeccccccHHHh-----hhcchhhhhhccccHHHhhhh
Confidence            34689999999986 444444445999987677899999999877766553     57788 999999999999997


No 2  
>KOG2156|consensus
Probab=98.81  E-value=1.2e-09  Score=92.94  Aligned_cols=71  Identities=20%  Similarity=0.345  Sum_probs=57.1

Q ss_pred             CCCCCCceEEEecCCc-hHHHHHHHhcCCEEccCCCCCceEEecccccccccccccccCCCCCCCeecCCCCccccccC
Q psy9336          22 PSDRQNKIYYCTDLDK-SVLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFSLELGYRMNDNQIINHFPNHYELTNL   99 (99)
Q Consensus        22 ~~~~~~~i~f~~~~~~-tvv~~vl~~rGW~ev~~~~~dWnl~W~d~~~~~~~f~~~~~~~L~~~QrVNHFPn~yELTRK   99 (99)
                      +++....++|+.+-.- .||+.+|.+-||+.++ ..+||..+|....-...      .+.+++||+||||||+|.|.||
T Consensus       190 p~~~~~vl~w~~t~~~p~vv~~vl~~sgfkivk-~n~dw~g~Wg~h~ksp~------fr~ir~HQkvNH~PGsF~IGRK  261 (662)
T KOG2156|consen  190 PPPLHAVLKWKPTEVMPKVVRQVLANSGFKIVK-VNDDWMGVWGHHLKSPS------FRAIRSHQKVNHFPGSFRIGRK  261 (662)
T ss_pred             ChhHHHHhccCCcchhHHHHHHHHHhcccEEec-ccchHHHHhhhhcCCch------hhhhhhhhhhccCCCccccccc
Confidence            4444566788776643 4789999999999999 88999999987654433      2468999999999999999998


No 3  
>KOG2158|consensus
Probab=93.83  E-value=0.0068  Score=51.79  Aligned_cols=35  Identities=20%  Similarity=0.086  Sum_probs=25.0

Q ss_pred             CCceEEecccccccccccccccCCCCCCCeecCCCCccccc
Q psy9336          57 DDWNFYWAGIQTCRNIFSLELGYRMNDNQIINHFPNHYELT   97 (99)
Q Consensus        57 ~dWnl~W~d~~~~~~~f~~~~~~~L~~~QrVNHFPn~yELT   97 (99)
                      .+|++.|+.....-.+     ++.++ .|+|||||+|-|++
T Consensus       151 ~~~~~l~~v~f~~~~~-----~~~~~-fqrvn~fPgm~e~~  185 (565)
T KOG2158|consen  151 EKYENLLAVAFQTFLS-----GRAAS-FQRENNFPGMREKE  185 (565)
T ss_pred             hhhhhHHHHhhchhhh-----ccchh-hhhhhcCchHHHHH
Confidence            4688888764333222     34566 89999999999987


No 4  
>PF11193 DUF2812:  Protein of unknown function (DUF2812);  InterPro: IPR021359  This is a bacterial family of uncharacterised proteins, however some members of this family are annotated as membrane proteins. 
Probab=78.91  E-value=4.7  Score=26.82  Aligned_cols=49  Identities=20%  Similarity=0.441  Sum_probs=37.9

Q ss_pred             CCCCceEEEecCC----c--h-HHHHHHHhcCCEEc-cCCCCCceEEeccccccc-ccc
Q psy9336          24 DRQNKIYYCTDLD----K--S-VLINNFEKRGWIHV-NSVEDDWNFYWAGIQTCR-NIF   73 (99)
Q Consensus        24 ~~~~~i~f~~~~~----~--t-vv~~vl~~rGW~ev-~~~~~dWnl~W~d~~~~~-~~f   73 (99)
                      +.+..++|+.|+.    +  . =-.+.++..||+.+ . ....|.++.+...... +++
T Consensus        33 ~ep~~~~Y~vd~~~~~~~~~~~~y~~~~e~~GW~~v~~-~~~~~~if~~~~~~~~~~i~   90 (115)
T PF11193_consen   33 GEPKDYRYRVDFNDPKSKEEQKEYLEFFEEAGWEYVYS-NFGGWQIFRKEEDDGPPEIY   90 (115)
T ss_pred             CCCceEEEEEEEccccchhhhHHHHHHHHHCCCEEEec-cCcEEEEEEEcCCCCCCCCc
Confidence            4577899999987    2  1 24588999999999 6 6788999999877665 444


