Query         psy9383
Match_columns 133
No_of_seqs    19 out of 21
Neff          1.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:42:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9383.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9383hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09079 Cdc6_C:  CDC6, C termi  79.4     1.3 2.7E-05   29.0   1.5   54   14-70     32-85  (85)
  2 PF00214 Calc_CGRP_IAPP:  Calci  71.8     1.5 3.2E-05   32.6   0.4   12  114-125   118-129 (130)
  3 PRK15451 tRNA cmo(5)U34 methyl  66.4     5.7 0.00012   30.3   2.6   52   49-105    23-76  (247)
  4 TIGR00138 gidB 16S rRNA methyl  55.3      11 0.00023   28.1   2.3   20   86-105    43-62  (181)
  5 PF12847 Methyltransf_18:  Meth  54.6     6.6 0.00014   25.0   1.0   21   86-106     2-22  (112)
  6 PF13489 Methyltransf_23:  Meth  53.7      12 0.00026   24.8   2.1   35   65-105     8-42  (161)
  7 PRK08287 cobalt-precorrin-6Y C  51.1     7.2 0.00016   28.1   0.8   25   82-106    28-52  (187)
  8 PRK00377 cbiT cobalt-precorrin  50.4     7.4 0.00016   28.6   0.8   26   82-107    37-62  (198)
  9 TIGR02752 MenG_heptapren 2-hep  49.8     5.1 0.00011   29.3  -0.1   24   83-106    43-66  (231)
 10 PRK14968 putative methyltransf  49.3      12 0.00026   25.9   1.6   22   85-106    23-44  (188)
 11 PLN02233 ubiquinone biosynthes  48.9     5.6 0.00012   31.0  -0.1   25   82-106    70-94  (261)
 12 PRK08317 hypothetical protein;  48.6     9.1  0.0002   26.9   1.0   26   82-107    16-41  (241)
 13 TIGR02469 CbiT precorrin-6Y C5  48.0     7.8 0.00017   24.7   0.5   22   85-106    19-40  (124)
 14 PLN02476 O-methyltransferase    47.9      16 0.00036   30.1   2.5   23   85-107   118-140 (278)
 15 TIGR02072 BioC biotin biosynth  47.4     7.6 0.00016   27.5   0.4   23   85-107    34-56  (240)
 16 COG3897 Predicted methyltransf  46.8      11 0.00024   31.4   1.4   34   73-106    67-100 (218)
 17 TIGR01934 MenG_MenH_UbiE ubiqu  46.4      11 0.00025   26.5   1.2   23   85-107    39-61  (223)
 18 PF02353 CMAS:  Mycolic acid cy  46.0      17 0.00036   29.3   2.2   46   64-110    41-86  (273)
 19 PRK01683 trans-aconitate 2-met  43.7     9.7 0.00021   28.5   0.5   24   83-106    29-52  (258)
 20 TIGR00740 methyltransferase, p  43.0      33 0.00072   25.6   3.3   23   84-106    52-74  (239)
 21 PLN02781 Probable caffeoyl-CoA  38.6      21 0.00045   27.6   1.7   23   85-107    68-90  (234)
 22 PRK14967 putative methyltransf  37.8      22 0.00047   26.6   1.6   37   62-106    21-57  (223)
 23 PRK14103 trans-aconitate 2-met  37.3      15 0.00032   27.8   0.7   46   52-106     5-50  (255)
 24 cd08768 Cdc6_C Winged-helix do  35.1      25 0.00053   22.4   1.3   30   14-43     39-68  (87)
 25 PF13847 Methyltransf_31:  Meth  34.3      17 0.00036   25.1   0.5   21   85-105     3-23  (152)
 26 PLN02366 spermidine synthase    33.9      33 0.00072   28.3   2.2   53   48-106    60-112 (308)
 27 PHA02594 nadV nicotinamide pho  33.4      30 0.00065   31.1   2.0   19   87-106   177-195 (470)
 28 PLN02244 tocopherol O-methyltr  32.5      32  0.0007   27.9   1.9   24   84-107   117-140 (340)
 29 PRK06922 hypothetical protein;  32.1      66  0.0014   30.4   4.1   81    8-105   343-438 (677)
 30 smart00828 PKS_MT Methyltransf  31.8      24 0.00052   25.6   1.0   21   87-107     1-21  (224)
 31 PF13679 Methyltransf_32:  Meth  31.4      38 0.00082   23.8   1.9   23   83-105    23-45  (141)
 32 TIGR00438 rrmJ cell division p  31.2      55  0.0012   23.6   2.8   26   82-107    29-54  (188)
 33 PRK11873 arsM arsenite S-adeno  30.1      25 0.00055   26.7   0.9   25   82-106    74-98  (272)
 34 PRK07402 precorrin-6B methylas  29.4      26 0.00055   25.5   0.8   23   84-106    39-61  (196)
 35 COG4976 Predicted methyltransf  28.7      43 0.00093   29.1   2.1   40   63-110   111-153 (287)
 36 PRK11188 rrmJ 23S rRNA methylt  28.3      42 0.00092   25.4   1.9   22   85-106    51-72  (209)
 37 COG1990 pth2 Peptidyl-tRNA hyd  28.3      34 0.00074   26.3   1.3   23   91-113    15-37  (122)
 38 PF03960 ArsC:  ArsC family;  I  27.7 1.2E+02  0.0026   20.6   3.8   57   11-74     25-84  (110)
 39 PRK00811 spermidine synthase;   27.4      36 0.00077   27.1   1.3   41   61-106    57-97  (283)
 40 PF01596 Methyltransf_3:  O-met  26.2      42 0.00091   26.0   1.5   23   85-107    45-67  (205)
 41 TIGR03534 RF_mod_PrmC protein-  26.1      25 0.00053   25.7   0.2   22   85-106    87-108 (251)
 42 TIGR00477 tehB tellurite resis  25.7      29 0.00064   25.6   0.6   21   86-106    31-51  (195)
 43 PLN02589 caffeoyl-CoA O-methyl  23.8      43 0.00094   26.9   1.2   22   85-106    79-100 (247)
 44 PF06564 YhjQ:  YhjQ protein;    23.8      62  0.0013   26.4   2.1   62   45-111   164-232 (243)
 45 PRK04457 spermidine synthase;   23.7      30 0.00066   27.3   0.3   24   84-107    65-88  (262)
 46 PF06515 BDV_P10:  Borna diseas  23.5      75  0.0016   23.5   2.3   12   64-75      7-18  (87)
 47 TIGR00080 pimt protein-L-isoas  23.3      35 0.00075   25.3   0.6   24   83-106    75-98  (215)
 48 PRK01581 speE spermidine synth  23.1      51  0.0011   28.9   1.6   45   58-107   128-172 (374)
 49 PRK11207 tellurite resistance   22.4      24 0.00053   26.1  -0.4   21   86-106    31-51  (197)
 50 PRK13944 protein-L-isoaspartat  21.8      37 0.00081   25.2   0.5   22   85-106    72-93  (205)
 51 PRK00312 pcm protein-L-isoaspa  21.8      38 0.00082   24.8   0.5   22   84-105    77-98  (212)
 52 COG4122 Predicted O-methyltran  21.5      68  0.0015   25.8   1.9   22   85-106    59-80  (219)
 53 PRK09328 N5-glutamine S-adenos  21.5      65  0.0014   24.1   1.7   23   85-107   108-130 (275)
 54 PF05193 Peptidase_M16_C:  Pept  21.4      56  0.0012   21.2   1.2   27   64-90    158-184 (184)
 55 PF05175 MTS:  Methyltransferas  21.3      40 0.00087   24.3   0.5   24   85-108    31-54  (170)
 56 smart00650 rADc Ribosomal RNA   21.2      32  0.0007   24.5   0.0   24   83-106    11-34  (169)
 57 PRK00107 gidB 16S rRNA methylt  21.0      64  0.0014   24.5   1.6   24   83-106    43-66  (187)
 58 TIGR03587 Pse_Me-ase pseudamin  21.0      82  0.0018   23.9   2.2   24   83-106    41-64  (204)
 59 PRK13942 protein-L-isoaspartat  20.8      39 0.00084   25.4   0.4   24   83-106    74-97  (212)
 60 TIGR01983 UbiG ubiquinone bios  20.7      81  0.0017   22.7   2.0   22   85-106    45-66  (224)
 61 PRK11705 cyclopropane fatty ac  20.6      49  0.0011   27.8   1.0   25   82-106   164-188 (383)
 62 COG3394 Uncharacterized protei  20.5      58  0.0013   27.8   1.4   19   91-109    11-29  (257)
 63 PLN02396 hexaprenyldihydroxybe  20.4 1.3E+02  0.0028   25.0   3.4   21   85-105   131-151 (322)

