BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9365
         (98 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RDW|A Chain A, Putative Arsenate Reductase From Yersinia Pestis
 pdb|3RDW|B Chain B, Putative Arsenate Reductase From Yersinia Pestis
          Length = 121

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 32 FVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLSLDIKFDRRGLVSKEELPPQRK 91
          ++E  P    +   LLQ++G+     L + KE   + L+L    D RGL   + L     
Sbjct: 37 YLETPPSVDKLK-ELLQQLGFSDARQLMRTKEDLYKTLNL----DDRGLTQDQLLQAMAD 91

Query: 92 NPYHVQQ 98
          NP  +++
Sbjct: 92 NPKLIER 98


>pdb|1XFV|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFW|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFX|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFY|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFZ|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1Y0V|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
          Length = 777

 Score = 26.2 bits (56), Expect = 4.8,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 46  LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
           L +K  W+  E + KN EG ++PL+ D
Sbjct: 442 LGEKFNWRNIEVMAKNVEGVLKPLTAD 468


>pdb|1XFU|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
          Length = 747

 Score = 26.2 bits (56), Expect = 4.9,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 46  LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
           L +K  W+  E + KN EG ++PL+ D
Sbjct: 412 LGEKFNWRNIEVMAKNVEGVLKPLTAD 438


>pdb|1K8T|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef)
 pdb|1K90|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin And
           3' Deoxy-Atp
 pdb|1K90|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin And
           3' Deoxy-Atp
 pdb|1K90|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin And
           3' Deoxy-Atp
 pdb|1K93|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin
 pdb|1K93|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin
 pdb|1K93|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin
 pdb|1LVC|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin And
           2' Deoxy, 3' Anthraniloyl Atp
 pdb|1LVC|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin And
           2' Deoxy, 3' Anthraniloyl Atp
 pdb|1LVC|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin And
           2' Deoxy, 3' Anthraniloyl Atp
 pdb|1S26|A Chain A, Structure Of Anthrax Edema Factor-calmodulin-alpha,beta-
           Methyleneadenosine 5'-triphosphate Complex Reveals An
           Alternative Mode Of Atp Binding To The Catalytic Site
 pdb|1S26|B Chain B, Structure Of Anthrax Edema Factor-calmodulin-alpha,beta-
           Methyleneadenosine 5'-triphosphate Complex Reveals An
           Alternative Mode Of Atp Binding To The Catalytic Site
 pdb|1S26|C Chain C, Structure Of Anthrax Edema Factor-calmodulin-alpha,beta-
           Methyleneadenosine 5'-triphosphate Complex Reveals An
           Alternative Mode Of Atp Binding To The Catalytic Site
 pdb|1SK6|A Chain A, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin,
           3',5' Cyclic Amp (Camp), And Pyrophosphate
 pdb|1SK6|B Chain B, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin,
           3',5' Cyclic Amp (Camp), And Pyrophosphate
 pdb|1SK6|C Chain C, Crystal Structure Of The Adenylyl Cyclase Domain Of
           Anthrax Edema Factor (Ef) In Complex With Calmodulin,
           3',5' Cyclic Amp (Camp), And Pyrophosphate
          Length = 510

 Score = 26.2 bits (56), Expect = 5.5,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 46  LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
           L +K  W+  E + KN EG ++PL+ D
Sbjct: 175 LGEKFNWRNIEVMAKNVEGVLKPLTAD 201


>pdb|1PK0|A Chain A, Crystal Structure Of The Ef3-Cam Complexed With Pmeapp
 pdb|1PK0|B Chain B, Crystal Structure Of The Ef3-Cam Complexed With Pmeapp
 pdb|1PK0|C Chain C, Crystal Structure Of The Ef3-Cam Complexed With Pmeapp
          Length = 507

 Score = 26.2 bits (56), Expect = 5.6,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 46  LLQKMGWQPGEGLGKNKEGTVQPLSLD 72
           L +K  W+  E + KN EG ++PL+ D
Sbjct: 174 LGEKFNWRNIEVMAKNVEGVLKPLTAD 200


>pdb|2PK0|A Chain A, Structure Of The S. Agalactiae Serine/threonine
           Phosphatase At 2.65 Resolution
 pdb|2PK0|B Chain B, Structure Of The S. Agalactiae Serine/threonine
           Phosphatase At 2.65 Resolution
 pdb|2PK0|C Chain C, Structure Of The S. Agalactiae Serine/threonine
           Phosphatase At 2.65 Resolution
 pdb|2PK0|D Chain D, Structure Of The S. Agalactiae Serine/threonine
           Phosphatase At 2.65 Resolution
          Length = 250

 Score = 25.0 bits (53), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 14  LTPQELAAGSQAWARKEQFVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLS 70
           LT +E A+  Q     +   +A PV   +G+HLL++     G+ L  N +G    LS
Sbjct: 153 LTEEEAASHPQKNIITQSIGQANPVEPDLGVHLLEE-----GDYLVVNSDGLTNMLS 204


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.133    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,258,239
Number of Sequences: 62578
Number of extensions: 122152
Number of successful extensions: 141
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 9
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)