No 5  
>PF06399 GFRP:  GTP cyclohydrolase I feedback regulatory protein (GFRP);  InterPro: IPR009112 GTP cyclohydrolase I feedback regulatory protein (GFRP) in mammals helps regulate the biosynthesis of tetrahydrobiopterin through the feedback inhibition of the rate-limiting enzyme GTP cyclohydrolase I (GTPCHI). Tetrahydrobiopterin is the cofactor required for the hydroxylation of aromatic amino acids. The crystal structure of GFRP reveals that the protein forms a homopentamer []. In the presence of phenylalanine, the stimulatory complex consists of a GTPCHI decamer sandwiched by two GFRP pentamers, which is thought to enhance GTPCHI activity by locking the enzyme in the active state []. The structure of GFRP consists of two alpha/beta layers arranged beta(2)-alpha-beta(2)-alpha-beta(2), with antiparallel beta-sheets in the order 342165.; GO: 0009890 negative regulation of biosynthetic process; PDB: 1IS7_N 1IS8_Q 1WPL_T 1JG5_C.
Probab=70.12  E-value=3.7  Score=27.50  Aligned_cols=35  Identities=26%  Similarity=0.402  Sum_probs=27.1

Q ss_pred             EEEecCCchHHHHHHHhcCCEEccCCCCCceEEec
Q psy9336          30 YYCTDLDKSVLINNFEKRGWIHVNSVEDDWNFYWA   64 (99)
Q Consensus        30 ~f~~~~~~tvv~~vl~~rGW~ev~~~~~dWnl~W~   64 (99)
                      -|.++....+|.+-|+.+||+.+.-....+-+.||
T Consensus        45 ey~~~~~Pr~VLnKLE~~G~kVvsmtgvgqt~vWt   79 (83)
T PF06399_consen   45 EYHVDDPPRVVLNKLEKMGYKVVSMTGVGQTLVWT   79 (83)
T ss_dssp             EEEESS-HHHHHHHHHHTTEEEEEEEEETTEEEEE
T ss_pred             EEEcCCChHHHHHHHHhcCeEEEEEeccCceEEEE
Confidence            57778777777899999999988644556788886


No 6  
>PF14847 Ras_bdg_2:  Ras-binding domain of Byr2; PDB: 1I35_A 1K8R_B.
Probab=63.39  E-value=1.7  Score=29.83  Aligned_cols=48  Identities=21%  Similarity=0.309  Sum_probs=31.2

Q ss_pred             hHHHHHHHhcCCEEccCCCCCceEEeccc-----ccccccccccccCCCCCCCeecCCCCccc
Q psy9336          38 SVLINNFEKRGWIHVNSVEDDWNFYWAGI-----QTCRNIFSLELGYRMNDNQIINHFPNHYE   95 (99)
Q Consensus        38 tvv~~vl~~rGW~ev~~~~~dWnl~W~d~-----~~~~~~f~~~~~~~L~~~QrVNHFPn~yE   95 (99)
                      .|+..+|++.|..+   ...+|++|+.+.     ..++.+.|.       +--.|+|.|+.-|
T Consensus        25 eI~~rvLKKfg~~~---~~~~~~~~v~d~~~~~~~~~~~LsD~-------EL~~IC~s~~r~e   77 (105)
T PF14847_consen   25 EIKRRVLKKFGLPE---HPRNYCFYVLDGESPDPSNCRPLSDV-------ELVTICHSPDRPE   77 (105)
T ss_dssp             HHHHHHHHHHTSS-----CCCEEEEEE-S-----SSEEEE-SS-------HHHHHHHTT--SS
T ss_pred             HHHHHHHHHcCCcc---ccccceEEEecccccccccceECcHH-------HHHHHHcCCCCcc
Confidence            48899999999988   256899999998     444555443       2346788887655


No 7  
>KOG2155|consensus
Probab=60.28  E-value=9.2  Score=33.28  Aligned_cols=62  Identities=19%  Similarity=0.155  Sum_probs=45.5

Q ss_pred             ceEEEecCCchHHHHHHHhcCCEEccCCCCCceEEecccccccccccccccCCCCCCCeecCCCCcccc
Q psy9336          28 KIYYCTDLDKSVLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFSLELGYRMNDNQIINHFPNHYEL   96 (99)
Q Consensus        28 ~i~f~~~~~~tvv~~vl~~rGW~ev~~~~~dWnl~W~d~~~~~~~f~~~~~~~L~~~QrVNHFPn~yEL   96 (99)
                      +|+--||..  -|.+-|.+.-++-++ +..|=|++|..++.-    |+..+..-.|-|.||.||=--=|
T Consensus       305 ~~kVYtD~~--Qv~e~Lt~p~f~~t~-~~kdADilw~~~hf~----Dykkls~e~p~~~iNQFPfE~cl  366 (631)
T KOG2155|consen  305 KIKVYTDDT--QVTEHLTNPKFEYTD-DIKDADILWMIKHFH----DYKKLSEENPCGMINQFPFESCL  366 (631)
T ss_pred             eeEEEcCcH--HHHHhccCCceEecc-CccccceeeehhhHH----HHHHHhccCCcceeccCchHHHH
Confidence            566555554  346889999999998 888999999877653    33345567899999999954333


No 8  
>PRK13999 potassium-transporting ATPase subunit C; Provisional
Probab=53.15  E-value=7.3  Score=29.87  Aligned_cols=18  Identities=33%  Similarity=0.543  Sum_probs=15.7