No 1  
>PF09079 Cdc6_C:  CDC6, C terminal ;  InterPro: IPR015163 The C-terminal domain of CDC6 assumes a winged helix fold, with a five alpha-helical bundle (alpha15-alpha19) structure, backed on one side by three beta strands (beta6-beta8). It has been shown that this domain acts as a DNA-localisation factor, however its exact function is, as yet, unknown. Putative functions include: (1) mediation of protein-protein interactions and (2) regulation of nucleotide binding and hydrolysis. Mutagenesis studies have shown that this domain is essential for appropriate Cdc6 activity []. ; PDB: 2QBY_A 2V1U_A 1W5T_A 1W5S_B 1FNN_B.
Probab=79.37  E-value=1.3  Score=29.02  Aligned_cols=54  Identities=24%  Similarity=0.399  Sum_probs=33.4

Q ss_pred             eeeCcchhhhHHHHhhhhhhhhhccccccccccchhhhhhcccccCCCChHHHHHHH
Q psy9383          14 FSISPLGMRHFSELLDQLQFFEFIGRRDKFQDQSSFVIKQYDNVEGADQPDLILEML   70 (133)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~ig~r~~~~~~~~~~~~~Yd~~~~~~d~DylleLL   70 (133)
                      ..+.|++.|.|++++.+|.+.-+|-.+.+-.....=.   |.......||+.+++.|
T Consensus        32 ~~~~pls~~r~~~~l~eL~~~gli~~~~~~~G~~~G~---~~~~~l~~d~~~v~~aL   85 (85)
T PF09079_consen   32 LGVDPLSYRRFSDYLSELEMLGLIESERKGRGRGRGR---TREISLNVDPEDVLEAL   85 (85)
T ss_dssp             TTS----HHHHHHHHHHHHHTTSEEEEEEE-TT-CTE---EEEEEECSSSHHHHHHH
T ss_pred             cCCCCCCHHHHHHHHHHHHhCCCeEEEeecCCCCCCe---EEEEEecCCHHHHHhhC
Confidence            3568999999999999999999986665432221112   34446677788887754


No 2  
>PF00214 Calc_CGRP_IAPP:  Calcitonin / CGRP / IAPP family The prints entry is specific to the calcitonins;  InterPro: IPR021116 Calcitonin [] is a 32 amino acid polypeptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in the blood, by promoting the incorporation of these ions in the bones. This is the alpha type. Alternative splicing of the gene coding for calcitonin produces a distantly related peptide of 37 amino acids, called calcitonin gene-related peptide (CGRP), beta type. CGRP induces vasodilatation in a variety of vessels, including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. Islet amyloid polypeptide (IAPP) [] (also known as diabetes-associated peptide (DAP), or amylin) is a peptide of 37 amino acids that selectively inhibits insulin-stimulated glucose utilisation and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. Structurally, IAPP is closely related to CGRP. Calcitonin receptor-stimulating peptide 1 stimulates cAMP production via the calcitonin receptor. Two conserved cysteines in the N-terminal of these peptides are known to be involved in a disulphide bond. The C-terminal residue of all three peptides is amidated.  xCxxxxxCxxxxxxxxxxxxxxxxxxxxxxxxxxxx-NH(2) | | Amide group +-----+ 'C': conserved cysteine involved in a disulphide bond.  This entry represents procalcitonin (before cleavage into the calcitonin peptide) and adrenomedullin.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 2L7S_A 2FLY_A 2JXZ_A 2GLG_A 2GLH_A 3G7W_A 2G48_D 3HGZ_D 3G7V_B 2L86_A ....
Probab=71.76  E-value=1.5  Score=32.58  Aligned_cols=12  Identities=58%  Similarity=0.670  Sum_probs=3.9

