BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy9365
(98 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3RDW|A Chain A, Putative Arsenate Reductase From Yersinia Pestis
pdb|3RDW|B Chain B, Putative Arsenate Reductase From Yersinia Pestis
Length = 121
Score = 26.6 bits (57), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 5/67 (7%)
Query: 32 FVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLSLDIKFDRRGLVSKEELPPQRK 91
++E P + LLQ++G+ L + KE + L+L D RGL + L
Sbjct: 37 YLETPPSVDKLK-ELLQQLGFSDARQLMRTKEDLYKTLNL----DDRGLTQDQLLQAMAD 91
Query: 92 NPYHVQQ 98
NP +++
Sbjct: 92 NPKLIER 98
>pdb|1XFV|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFW|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFX|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFY|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFZ|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1Y0V|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
Length = 777
Score = 26.2 bits (56), Expect = 4.8, Method: Composition-based stats.
Identities = 11/27 (40%), Positives = 17/27 (62%)
Query: 46 LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
L +K W+ E + KN EG ++PL+ D
Sbjct: 442 LGEKFNWRNIEVMAKNVEGVLKPLTAD 468
>pdb|1XFU|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
Length = 747
Score = 26.2 bits (56), Expect = 4.9, Method: Composition-based stats.
Identities = 11/27 (40%), Positives = 17/27 (62%)
Query: 46 LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
L +K W+ E + KN EG ++PL+ D
Sbjct: 412 LGEKFNWRNIEVMAKNVEGVLKPLTAD 438
>pdb|1K8T|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef)
pdb|1K90|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin And
3' Deoxy-Atp
pdb|1K90|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin And
3' Deoxy-Atp
pdb|1K90|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin And
3' Deoxy-Atp
pdb|1K93|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin
pdb|1K93|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin
pdb|1K93|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin
pdb|1LVC|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin And
2' Deoxy, 3' Anthraniloyl Atp
pdb|1LVC|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin And
2' Deoxy, 3' Anthraniloyl Atp
pdb|1LVC|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin And
2' Deoxy, 3' Anthraniloyl Atp
pdb|1S26|A Chain A, Structure Of Anthrax Edema Factor-calmodulin-alpha,beta-
Methyleneadenosine 5'-triphosphate Complex Reveals An
Alternative Mode Of Atp Binding To The Catalytic Site
pdb|1S26|B Chain B, Structure Of Anthrax Edema Factor-calmodulin-alpha,beta-
Methyleneadenosine 5'-triphosphate Complex Reveals An
Alternative Mode Of Atp Binding To The Catalytic Site
pdb|1S26|C Chain C, Structure Of Anthrax Edema Factor-calmodulin-alpha,beta-
Methyleneadenosine 5'-triphosphate Complex Reveals An
Alternative Mode Of Atp Binding To The Catalytic Site
pdb|1SK6|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin,
3',5' Cyclic Amp (Camp), And Pyrophosphate
pdb|1SK6|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin,
3',5' Cyclic Amp (Camp), And Pyrophosphate
pdb|1SK6|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
Anthrax Edema Factor (Ef) In Complex With Calmodulin,
3',5' Cyclic Amp (Camp), And Pyrophosphate
Length = 510
Score = 26.2 bits (56), Expect = 5.5, Method: Composition-based stats.
Identities = 11/27 (40%), Positives = 17/27 (62%)
Query: 46 LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
L +K W+ E + KN EG ++PL+ D
Sbjct: 175 LGEKFNWRNIEVMAKNVEGVLKPLTAD 201
>pdb|1PK0|A Chain A, Crystal Structure Of The Ef3-Cam Complexed With Pmeapp
pdb|1PK0|B Chain B, Crystal Structure Of The Ef3-Cam Complexed With Pmeapp
pdb|1PK0|C Chain C, Crystal Structure Of The Ef3-Cam Complexed With Pmeapp
Length = 507
Score = 26.2 bits (56), Expect = 5.6, Method: Composition-based stats.
Identities = 11/27 (40%), Positives = 17/27 (62%)
Query: 46 LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
L +K W+ E + KN EG ++PL+ D
Sbjct: 174 LGEKFNWRNIEVMAKNVEGVLKPLTAD 200
>pdb|2PK0|A Chain A, Structure Of The S. Agalactiae Serine/threonine
Phosphatase At 2.65 Resolution
pdb|2PK0|B Chain B, Structure Of The S. Agalactiae Serine/threonine
Phosphatase At 2.65 Resolution
pdb|2PK0|C Chain C, Structure Of The S. Agalactiae Serine/threonine
Phosphatase At 2.65 Resolution
pdb|2PK0|D Chain D, Structure Of The S. Agalactiae Serine/threonine
Phosphatase At 2.65 Resolution
Length = 250
Score = 25.0 bits (53), Expect = 9.8, Method: Compositional matrix adjust.
Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 5/57 (8%)
Query: 14 LTPQELAAGSQAWARKEQFVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLS 70
LT +E A+ Q + +A PV +G+HLL++ G+ L N +G LS
Sbjct: 153 LTEEEAASHPQKNIITQSIGQANPVEPDLGVHLLEE-----GDYLVVNSDGLTNMLS 204
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.133 0.398
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,258,239
Number of Sequences: 62578
Number of extensions: 122152
Number of successful extensions: 141
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 9
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)