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      +.||.+.+||++|+++..
T Consensus        86 ~~~y~~~~SGgSNlgpsn  103 (201)
T PRK13999         86 PAPYNAANSMGSNLGPTS  103 (201)
T ss_pred             CCCCCcccccccCCCCCC
Confidence            457999999999999875


No 9  
>PRK13995 potassium-transporting ATPase subunit C; Provisional
Probab=44.88  E-value=12  Score=28.68  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=15.7

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..||.+.+||++|+++..
T Consensus        84 ~~~y~~~~SggSNlgpsn  101 (203)
T PRK13995         84 NGNYGGVSSGSQNYAPTN  101 (203)
T ss_pred             cCCCCcccccccCCCCCC
Confidence            457999999999999875


No 10 
>TIGR00681 kdpC K+-transporting ATPase, C subunit. This chain has a single predicted transmembrane region near the amino end. It is part of a K+-transport ATPase that contains two other membrane-bound subunits, KdpA and KdpB, and a small subunit KdpF. KdpA is the K+-translocating subunit, KdpB the ATP-hydrolyzing subunit. During assembly of the complex, KdpA and KdpC bind to each other. This interaction is thought to stabilize the complex [PubMed:9858692]. Data indicates that KdpC might connect the KdpA, the K+-transporting subunit, to KdpB, the ATP-hydrolyzing (energy providing) subunit [PubMed:9858692].
Probab=42.58  E-value=14  Score=28.06  Aligned_cols=18  Identities=33%  Similarity=0.580  Sum_probs=15.8

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..||.+.+||++|+++..
T Consensus        73 ~~~y~~~~SggSNl~psn   90 (187)
T TIGR00681        73 YSEYPTGASGGSNLAPSN   90 (187)
T ss_pred             CCCCCcccccccCCCCCC
Confidence            558999999999999975


No 11 
>PRK00315 potassium-transporting ATPase subunit C; Reviewed
Probab=41.87  E-value=14  Score=28.07  Aligned_cols=18  Identities=39%  Similarity=0.805  Sum_probs=15.7

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      +.+|.+.+||++|+++..
T Consensus        75 ~~~y~~~~SggSNl~psn   92 (193)
T PRK00315         75 PMPYNPQASGGSNLAPSN   92 (193)
T ss_pred             CCCCCcccccccCCCCCC
Confidence            457999999999999875


No 12 
>PF00919 UPF0004:  Uncharacterized protein family UPF0004;  InterPro: IPR013848  The methylthiotransferase (MTTase) or miaB-like family is named after the (dimethylallyl)adenosine tRNA MTTase miaB protein, which catalyses a C-H to C-S bond conversion in the methylthiolation of tRNA. A related bacterial enzyme rimO performs a similar methylthiolation, but on a protein substrate. RimO acts on the ribosomal protein S12 and forms a separate MTTase subfamily. The miaB-subfamily includes mammalian CDK5 regulatory subunit-associated proteins and similar proteins in other eukaryotes. Two other subfamilies, yqeV and CDKAL1, are named after a Bacillus subtilis and a human protein, respectively. While yqeV-like proteins are found in bacteria, CDKAL1 subfamily members occur in eukaryotes and in archaebacteria. The likely MTTases from these 4 subfamilies contain an N-terminal MTTase domain, a central radical generating fold and a C-terminal TRAM domain (see PDOC50926 from PROSITEDOC). The core forms a radical SAM fold (or AdoMet radical), containing a cysteine motif CxxxCxxC that binds a [4Fe-4S] cluster [, , ]. A reducing equivalent from the [4Fe-4S]+ cluster is used to cleave S-adenosylmethionine (SAM) to generate methionine and a 5'-deoxyadenosyl radical. The latter is thought to produce a reactive substrate radical that is amenable to sulphur insertion [, ]. The N-terminal MTTase domain contains 3 cysteines that bind a second [4Fe-4S] cluster, in addition to the radical-generating [4Fe-4S] cluster, which could be involved in the thiolation reaction. The C-terminal TRAM domain is not shared with other radical SAM proteins outside the MTTase family. The TRAM domain can bind to RNA substrate and seems to be important for substrate recognition. The tertiary structure of the central radical SAM fold has six beta/alpha motifs resembling a three-quarter TIM barrel core (see PDOC00155 from PROSITEDOC) []. The N-terminal MTTase domain might form an additional [beta/alpha]2 TIM barrel unit []. ; GO: 0003824 catalytic activity, 0051539 4 iron, 4 sulfur cluster binding, 0009451 RNA modification
Probab=41.40  E-value=30  Score=22.98  Aligned_cols=30  Identities=10%  Similarity=0.108  Sum_probs=22.0

Q ss_pred             HHHHHHHhcCCEEccCCCCCceEEecccccc
Q psy9336          39 VLINNFEKRGWIHVNSVEDDWNFYWAGIQTC   69 (99)
Q Consensus        39 vv~~vl~~rGW~ev~~~~~dWnl~W~d~~~~   69 (99)
                      .|...|.++||.+++ +.++=|++=-++-.+
T Consensus        18 ~i~~~l~~~G~~~~~-~~e~AD~iiiNTC~V   47 (98)
T PF00919_consen   18 RIASILQAAGYEIVD-DPEEADVIIINTCTV   47 (98)
T ss_pred             HHHHHHHhcCCeeec-ccccCCEEEEEcCCC
Confidence            678999999999998 556667665444333