Q ss_pred             cCCCCCCCccCC
Q psy9383         114 NYAGGPGRRRRS  125 (133)
Q Consensus       114 N~agGPGRrRRs  125 (133)
                      .-+.||||||||
T Consensus       118 ~g~~~yGrrRRs  129 (130)
T PF00214_consen  118 VGPKGYGRRRRS  129 (130)
T ss_dssp             CCTTT-------
T ss_pred             CCCCCCCcCCCC
Confidence            568899999997


No 3  
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional
Probab=66.38  E-value=5.7  Score=30.30  Aligned_cols=52  Identities=17%  Similarity=0.236  Sum_probs=34.5

Q ss_pred             hhhhhcccccC--CCChHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHH
Q psy9383          49 FVIKQYDNVEG--ADQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        49 ~~~~~Yd~~~~--~~d~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAK  105 (133)
                      .|-+.||++-.  .+.-+.+.+++..+-...     +....++||+|-|.|......++
T Consensus        23 ~~a~~yd~~~~~~~p~y~~~~~~~~~~~~~~-----~~~~~~vLDlGcGtG~~~~~l~~   76 (247)
T PRK15451         23 RVAEVFPDMIQRSVPGYSNIISMIGMLAERF-----VQPGTQVYDLGCSLGAATLSVRR   76 (247)
T ss_pred             HHHHhhhhHHHhcCCChHHHHHHHHHHHHHh-----CCCCCEEEEEcccCCHHHHHHHH
Confidence            45556776554  556677888877754332     23457899999999987655554


No 4  
>TIGR00138 gidB 16S rRNA methyltransferase GidB. GidB (glucose-inhibited division protein B) appears to be present and in a single copy in nearly all complete eubacterial genomes. It is missing only from some obligate intracellular species of various lineages (Chlamydiae, Ehrlichia, Wolbachia, Anaplasma, Buchnera, etc.). GidB shows a methytransferase fold in its the crystal structure, and acts as a 7-methylguanosine (m(7)G) methyltransferase, apparently specific to 16S rRNA.
Probab=55.30  E-value=11  Score=28.13  Aligned_cols=20  Identities=35%  Similarity=0.589  Sum_probs=17.6

Q ss_pred             cccccccccCCCCchhHHHH
Q psy9383          86 SKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        86 ~KR~lDfGL~RG~SGsqaAK  105 (133)
                      .+++||+|-|.|+.+...|+
T Consensus        43 ~~~vLDiGcGtG~~s~~la~   62 (181)
T TIGR00138        43 GKKVIDIGSGAGFPGIPLAI   62 (181)
T ss_pred             CCeEEEecCCCCccHHHHHH
Confidence            67999999999999888764


No 5  
>PF12847 Methyltransf_18:  Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A ....
Probab=54.65  E-value=6.6  Score=24.98  Aligned_cols=21  Identities=33%  Similarity=0.325  Sum_probs=18.5

Q ss_pred             cccccccccCCCCchhHHHHH
Q psy9383          86 SKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        86 ~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+|+||+|-|-|.....+|++
T Consensus         2 ~~~vLDlGcG~G~~~~~l~~~   22 (112)
T PF12847_consen    2 GGRVLDLGCGTGRLSIALARL   22 (112)
T ss_dssp             TCEEEEETTTTSHHHHHHHHH
T ss_pred             CCEEEEEcCcCCHHHHHHHhc
Confidence            368999999999999999984


No 6  
>PF13489 Methyltransf_23:  Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C ....
Probab=53.74  E-value=12  Score=24.84  Aligned_cols=35  Identities=34%  Similarity=0.376  Sum_probs=23.9

Q ss_pred             HHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHH
Q psy9383          65 LILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        65 ylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAK  105 (133)
                      .+.++|.++...      +...+++||+|-|.|......++
T Consensus         8 ~~~~~~~~~~~~------~~~~~~vLDiGcG~G~~~~~l~~   42 (161)
T PF13489_consen    8 AYADLLERLLPR------LKPGKRVLDIGCGTGSFLRALAK   42 (161)
T ss_dssp             CHHHHHHHHHTC------TTTTSEEEEESSTTSHHHHHHHH
T ss_pred             HHHHHHHHHhcc------cCCCCEEEEEcCCCCHHHHHHHH
Confidence            345666665521      56778999999999976555544


No 7  
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated
Probab=51.07  E-value=7.2  Score=28.06  Aligned_cols=25  Identities=28%  Similarity=0.399  Sum_probs=20.5

Q ss_pred             hhhhcccccccccCCCCchhHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ++++.+++||+|-|-|..+..+|+.
T Consensus        28 ~~~~~~~vLDiG~G~G~~~~~la~~   52 (187)
T PRK08287         28 ELHRAKHLIDVGAGTGSVSIEAALQ   52 (187)
T ss_pred             CCCCCCEEEEECCcCCHHHHHHHHH
Confidence            3456778999999999998888764


No 8  
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=50.38  E-value=7.4  Score=28.56  Aligned_cols=26  Identities=23%  Similarity=0.259  Sum_probs=21.1

Q ss_pred             hhhhcccccccccCCCCchhHHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      ++...+++||+|.|-|+-+.++|+.+
T Consensus        37 ~~~~~~~vlDlG~GtG~~s~~~a~~~   62 (198)
T PRK00377         37 RLRKGDMILDIGCGTGSVTVEASLLV   62 (198)
T ss_pred             CCCCcCEEEEeCCcCCHHHHHHHHHh
Confidence            45566789999999999888888753


No 9  
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase. MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species.
Probab=49.85  E-value=5.1  Score=29.26  Aligned_cols=24  Identities=13%  Similarity=0.057  Sum_probs=19.1

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +...+++||+|-|.|......|++
T Consensus        43 ~~~~~~vLDiGcG~G~~~~~la~~   66 (231)
T TIGR02752        43 VQAGTSALDVCCGTADWSIALAEA   66 (231)
T ss_pred             CCCCCEEEEeCCCcCHHHHHHHHH
Confidence            445689999999999987766664


No 10 
>PRK14968 putative methyltransferase; Provisional
Probab=49.29  E-value=12  Score=25.87  Aligned_cols=22  Identities=32%  Similarity=0.457  Sum_probs=18.0

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.+++||+|.|.|+.....|+.
T Consensus        23 ~~~~vLd~G~G~G~~~~~l~~~   44 (188)
T PRK14968         23 KGDRVLEVGTGSGIVAIVAAKN   44 (188)
T ss_pred             CCCEEEEEccccCHHHHHHHhh
Confidence            4578999999999987776654


