Diaphorina citri psyllid: psy9356


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
SEGRFGNQADNFLGALALAKGINRTLVLPPWVEYRYGEPKSIQVPFDTYFQVEPLQEYHRVMTMEKFMQDIAPHIWPPHKRIAFCYMARGSTNESSCNAKEGNPFGPFWDTYGIDFVGSEFYGPLHYDVHHSDIADHWKMRYPSDDWPGLLIYLV
cccccccHHHHHHHHHHHHHHcccEEECccEEEccccccccccccccccccccccccccccEEHHHHHHHHccccccccccEEEEcccccccccccccccccccccccccccccEECccEECccccccccccHHHHHHHHHcccccccEEEEEEc
***R*GNQADNFLGALALAKGINRTLVLPPWVEYRYGEPKSIQVPFDTYFQVEPLQEYHRVMTMEKFMQDIAPHIWPPHKRIAFCYMARGS*********EGNPFGPFWDTYGIDFVGSEFYGPLHYDVHHSDIADHWKMRYPSDDWPGLLIYLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SEGRFGNQADNFLGALALAKGINRTLVLPPWVEYRYGEPKSIQVPFDTYFQVEPLQEYHRVMTMEKFMQDIAPHIWPPHKRIAFCYMARGSTNESSCNAKEGNPFGPFWDTYGIDFVGSEFYGPLHYDVHHSDIADHWKMRYPSDDWPGLLIYLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GDP-fucose protein O-fucosyltransferase 1 Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains. Plays a crucial role in Notch signaling; essential for the interaction of Notch with its ligand Delta, and for the ability of Fringe to modulate this interaction.confidentQ9V6X7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005112 [MF]Notch bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0008417 [MF]fucosyltransferase activityprobableGO:0016758, GO:0016740, GO:0003674, GO:0016757, GO:0003824
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0036066 [BP]protein O-linked fucosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0036065, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZY2, chain A
Confidence level:very confident
Coverage over the Query: 1-155
View the alignment between query and template
View the model in PyMOL