No 13 
>PRK13998 potassium-transporting ATPase subunit C; Provisional
Probab=38.60  E-value=16  Score=27.78  Aligned_cols=17  Identities=24%  Similarity=0.159  Sum_probs=14.9

Q ss_pred             cceecCCCccccccCCC
Q psy9336           8 YPYQANGSGQQNVSPSD   24 (99)
Q Consensus         8 ~~~~~~~~~~~~~~~~~   24 (99)
                      .||.+.+||++|+++..
T Consensus        81 ~~y~~~~SggSNl~psn   97 (186)
T PRK13998         81 LYKNGVSSGGSNESNGN   97 (186)
T ss_pred             cCCCcccccccCCCCCC
Confidence            47999999999999875


No 14 
>PF05382 Amidase_5:  Bacteriophage peptidoglycan hydrolase ;  InterPro: IPR008044 This entry is represented by Bacteriophage SFi21, lysin (Cell wall hydrolase; 3.5.1.28 from EC). At least one of proteins in this entry, the Pal protein from the pneumococcal bacteriophage Dp-1 (O03979 from SWISSPROT) has been shown to be an N-acetylmuramoyl-L-alanine amidase []. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside within this domain while a C-terminal domain binds to the choline residues of the cell wall teichoic acids [, ].
Probab=37.84  E-value=26  Score=25.30  Aligned_cols=21  Identities=29%  Similarity=0.613  Sum_probs=16.7

Q ss_pred             HHHHHHHhcCCEEccCCCCCce
Q psy9336          39 VLINNFEKRGWIHVNSVEDDWN   60 (99)
Q Consensus        39 vv~~vl~~rGW~ev~~~~~dWn   60 (99)
                      -+.+.|++.||+++. +..+|+
T Consensus        55 tl~~~L~~~G~~~I~-~~~~~~   75 (145)
T PF05382_consen   55 TLHDWLKKNGFKKIS-ENVDWN   75 (145)
T ss_pred             HHHHHHhhCCcEEec-cCCccc
Confidence            457999999999998 555674


No 15 
>PRK14000 potassium-transporting ATPase subunit C; Provisional
Probab=37.31  E-value=18  Score=27.39  Aligned_cols=17  Identities=24%  Similarity=0.182  Sum_probs=15.1

Q ss_pred             cceecCCCccccccCCC
Q psy9336           8 YPYQANGSGQQNVSPSD   24 (99)
Q Consensus         8 ~~~~~~~~~~~~~~~~~   24 (99)
                      .||.+.+||++|+++..
T Consensus        82 ~~y~~~~SggSNl~psn   98 (185)
T PRK14000         82 KESGGPASGGSNYGNSN   98 (185)
T ss_pred             cCCCcccccccCCCCCC
Confidence            48999999999999875


No 16 
>PF15337 Vasculin:  Vascular protein family Vasculin-like 1
Probab=34.47  E-value=27  Score=24.06  Aligned_cols=14  Identities=14%  Similarity=0.328  Sum_probs=11.7

Q ss_pred             HHHHHhcCCEEccC
Q psy9336          41 INNFEKRGWIHVNS   54 (99)
Q Consensus        41 ~~vl~~rGW~ev~~   54 (99)
                      ..+|+++||+|..+
T Consensus        13 hRLLk~MGWqEy~e   26 (97)
T PF15337_consen   13 HRLLKAMGWQEYPE   26 (97)
T ss_pred             HHHHHHhcccccCc
Confidence            57899999999973


No 17 
>PRK14001 potassium-transporting ATPase subunit C; Provisional
Probab=33.90  E-value=19  Score=27.29  Aligned_cols=18  Identities=28%  Similarity=0.462  Sum_probs=15.5

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..||.+.+||++|+++..
T Consensus        74 ~~~y~~~~SggSNl~psn   91 (189)
T PRK14001         74 GDGYDAAASSGSNLGPTN   91 (189)
T ss_pred             CCCCCcccccccCCCCCC
Confidence            348999999999999975


No 18 
>TIGR01619 hyp_HI0040 conserved hypothetical protein, TIGR01619. This model represents a hypothetical equivalog of gamma proteobacteria, includes HI0040. These sequences do not have any similarity to known proteins by PSI-BLAST.
Probab=31.58  E-value=26  Score=27.58  Aligned_cols=40  Identities=15%  Similarity=0.434  Sum_probs=28.6