No 11 
>PLN02233 ubiquinone biosynthesis methyltransferase
Probab=48.89  E-value=5.6  Score=30.98  Aligned_cols=25  Identities=20%  Similarity=0.101  Sum_probs=18.4

Q ss_pred             hhhhcccccccccCCCCchhHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+....++||+|-|.|......|++
T Consensus        70 ~~~~~~~VLDlGcGtG~~~~~la~~   94 (261)
T PLN02233         70 GAKMGDRVLDLCCGSGDLAFLLSEK   94 (261)
T ss_pred             CCCCCCEEEEECCcCCHHHHHHHHH
Confidence            3445679999999999866555543


No 12 
>PRK08317 hypothetical protein; Provisional
Probab=48.56  E-value=9.1  Score=26.89  Aligned_cols=26  Identities=23%  Similarity=0.412  Sum_probs=20.5

Q ss_pred             hhhhcccccccccCCCCchhHHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      .+...+++||+|-|.|.-....|++.
T Consensus        16 ~~~~~~~vLdiG~G~G~~~~~~a~~~   41 (241)
T PRK08317         16 AVQPGDRVLDVGCGPGNDARELARRV   41 (241)
T ss_pred             CCCCCCEEEEeCCCCCHHHHHHHHhc
Confidence            44556789999999998877777754


No 13 
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit. This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL.
Probab=47.96  E-value=7.8  Score=24.67  Aligned_cols=22  Identities=23%  Similarity=0.190  Sum_probs=18.5

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ..+++||+|-|.|.-...+|++
T Consensus        19 ~~~~vldlG~G~G~~~~~l~~~   40 (124)
T TIGR02469        19 PGDVLWDIGAGSGSITIEAARL   40 (124)
T ss_pred             CCCEEEEeCCCCCHHHHHHHHH
Confidence            3568999999999988888775


No 14 
>PLN02476 O-methyltransferase
Probab=47.91  E-value=16  Score=30.12  Aligned_cols=23  Identities=26%  Similarity=0.485  Sum_probs=20.3

Q ss_pred             hcccccccccCCCCchhHHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      +.|++|++|-+-|||+...|+.+
T Consensus       118 ~ak~VLEIGT~tGySal~lA~al  140 (278)
T PLN02476        118 GAERCIEVGVYTGYSSLAVALVL  140 (278)
T ss_pred             CCCeEEEecCCCCHHHHHHHHhC
Confidence            48999999999999999888753


No 15 
>TIGR02072 BioC biotin biosynthesis protein BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology.
Probab=47.40  E-value=7.6  Score=27.48  Aligned_cols=23  Identities=22%  Similarity=0.320  Sum_probs=18.1

Q ss_pred             hcccccccccCCCCchhHHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      ..+++||+|-|.|......+++.
T Consensus        34 ~~~~vLDlG~G~G~~~~~l~~~~   56 (240)
T TIGR02072        34 IPASVLDIGCGTGYLTRALLKRF   56 (240)
T ss_pred             CCCeEEEECCCccHHHHHHHHhC
Confidence            34789999999998777766653


No 16 
>COG3897 Predicted methyltransferase [General function prediction only]
Probab=46.79  E-value=11  Score=31.43  Aligned_cols=34  Identities=32%  Similarity=0.391  Sum_probs=27.5

Q ss_pred             hhhhcccchhhhhcccccccccCCCCchhHHHHH
Q psy9383          73 LSQSILRENDLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        73 lg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.+-|+...+...-||+||||-|-|.-+-.|||.
T Consensus        67 lAR~i~~~PetVrgkrVLd~gagsgLvaIAaa~a  100 (218)
T COG3897          67 LARYIDDHPETVRGKRVLDLGAGSGLVAIAAARA  100 (218)
T ss_pred             HHHHHhcCccccccceeeecccccChHHHHHHHh
Confidence            3444667788889999999999999888777775


No 17 
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases.
Probab=46.36  E-value=11  Score=26.49  Aligned_cols=23  Identities=22%  Similarity=0.222  Sum_probs=18.5

Q ss_pred             hcccccccccCCCCchhHHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      ..+++||+|-|.|......++..
T Consensus        39 ~~~~vldiG~G~G~~~~~~~~~~   61 (223)
T TIGR01934        39 KGQKVLDVACGTGDLAIELAKSA   61 (223)
T ss_pred             CCCeEEEeCCCCChhHHHHHHhc
Confidence            56799999999998877766654


No 18 
>PF02353 CMAS:  Mycolic acid cyclopropane synthetase;  InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4). All are thought to be S-adenosyl-L-methionine (SAM) utilising methyltransferases []. Mycolic acid cyclopropane synthase or cyclopropane-fatty-acyl-phospholipid synthase (CFA synthase) 2.1.1.79 from EC catalyses the reaction:   S-adenosyl-L-methionine + phospholipid olefinic fatty acid -> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.  The major mycolic acid produced by Mycobacterium tuberculosis contains two cis-cyclopropanes in the meromycolate chain. Cyclopropanation may contribute to the structural integrity of the cell wall complex [].; GO: 0008610 lipid biosynthetic process; PDB: 3HA5_A 2FK8_A 3HA7_A 3HA3_A 2FK7_A 1KPG_D 1KP9_B 1KPH_D 3VC2_E 3VC1_D ....
Probab=45.96  E-value=17  Score=29.30  Aligned_cols=46  Identities=26%  Similarity=0.248  Sum_probs=28.3

Q ss_pred             HHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHHHHhhh
Q psy9383          64 DLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKHLMGL  110 (133)
Q Consensus        64 DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh~mGL  110 (133)
                      +-|-+.=.+.-..++..-.|..-.|+||+|-|.|--.-.+|++. |.
T Consensus        41 ~~Le~AQ~~k~~~~~~~~~l~~G~~vLDiGcGwG~~~~~~a~~~-g~   86 (273)
T PF02353_consen   41 DTLEEAQERKLDLLCEKLGLKPGDRVLDIGCGWGGLAIYAAERY-GC   86 (273)
T ss_dssp             --HHHHHHHHHHHHHTTTT--TT-EEEEES-TTSHHHHHHHHHH---
T ss_pred             hhHHHHHHHHHHHHHHHhCCCCCCEEEEeCCCccHHHHHHHHHc-Cc
Confidence            33444444444455667788888999999999999888888875 53