Q ss_pred             ceEEEecCCchHHHHHHHhcCCE---EccCCCCCceEEecccccc
Q psy9336          28 KIYYCTDLDKSVLINNFEKRGWI---HVNSVEDDWNFYWAGIQTC   69 (99)
Q Consensus        28 ~i~f~~~~~~tvv~~vl~~rGW~---ev~~~~~dWnl~W~d~~~~   69 (99)
                      .+.|-|.... .+.++|...|+.   .+. ++.+|++||.--.+-
T Consensus        91 ~~yFY~~~~e-~~~~~l~~f~y~~~~~~~-eDp~Wd~Yf~fLyPs  133 (249)
T TIGR01619        91 KIHFYCDHEE-LFLETLKQFDEIKAIEIQ-KDLHWDIYFDFLLAS  133 (249)
T ss_pred             EEEEEcCChH-HHHHHHHhCCcccccccc-cCCCHHHHHHhhCCC
Confidence            4667777766 446888888774   444 788999999766554


No 19 
>TIGR02695 azurin azurin. Azurin is a blue copper-binding protein in the plastocyanin/azurin family (see Pfam model pfam00127). It serves as a redox partner to enzymes such as nitrite reductase or arsenite oxidase. The most closely related copper-binding proteins to this family are auracyanins, as in Chloroflexus aurantiacus, which have similar redox activities.
Probab=29.82  E-value=24  Score=25.21  Aligned_cols=15  Identities=27%  Similarity=0.680  Sum_probs=13.3

Q ss_pred             CCCeecCCCCccccc
Q psy9336          83 DNQIINHFPNHYELT   97 (99)
Q Consensus        83 ~~QrVNHFPn~yELT   97 (99)
                      +|.-+|=|||||.|=
T Consensus       105 ~Y~f~CSFPGH~~~M  119 (125)
T TIGR02695       105 DYTFFCSFPGHWAMM  119 (125)
T ss_pred             cceEEEcCCCcHHhc
Confidence            699999999999863


No 20 
>PRK13994 potassium-transporting ATPase subunit C; Provisional
Probab=29.75  E-value=30  Score=26.98  Aligned_cols=18  Identities=28%  Similarity=0.259  Sum_probs=15.7

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..||.+.+||++|+++..
T Consensus       100 ~~~Y~~~~SggSNlgpsn  117 (222)
T PRK13994        100 NTQYSLILSGATNRSADN  117 (222)
T ss_pred             CCCCCcccccccCCCCCC
Confidence            458999999999999875


No 21 
>PRK14003 potassium-transporting ATPase subunit C; Provisional
Probab=29.11  E-value=27  Score=26.64  Aligned_cols=18  Identities=28%  Similarity=0.373  Sum_probs=15.4

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..||.+.+||++|+++..
T Consensus        82 ~~~y~~~~SggSNl~psn   99 (194)
T PRK14003         82 EPAKPTGISGASNLAPSN   99 (194)
T ss_pred             ccCCCcCcCCCcCCCCCC
Confidence            457999999999999974


No 22 
>PRK14002 potassium-transporting ATPase subunit C; Provisional
Probab=27.30  E-value=29  Score=26.27  Aligned_cols=16  Identities=50%  Similarity=0.794  Sum_probs=14.6

Q ss_pred             ceecCCCccccccCCC
Q psy9336           9 PYQANGSGQQNVSPSD   24 (99)
Q Consensus         9 ~~~~~~~~~~~~~~~~   24 (99)
                      ||.+.+||++|+++..
T Consensus        72 ~y~~~~SggSNl~psn   87 (186)
T PRK14002         72 GYNAAGSGGSNKGPSN   87 (186)
T ss_pred             CCCcccccccCCCCCC
Confidence            8999999999999875


No 23 
>PRK02813 putative aminopeptidase 2; Provisional
Probab=27.05  E-value=48  Score=27.66  Aligned_cols=21  Identities=19%  Similarity=0.635  Sum_probs=17.3

Q ss_pred             HHHHHHhcCCEEccCCCCCceE
Q psy9336          40 LINNFEKRGWIHVNSVEDDWNF   61 (99)
Q Consensus        40 v~~vl~~rGW~ev~~~~~dWnl   61 (99)
                      +.+.|++.||+|.+ +.+.|+|
T Consensus        28 ~~~~L~~~Gf~~l~-e~~~w~l   48 (428)
T PRK02813         28 VAQRLEAAGFTELD-ETDAWKL   48 (428)
T ss_pred             HHHHHHHcCCeecc-ccccCcc
Confidence            46889999999998 6667875


No 24 
>PF02669 KdpC:  K+-transporting ATPase, c chain;  InterPro: IPR003820 Kdp, the high affinity ATP-driven K+-transport system of Escherichia coli, is a complex of the membrane-bound subunits KdpA, KdpB, KdpC and the small peptide KdpF. KdpC forms strong interactions with the KdpA subunit, serving to assemble and stabilise the Kdp complex []. It has been suggested that KdpC could be one of the connecting links between the energy providing subunit KdpB and the K+- transporting subunit KdpA []. The K+ transport system actively transports K+ ions via ATP hydrolysis.; GO: 0008556 potassium-transporting ATPase activity, 0006813 potassium ion transport, 0016020 membrane
Probab=26.99  E-value=33  Score=25.96  Aligned_cols=16  Identities=44%  Similarity=0.775  Sum_probs=14.2

Q ss_pred             ceecCCCccccccCCC
Q psy9336           9 PYQANGSGQQNVSPSD   24 (99)
Q Consensus         9 ~~~~~~~~~~~~~~~~   24 (99)
                      +|.+.+||++|+++..
T Consensus        76 ~y~~~~SggSNl~psn   91 (188)
T PF02669_consen   76 TYNAAASGGSNLGPSN   91 (188)
T ss_pred             CCCccccccccCCCCC
Confidence            4889999999999885


No 25 
>PF02127 Peptidase_M18:  Aminopeptidase I zinc metalloprotease (M18);  InterPro: IPR001948 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M18, (clan MH). The proteins have two catalytic zinc ions at the active site, bound by His/Asp, Asp, Glu, Asp/Glu and His. The catalysed reaction involves the release of an N-terminal aminoacid, usually neutral or hydrophobic, from a polypeptide []. The type example is aminopeptidase I from Saccharomyces cerevisiae (Baker's yeast), the sequence of which has been deduced, and the mature protein shown to consist of 469 amino acids []. A 45-residue presequence contains both positively- and negatively-charged and hydrophobic residues, which could be arranged in an N-terminal amphiphilic alpha-helix []. The presequence differs from signal sequences that direct proteins across bacterial plasma membranes and endoplasmic reticulum or into mitochondria. It is unclear how this unique presequence targets aminopeptidase I to yeast vacuoles, and how this sorting utilises classical protein secretory pathways [].; GO: 0004177 aminopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis; PDB: 1Y7E_A 2GLJ_R 4DYO_A 2IJZ_B 3VAT_A 3VAR_A 2GLF_B.
Probab=25.33  E-value=46  Score=27.89  Aligned_cols=21  Identities=19%  Similarity=0.631  Sum_probs=17.4

Q ss_pred             HHHHHHhcCCEEccCCCCCceE
Q psy9336          40 LINNFEKRGWIHVNSVEDDWNF   61 (99)
Q Consensus        40 v~~vl~~rGW~ev~~~~~dWnl   61 (99)
                      +.+.|++.||+|.+ +.+.|++
T Consensus        15 ~~~~L~~~GF~eL~-e~~~W~l   35 (432)
T PF02127_consen   15 AKERLEKAGFTELD-ETEKWDL   35 (432)
T ss_dssp             HHHHHHHTTHEEST-TTSSTT-
T ss_pred             HHHHHHHcCCeEcc-cccccCC
Confidence            46889999999999 8888963


No 26 
>PTZ00371 aspartyl aminopeptidase; Provisional
Probab=24.68  E-value=57  Score=27.51  Aligned_cols=21  Identities=24%  Similarity=0.689  Sum_probs=17.6

Q ss_pred             HHHHHHhcCCEEccCCCCCceE
Q psy9336          40 LINNFEKRGWIHVNSVEDDWNF   61 (99)
Q Consensus        40 v~~vl~~rGW~ev~~~~~dWnl   61 (99)
                      +.+.|++.||++.+ +.+.|+|
T Consensus        29 ~~~~L~~~GF~~l~-e~~~w~l   49 (465)
T PTZ00371         29 LKERLKKSGFKQLN-EGENWKL   49 (465)
T ss_pred             HHHHHHHCcCEEcc-ccccCcc
Confidence            46889999999998 7777985


No 27 
>PRK13996 potassium-transporting ATPase subunit C; Provisional
Probab=23.59  E-value=39  Score=25.84  Aligned_cols=18  Identities=22%  Similarity=0.191  Sum_probs=15.0

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..+|.+.+||++|+++..
T Consensus        80 ~~~y~~~~SggSNlgpsn   97 (197)
T PRK13996         80 ANGKKLAYSAPSNLSPAS   97 (197)
T ss_pred             cccCCcCCccccCCCCCC
Confidence            346899999999999875


No 28 
>PF01585 G-patch:  G-patch domain;  InterPro: IPR000467 The D111/G-patch domain [] is a short conserved region of about 40 amino acids which occurs in a number of putative RNA-binding proteins, including tumor suppressor and DNA-damage-repair proteins, suggesting that this domain may have an RNA binding function. This domain has seven highly conserved glycines. A multiple alignment of a small subset of D111/G-patch domains is shown in Fig. 2b of [].; GO: 0003676 nucleic acid binding, 0005622 intracellular
Probab=23.21  E-value=58  Score=18.66  Aligned_cols=16  Identities=25%  Similarity=0.385  Sum_probs=12.2

Q ss_pred             chHHHHHHHhcCCEEc
Q psy9336          37 KSVLINNFEKRGWIHV   52 (99)
Q Consensus        37 ~tvv~~vl~~rGW~ev   52 (99)
                      +.+-..+|++.||.+-
T Consensus         2 ~~~g~~lm~kmGw~~G   17 (45)
T PF01585_consen    2 SSIGFKLMKKMGWKPG   17 (45)
T ss_pred             CcHHHHHHHHCCCCCC
Confidence            3455789999999864