No 19 
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=43.70  E-value=9.7  Score=28.48  Aligned_cols=24  Identities=33%  Similarity=0.396  Sum_probs=19.3

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +...+++||+|-|.|......|++
T Consensus        29 ~~~~~~vLDiGcG~G~~~~~la~~   52 (258)
T PRK01683         29 LENPRYVVDLGCGPGNSTELLVER   52 (258)
T ss_pred             CcCCCEEEEEcccCCHHHHHHHHH
Confidence            345679999999999988777765


No 20 
>TIGR00740 methyltransferase, putative. A simple BLAST search finds all members of this family and weaker hits to a large number of known and predicted methyltransferases. A single iteration with PSI-BLAST, keeping only clear members of the family, leads to a large number of highly significant hits to a set of known and predicted methyltransferases with a large repertoire of different specifities. This model is restricted to a subfamily found so far only in the Proteobacteria, sharing consistent length, full-length homology, and on average better than 35 % identity. It is reasonable to predict equivalent function within this subfamily.
Probab=42.97  E-value=33  Score=25.61  Aligned_cols=23  Identities=30%  Similarity=0.369  Sum_probs=18.5

Q ss_pred             hhcccccccccCCCCchhHHHHH
Q psy9383          84 ENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        84 e~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ....++||+|-|.|......+++
T Consensus        52 ~~~~~iLDlGcG~G~~~~~l~~~   74 (239)
T TIGR00740        52 TPDSNVYDLGCSRGAATLSARRN   74 (239)
T ss_pred             CCCCEEEEecCCCCHHHHHHHHh
Confidence            35568999999999987777765


No 21 
>PLN02781 Probable caffeoyl-CoA O-methyltransferase
Probab=38.60  E-value=21  Score=27.62  Aligned_cols=23  Identities=35%  Similarity=0.489  Sum_probs=19.1

Q ss_pred             hcccccccccCCCCchhHHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      +.|++||+|-+-|||+.-.|+++
T Consensus        68 ~~~~vLEiGt~~G~s~l~la~~~   90 (234)
T PLN02781         68 NAKNTLEIGVFTGYSLLTTALAL   90 (234)
T ss_pred             CCCEEEEecCcccHHHHHHHHhC
Confidence            47899999999999987666553


No 22 
>PRK14967 putative methyltransferase; Provisional
Probab=37.84  E-value=22  Score=26.57  Aligned_cols=37  Identities=30%  Similarity=0.311  Sum_probs=26.1

Q ss_pred             ChHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHHH
Q psy9383          62 QPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        62 d~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      |...+.+.+.+++        +....++||+|-|.|.-+..+|+.
T Consensus        21 ds~~l~~~l~~~~--------~~~~~~vLDlGcG~G~~~~~la~~   57 (223)
T PRK14967         21 DTQLLADALAAEG--------LGPGRRVLDLCTGSGALAVAAAAA   57 (223)
T ss_pred             cHHHHHHHHHhcc--------cCCCCeEEEecCCHHHHHHHHHHc
Confidence            5566667766543        223468999999999887777763


No 23 
>PRK14103 trans-aconitate 2-methyltransferase; Provisional
Probab=37.31  E-value=15  Score=27.84  Aligned_cols=46  Identities=24%  Similarity=0.314  Sum_probs=28.6

Q ss_pred             hhcccccCCCChHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHHH
Q psy9383          52 KQYDNVEGADQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        52 ~~Yd~~~~~~d~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.|....... ...+.++|.++.        +...+++||+|-|.|......++.
T Consensus         5 ~~y~~~~~~~-~~~~~~ll~~l~--------~~~~~~vLDlGcG~G~~~~~l~~~   50 (255)
T PRK14103          5 DVYLAFADHR-GRPFYDLLARVG--------AERARRVVDLGCGPGNLTRYLARR   50 (255)
T ss_pred             HHHHHHHhHh-hCHHHHHHHhCC--------CCCCCEEEEEcCCCCHHHHHHHHH
Confidence            3454433333 244556666655        234589999999999877666553


No 24 
>cd08768 Cdc6_C Winged-helix domain of essential DNA replication protein Cell division control protein (Cdc6), which mediates DNA binding. This model characterizes the winged-helix, C-terminal domain of the Cell division control protein (Cdc6_C). Cdc6 (also known as Cell division cycle 6 or Cdc18) functions as a regulator at the early stages of DNA replication, by helping to recruit and load the Minichromosome Maintenance Complex (MCM) onto DNA and may have additional roles in the control of mitotic entry. Precise duplication of chromosomal DNA is required for genomic stability during replication. Cdc6 has an essential role in DNA replication and irregular expression of Cdc6 may lead to genomic instability. Cdc6 over-expression is observed in many cancerous lesions. DNA replication begins when an origin recognition complex (ORC) binds to a replication origin site on the chromatin. Studies indicate that Cdc6 interacts with ORC through the Orc1 subunit, and that this association increases
Probab=35.12  E-value=25  Score=22.40  Aligned_cols=30  Identities=23%  Similarity=0.479  Sum_probs=24.5

Q ss_pred             eeeCcchhhhHHHHhhhhhhhhhccccccc
Q psy9383          14 FSISPLGMRHFSELLDQLQFFEFIGRRDKF   43 (133)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~ig~r~~~   43 (133)
                      +.+.|+++|.|++++..|...-+|--+.+-
T Consensus        39 ~~~~~l~~~~~~~~l~~L~~~gli~~~~~~   68 (87)
T cd08768          39 IGVDPLTQRRISDLLSELEMLGLLETEVSS   68 (87)
T ss_pred             cCCCCCcHHHHHHHHHHHHHcCCeEEEEec
Confidence            357899999999999999998888654443


No 25 
>PF13847 Methyltransf_31:  Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A ....
Probab=34.27  E-value=17  Score=25.13  Aligned_cols=21  Identities=43%  Similarity=0.373  Sum_probs=17.4

Q ss_pred             hcccccccccCCCCchhHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAK  105 (133)
                      +.+++||+|-|.|+..-..|+
T Consensus         3 ~~~~iLDlGcG~G~~~~~l~~   23 (152)
T PF13847_consen    3 SNKKILDLGCGTGRLLIQLAK   23 (152)
T ss_dssp             TTSEEEEET-TTSHHHHHHHH
T ss_pred             CCCEEEEecCcCcHHHHHHHH
Confidence            457899999999999988885