No 29 
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]
Probab=23.19  E-value=1.3e+02  Score=25.27  Aligned_cols=46  Identities=26%  Similarity=0.322  Sum_probs=28.3

Q ss_pred             CcCccccceecCCCccccccCCCCCCceEEEecCCchHHHHHHHhcCCEE
Q psy9336           2 KQASTKYPYQANGSGQQNVSPSDRQNKIYYCTDLDKSVLINNFEKRGWIH   51 (99)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~f~~~~~~tvv~~vl~~rGW~e   51 (99)
                      +++|||.||.-.+   -+.........+.+-+-.+..|| ..|.+||-..
T Consensus       159 ~~VSt~~~~~~~~---~~~~~~~~~~Vv~iD~GvK~nIl-r~L~~rg~~v  204 (368)
T COG0505         159 KEVSTKEPYTWPG---LNGGGEPGKHVVVIDFGVKRNIL-RELVKRGCRV  204 (368)
T ss_pred             ceeecCCceeccc---cccCCCCCcEEEEEEcCccHHHH-HHHHHCCCeE
Confidence            6889999999776   11112222334444444454675 7888999854


No 30 
>PRK10562 putative acetyltransferase; Provisional
Probab=23.04  E-value=2.1e+02  Score=18.80  Aligned_cols=36  Identities=17%  Similarity=0.261  Sum_probs=24.2

Q ss_pred             ceEEEecCCchHHHHHHHhcCCEEccC--CCCCceEEe
Q psy9336          28 KIYYCTDLDKSVLINNFEKRGWIHVNS--VEDDWNFYW   63 (99)
Q Consensus        28 ~i~f~~~~~~tvv~~vl~~rGW~ev~~--~~~dWnl~W   63 (99)
                      .+.-.+...|......+++.||+++..  .++.|+-.|
T Consensus        99 ~~~~~v~~~N~~s~~~y~k~Gf~~~~~~~~~~~~~~~~  136 (145)
T PRK10562         99 HLSLEVYQKNQRAVNFYHAQGFRIVDSAWQEETQHPTW  136 (145)
T ss_pred             eEEEEEEcCChHHHHHHHHCCCEEccccccCCCCCEEE
Confidence            455566667766579999999998763  233355555


No 31 
>PF01427 Peptidase_M15:  D-ala-D-ala dipeptidase This is family M15 in the peptidase classification. ;  InterPro: IPR000755 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M15 (clan MD), subfamily M15D (vanX D-Ala-D-Ala dipeptidase). The D-alanyl-D-alanine dipeptidase enzyme from Enterococcus faecalis is also known as the vancomycin resistance protein VanX, and hydrolyses D-ala-D-ala. It has a 250-fold differential in catalytic efficiency for hydrolysis of D-ala-D-ala versus D-ala-D-lactate. The latter therefore remains intact for subsequent incorporation into peptidoglycan precursors that terminate in the dipeptide D-ala-D-lactate rather than the dipeptide D-ala-D-ala, thereby preventing vancomycin from binding. The enzyme requires a metal cofactor, and is induced by vancomycin through regulation by VanS and VanR.; GO: 0008237 metallopeptidase activity, 0016805 dipeptidase activity, 0006508 proteolysis, 0005618 cell wall; PDB: 1R44_B.
Probab=22.54  E-value=1.1e+02  Score=22.78  Aligned_cols=34  Identities=18%  Similarity=0.445  Sum_probs=23.0

Q ss_pred             HHHHHHHhcCCEEccCCCCCceEEeccccccccccc
Q psy9336          39 VLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFS   74 (99)
Q Consensus        39 vv~~vl~~rGW~ev~~~~~dWnl~W~d~~~~~~~f~   74 (99)
                      +|+++|++.||+-..  .+=|++-..+..|-...|+
T Consensus       161 lL~~~M~~aGF~~~p--~EWWHf~~~d~~~~~~~~~  194 (198)
T PF01427_consen  161 LLREAMTKAGFVNYP--TEWWHFSYGDQPWADQYFD  194 (198)
T ss_dssp             HHHHHHHTTTEEE-T--T-TTEEEESS-S-TT----
T ss_pred             HHHHHHHHcCCccCC--chhcCcCCCCCCCCCceeC
Confidence            789999999999996  6669999999888776665


No 32 
>COG2156 KdpC K+-transporting ATPase, c chain [Inorganic ion transport and metabolism]
Probab=22.15  E-value=50  Score=25.24  Aligned_cols=18  Identities=44%  Similarity=0.722  Sum_probs=15.0

Q ss_pred             ccceecCCCccccccCCC
Q psy9336           7 KYPYQANGSGQQNVSPSD   24 (99)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~   24 (99)
                      ..||.+..||++|+++.-
T Consensus        76 ~~~yn~~aSggSNl~psN   93 (190)
T COG2156          76 GEPYNAVASGGSNLGPSN   93 (190)
T ss_pred             CCCCCccccCCcCCCCCC
Confidence            358999999999998864


No 33 
>KOG3490|consensus
Probab=22.13  E-value=22  Score=24.98  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=13.6

Q ss_pred             CCCCCeecCC-CCccccc
Q psy9336          81 MNDNQIINHF-PNHYELT   97 (99)
Q Consensus        81 L~~~QrVNHF-Pn~yELT   97 (99)
                      ...||||-|| ||+|.|.
T Consensus        65 VakWqri~~f~~G~YAi~   82 (111)
T KOG3490|consen   65 VAKWQRIGRFTPGMYAIS   82 (111)
T ss_pred             HHHHHhhccccCceEEEE
Confidence            5679999999 7888763


No 34 
>KOG3347|consensus
Probab=21.23  E-value=85  Score=23.70  Aligned_cols=29  Identities=21%  Similarity=0.289  Sum_probs=24.1

Q ss_pred             CCCceEEEecCCchHHHHHHHhcCCEEcc
Q psy9336          25 RQNKIYYCTDLDKSVLINNFEKRGWIHVN   53 (99)
Q Consensus        25 ~~~~i~f~~~~~~tvv~~vl~~rGW~ev~   53 (99)
                      +.--+.|-..++++++.+=|+.|||.|.+
T Consensus        91 rwfdlVvVLr~~~s~LY~RL~sRgY~e~K  119 (176)
T KOG3347|consen   91 RWFDLVVVLRTPNSVLYDRLKSRGYSEKK  119 (176)
T ss_pred             hheeEEEEEecCchHHHHHHHHcCCCHHH
Confidence            34567888899999999999999997654


No 35 
>COG1724 Predicted RNA binding protein (dsRBD-like fold), HicA family    [General function prediction only]
Probab=21.11  E-value=76  Score=20.40  Aligned_cols=14  Identities=36%  Similarity=0.593  Sum_probs=12.1

Q ss_pred             HHHHHHhcCCEEcc
Q psy9336          40 LINNFEKRGWIHVN   53 (99)
Q Consensus        40 v~~vl~~rGW~ev~   53 (99)
                      ++.+|++.||.++.
T Consensus        12 ~ik~Le~~Gf~~vr   25 (66)
T COG1724          12 VIKALEKDGFQLVR   25 (66)
T ss_pred             HHHHHHhCCcEEEE
Confidence            46999999999886


No 36 
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme. This clade is a member of a subfamily (TIGR00089) and spans low GC Gram positive bacteria, alpha and epsilon proteobacteria, Campylobacter, Porphyromonas, Aquifex, Thermotoga, Chlamydia, Treponema and Fusobacterium.
Probab=20.43  E-value=1e+02  Score=24.83  Aligned_cols=30  Identities=27%  Similarity=0.303  Sum_probs=23.6

Q ss_pred             HHHHHHHhcCCEEccCCCCCceEEecccccc
Q psy9336          39 VLINNFEKRGWIHVNSVEDDWNFYWAGIQTC   69 (99)
Q Consensus        39 vv~~vl~~rGW~ev~~~~~dWnl~W~d~~~~   69 (99)
                      .+...|.+.||.+++ +++++||.=-++-.+
T Consensus        15 ~~~~~l~~~g~~~~~-~~~~aD~v~intctv   44 (414)
T TIGR01579        15 SLKNQLIQKGYEVVP-DEDKADVYIINTCTV   44 (414)
T ss_pred             HHHHHHHHCcCEECC-CcccCCEEEEecccc
Confidence            678999999999998 667889876665433


No 37 
>PF08373 RAP:  RAP domain;  InterPro: IPR013584 The ~60-residue RAP (an acronym for RNA-binding domain abundant in Apicomplexans) domain is found in various proteins in eukaryotes. It is particularly abundant in apicomplexans and might mediate a range of cellular functions through its potential interactions with RNA []. The RAP domain consists of multiple blocks of charged and aromatics residues and is predicted to be composed of alpha helical and beta strand structures. Two predicted loop regions that are dominated by glycine and tryptophan residues are found before and after the central beta sheet []. Some proteins known to contain a RAP domain are listed below:   Human hypothetical protein MGC5297,  Mammalian FAST kinase domain-containing proteins (FASTKDs),   Chlamydomonas reinhardtii chloroplastic trans-splicing factor Raa3. 
Probab=20.08  E-value=35  Score=19.72  Aligned_cols=22  Identities=14%  Similarity=0.255  Sum_probs=14.9

Q ss_pred             HHHHHHhcCCEEccCCCCCceE
Q psy9336          40 LINNFEKRGWIHVNSVEDDWNF   61 (99)
Q Consensus        40 v~~vl~~rGW~ev~~~~~dWnl   61 (99)
                      =...|+++||..+..+--+|+=
T Consensus        23 k~r~L~~~G~~Vi~Ip~~eW~~   44 (58)
T PF08373_consen   23 KHRHLKALGYKVISIPYYEWNK   44 (58)
T ss_pred             HHHHHHHCCCEEEEecHHHHHh
Confidence            3567888899887644445543


Done!