No 26 
>PLN02366 spermidine synthase
Probab=33.86  E-value=33  Score=28.26  Aligned_cols=53  Identities=21%  Similarity=0.172  Sum_probs=34.5

Q ss_pred             hhhhhhcccccCCCChHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHHH
Q psy9383          48 SFVIKQYDNVEGADQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        48 ~~~~~~Yd~~~~~~d~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+++.+.-+ ..+.|+-.-.|+|..+.-   .  -.++-||+|++|.|-|......+||
T Consensus        60 ~L~lDg~~q-~~~~de~~Y~e~l~h~~l---~--~~~~pkrVLiIGgG~G~~~rellk~  112 (308)
T PLN02366         60 VLVLDGVIQ-LTERDECAYQEMITHLPL---C--SIPNPKKVLVVGGGDGGVLREIARH  112 (308)
T ss_pred             EEEECCEee-ecCccHHHHHHHHHHHHH---h--hCCCCCeEEEEcCCccHHHHHHHhC
Confidence            344444433 334454445677776542   1  2345799999999999988888887


No 27 
>PHA02594 nadV nicotinamide phosphoribosyl transferase; Provisional
Probab=33.43  E-value=30  Score=31.09  Aligned_cols=19  Identities=32%  Similarity=0.401  Sum_probs=14.5

Q ss_pred             ccccccccCCCCchhHHHHH
Q psy9383          87 KRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        87 KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+..|||+ ||.||.++|..
T Consensus       177 ~~l~DFG~-Rra~g~eaa~~  195 (470)
T PHA02594        177 FQLHDFGA-RGMSSGESAAL  195 (470)
T ss_pred             ceeeeccC-CCCCChHHHHH
Confidence            36899997 88888877653


No 28 
>PLN02244 tocopherol O-methyltransferase
Probab=32.49  E-value=32  Score=27.90  Aligned_cols=24  Identities=29%  Similarity=0.325  Sum_probs=19.5

Q ss_pred             hhcccccccccCCCCchhHHHHHH
Q psy9383          84 ENSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        84 e~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      ...+++||+|-|-|......|+..
T Consensus       117 ~~~~~VLDiGCG~G~~~~~La~~~  140 (340)
T PLN02244        117 KRPKRIVDVGCGIGGSSRYLARKY  140 (340)
T ss_pred             CCCCeEEEecCCCCHHHHHHHHhc
Confidence            456789999999999887777753


No 29 
>PRK06922 hypothetical protein; Provisional
Probab=32.06  E-value=66  Score=30.43  Aligned_cols=81  Identities=21%  Similarity=0.336  Sum_probs=43.9

Q ss_pred             ceeEEEeeeCcchhhhHHH---------Hhhh--hhhhhhccccc----cccccchhhhhhcccccCCCChHHHHHHHHH
Q psy9383           8 SEFFVSFSISPLGMRHFSE---------LLDQ--LQFFEFIGRRD----KFQDQSSFVIKQYDNVEGADQPDLILEMLAR   72 (133)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~---------~~~~--~~~~~~ig~r~----~~~~~~~~~~~~Yd~~~~~~d~DylleLL~R   72 (133)
                      +.-+|+|..|+.|-.-..-         +-++  +-++.|+|.|.    .|.++.+     |-+.. ....++..+++  
T Consensus       343 ~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~r~~~~~fd~fg~r~D~~dRf~~~~~-----yle~m-~~~~~~k~~i~--  414 (677)
T PRK06922        343 KTAYVSFRFSAVGEALITFCVEAEKIDMMHARANVLLFDFFGLRKDAYDRFHNEEV-----YLEHM-NSSADDKRIIL--  414 (677)
T ss_pred             ceeeEEEeecHHHHHHHHHHHhhhhcchHHHHHHhHHHHHhccChhhHhHHHhHHH-----HHHhc-cccHHHHHHHh--
Confidence            4468999999998543221         2222  23667777763    2323322     22211 11333332221  


Q ss_pred             hhhhcccchhhhhcccccccccCCCCchhHHHH
Q psy9383          73 LSQSILRENDLENSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        73 lg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAK  105 (133)
                               ++....++||+|-|-|......|+
T Consensus       415 ---------d~~~g~rVLDIGCGTG~ls~~LA~  438 (677)
T PRK06922        415 ---------DYIKGDTIVDVGAGGGVMLDMIEE  438 (677)
T ss_pred             ---------hhcCCCEEEEeCCCCCHHHHHHHH
Confidence                     222357899999999987655554


No 30 
>smart00828 PKS_MT Methyltransferase  in polyketide synthase (PKS) enzymes.
Probab=31.78  E-value=24  Score=25.62  Aligned_cols=21  Identities=33%  Similarity=0.305  Sum_probs=17.2

Q ss_pred             ccccccccCCCCchhHHHHHH
Q psy9383          87 KRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        87 KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      |++||+|-|.|......|++.
T Consensus         1 ~~vLDiGcG~G~~~~~la~~~   21 (224)
T smart00828        1 KRVLDFGCGYGSDLIDLAERH   21 (224)
T ss_pred             CeEEEECCCCCHHHHHHHHHC
Confidence            689999999998777777654


No 31 
>PF13679 Methyltransf_32:  Methyltransferase domain
Probab=31.41  E-value=38  Score=23.82  Aligned_cols=23  Identities=22%  Similarity=0.341  Sum_probs=18.7

Q ss_pred             hhhcccccccccCCCCchhHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAK  105 (133)
                      .....+++|||-|+||=+...|.
T Consensus        23 ~~~~~~vvD~GsG~GyLs~~La~   45 (141)
T PF13679_consen   23 SKRCITVVDLGSGKGYLSRALAH   45 (141)
T ss_pred             cCCCCEEEEeCCChhHHHHHHHH
Confidence            34567799999999998877776


No 32 
>TIGR00438 rrmJ cell division protein FtsJ.
Probab=31.24  E-value=55  Score=23.60  Aligned_cols=26  Identities=23%  Similarity=0.241  Sum_probs=18.9

Q ss_pred             hhhhcccccccccCCCCchhHHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      .+...+++||+|-|-|.-...+++..
T Consensus        29 ~i~~g~~VLDiG~GtG~~~~~l~~~~   54 (188)
T TIGR00438        29 LIKPGDTVLDLGAAPGGWSQVAVEQV   54 (188)
T ss_pred             ccCCCCEEEEecCCCCHHHHHHHHHh
Confidence            44556799999999997666555543


No 33 
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed
Probab=30.11  E-value=25  Score=26.66  Aligned_cols=25  Identities=36%  Similarity=0.501  Sum_probs=20.4

Q ss_pred             hhhhcccccccccCCCCchhHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+...+++||+|-|-|....+++++
T Consensus        74 ~~~~g~~VLDiG~G~G~~~~~~a~~   98 (272)
T PRK11873         74 ELKPGETVLDLGSGGGFDCFLAARR   98 (272)
T ss_pred             cCCCCCEEEEeCCCCCHHHHHHHHH
Confidence            4556789999999999888777765


No 34 
>PRK07402 precorrin-6B methylase; Provisional
Probab=29.40  E-value=26  Score=25.50  Aligned_cols=23  Identities=22%  Similarity=0.146  Sum_probs=18.2

Q ss_pred             hhcccccccccCCCCchhHHHHH
Q psy9383          84 ENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        84 e~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ....++||+|-|-|+.+..+|+.
T Consensus        39 ~~~~~VLDiG~G~G~~~~~la~~   61 (196)
T PRK07402         39 EPDSVLWDIGAGTGTIPVEAGLL   61 (196)
T ss_pred             CCCCEEEEeCCCCCHHHHHHHHH
Confidence            34568999999999988777653


No 35 
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]
Probab=28.65  E-value=43  Score=29.12  Aligned_cols=40  Identities=38%  Similarity=0.682  Sum_probs=26.1

Q ss_pred             hHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhH---HHHHHhhh
Q psy9383          63 PDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQ---AAKHLMGL  110 (133)
Q Consensus        63 ~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsq---aAKh~mGL  110 (133)
                      |..|-++|.+.+        ..--+|+||+|.|-|.+|-.   -|+++-|.
T Consensus       111 P~~l~emI~~~~--------~g~F~~~lDLGCGTGL~G~~lR~~a~~ltGv  153 (287)
T COG4976         111 PELLAEMIGKAD--------LGPFRRMLDLGCGTGLTGEALRDMADRLTGV  153 (287)
T ss_pred             HHHHHHHHHhcc--------CCccceeeecccCcCcccHhHHHHHhhccCC
Confidence            455555555433        22278999999999999853   35555553


No 36 
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional
Probab=28.33  E-value=42  Score=25.42  Aligned_cols=22  Identities=23%  Similarity=0.176  Sum_probs=17.6

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ..+++||+|-|-|.-...+++.
T Consensus        51 ~~~~VLDlG~GtG~~t~~l~~~   72 (209)
T PRK11188         51 PGMTVVDLGAAPGGWSQYAVTQ   72 (209)
T ss_pred             CCCEEEEEcccCCHHHHHHHHH
Confidence            4568999999999877766664


No 37 
>COG1990 pth2 Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis]
Probab=28.28  E-value=34  Score=26.27  Aligned_cols=23  Identities=30%  Similarity=0.338  Sum_probs=19.4

Q ss_pred             ccccCCCCchhHHHHHHhhhhhh
Q psy9383          91 DLGLSRGFSGSQAAKHLMGLAAA  113 (133)
Q Consensus        91 DfGL~RG~SGsqaAKh~mGLaaA  113 (133)
                      |++||||.=.+|+|-+-...+..
T Consensus        15 Dl~m~kGKiaaQvaHaa~~~~~~   37 (122)
T COG1990          15 DLKMSKGKLAAQVAHAAVDAAKL   37 (122)
T ss_pred             ccccccchHHHHHHHHHHHHHHH
Confidence            89999999999999887766543


No 38 
>PF03960 ArsC:  ArsC family;  InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite []. This system transports arsenite and antimonite out of the cell. The pump is composed of two polypeptides, the products of the arsA and arsB genes. This two-subunit enzyme produces resistance to arsenite and antimonite. Arsenate, however, must first be reduced to arsenite before it is extruded. A third gene, arsC, expands the substrate specificity to allow for arsenate pumping and resistance. ArsC is an approximately 150-residue arsenate reductase that uses reduced glutathione (GSH) to convert arsenate to arsenite with a redox active cysteine residue in the active site. ArsC forms an active quaternary complex with GSH, arsenate, and glutaredoxin 1 (Grx1). The three ligands must be present simultaneously for reduction to occur []. The arsC family also comprises the Spx proteins which are GRAM-positive bacterial transcription factors that regulate the transcription of multiple genes in response to disulphide stress []. The arsC protein structure has been solved []. It belongs to the thioredoxin superfamily fold which is defined by a beta-sheet core surrounded by alpha-helices. The active cysteine residue of ArsC is located in the loop between the first beta-strand and the first helix, which is also conserved in the Spx protein and its homologues.; PDB: 2KOK_A 1SK1_A 1SK2_A 1JZW_A 1J9B_A 1S3C_A 1SD8_A 1SD9_A 1I9D_A 1SK0_A ....
Probab=27.73  E-value=1.2e+02  Score=20.56  Aligned_cols=57  Identities=23%  Similarity=0.345  Sum_probs=36.3

Q ss_pred             EEEeeeCcchhhhHHHHhhhhh--hhhhccccccccccchhhhhhcc-cccCCCChHHHHHHHHHhh
Q psy9383          11 FVSFSISPLGMRHFSELLDQLQ--FFEFIGRRDKFQDQSSFVIKQYD-NVEGADQPDLILEMLARLS   74 (133)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~--~~~~ig~r~~~~~~~~~~~~~Yd-~~~~~~d~DylleLL~Rlg   74 (133)
                      |+.+.=.|+--..+.+++..+.  +-..|-.+.+.       ++..+ ....+.+++.++++|..-.
T Consensus        25 ~~d~~k~p~s~~el~~~l~~~~~~~~~lin~~~~~-------~k~l~~~~~~~~s~~e~i~~l~~~p   84 (110)
T PF03960_consen   25 FIDYKKEPLSREELRELLSKLGNGPDDLINTRSKT-------YKELGKLKKDDLSDEELIELLLENP   84 (110)
T ss_dssp             EEETTTS---HHHHHHHHHHHTSSGGGGB-TTSHH-------HHHTTHHHCTTSBHHHHHHHHHHSG
T ss_pred             eehhhhCCCCHHHHHHHHHHhcccHHHHhcCccch-------HhhhhhhhhhhhhhHHHHHHHHhCh
Confidence            4566667888888888888887  67777665443       34444 3335668889999998844


No 39 
>PRK00811 spermidine synthase; Provisional
Probab=27.37  E-value=36  Score=27.10  Aligned_cols=41  Identities=24%  Similarity=0.202  Sum_probs=27.6

Q ss_pred             CChHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHHH
Q psy9383          61 DQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        61 ~d~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .|+-.-.|+|..+.-   -  .-++-|++||+|.|-|.....++||
T Consensus        57 ~de~~Y~e~l~h~~~---~--~~~~p~~VL~iG~G~G~~~~~~l~~   97 (283)
T PRK00811         57 RDEFIYHEMMTHVPL---F--AHPNPKRVLIIGGGDGGTLREVLKH   97 (283)
T ss_pred             cchhhHHHHhhhHHH---h--hCCCCCEEEEEecCchHHHHHHHcC
Confidence            343334566665441   1  1235689999999999998888887


No 40 
>PF01596 Methyltransf_3:  O-methyltransferase;  InterPro: IPR002935 Members of this family are O-methyltransferases. The family includes also bacterial O-methyltransferases that may be involved in antibiotic production [].; GO: 0008171 O-methyltransferase activity; PDB: 1SUI_C 1SUS_D 3CBG_A 2GPY_B 3TR6_A 2AVD_A 3DUL_B 3DUW_B 2ZTH_A 1VID_A ....
Probab=26.24  E-value=42  Score=26.05  Aligned_cols=23  Identities=35%  Similarity=0.469  Sum_probs=19.0

Q ss_pred             hcccccccccCCCCchhHHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      +.|++|.+|-+-|||+..-|+++
T Consensus        45 ~~k~vLEIGt~~GySal~la~~l   67 (205)
T PF01596_consen   45 RPKRVLEIGTFTGYSALWLAEAL   67 (205)
T ss_dssp             T-SEEEEESTTTSHHHHHHHHTS
T ss_pred             CCceEEEeccccccHHHHHHHhh
Confidence            58999999999999998877653


No 41 
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific. Members of this protein family are HemK (PrmC), a protein once thought to be involved in heme biosynthesis but now recognized to be a protein-glutamine methyltransferase that modifies the peptide chain release factors. All members of the seed alignment are encoded next to the release factor 1 gene (prfA) and confirmed by phylogenetic analysis. SIMBAL analysis (manuscript in prep.) shows the motif [LIV]PRx[DE]TE (in Escherichia coli, IPRPDTE) confers specificity for the release factors rather than for ribosomal protein L3.
Probab=26.15  E-value=25  Score=25.66  Aligned_cols=22  Identities=36%  Similarity=0.362  Sum_probs=18.8

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.+++||+|-|.|..+...|++
T Consensus        87 ~~~~ilDig~G~G~~~~~l~~~  108 (251)
T TIGR03534        87 GPLRVLDLGTGSGAIALALAKE  108 (251)
T ss_pred             CCCeEEEEeCcHhHHHHHHHHH
Confidence            3468999999999998888875


No 42 
>TIGR00477 tehB tellurite resistance protein TehB. Part of a tellurite-reducing operon tehA and tehB
Probab=25.68  E-value=29  Score=25.60  Aligned_cols=21  Identities=24%  Similarity=0.268  Sum_probs=18.1

Q ss_pred             cccccccccCCCCchhHHHHH
Q psy9383          86 SKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        86 ~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+++||+|-|-|.....+|+.
T Consensus        31 ~~~vLDiGcG~G~~a~~la~~   51 (195)
T TIGR00477        31 PCKTLDLGCGQGRNSLYLSLA   51 (195)
T ss_pred             CCcEEEeCCCCCHHHHHHHHC
Confidence            479999999999998888774


No 43 
>PLN02589 caffeoyl-CoA O-methyltransferase
Probab=23.79  E-value=43  Score=26.91  Aligned_cols=22  Identities=27%  Similarity=0.443  Sum_probs=18.8

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.|++|.+|-+.|||+..-|+.
T Consensus        79 ~ak~iLEiGT~~GySal~la~a  100 (247)
T PLN02589         79 NAKNTMEIGVYTGYSLLATALA  100 (247)
T ss_pred             CCCEEEEEeChhhHHHHHHHhh
Confidence            4899999999999999876654


No 44 
>PF06564 YhjQ:  YhjQ protein;  InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm [], based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=23.79  E-value=62  Score=26.40  Aligned_cols=62  Identities=27%  Similarity=0.309  Sum_probs=37.0

Q ss_pred             ccchhhhhhcccccCCCChHHHHHHHHHhhhhcc----cchhhh---hcccccccccCCCCchhHHHHHHhhhh
Q psy9383          45 DQSSFVIKQYDNVEGADQPDLILEMLARLSQSIL----RENDLE---NSKRGLDLGLSRGFSGSQAAKHLMGLA  111 (133)
Q Consensus        45 ~~~~~~~~~Yd~~~~~~d~DylleLL~Rlg~sil----~~~dLe---~~KR~lDfGL~RG~SGsqaAKh~mGLa  111 (133)
                      ...-||||+|+. ...-..|.+.-+..++++.+.    +++-+.   ..|.-    ++.=..-||||+.+++||
T Consensus       164 ~~~~~liNq~~~-~s~l~~D~~~~~~~~l~~llp~~IHrDeAv~EAlA~~~~----v~~yaP~S~Aa~D~~~LA  232 (243)
T PF06564_consen  164 AGHRFLINQYDP-ASQLQRDLLQVWRQSLGRLLPGVIHRDEAVAEALASGQP----VGEYAPHSQAAEDIQTLA  232 (243)
T ss_pred             CCcEEEEeccCc-cchHHHHHHHHHHHhhccccceeeecchHHHHHHhcCCC----ccccCccCHHHHHHHHHH
Confidence            356899999999 556666765544444553221    233332   12322    122356789999999987


No 45 
>PRK04457 spermidine synthase; Provisional
Probab=23.68  E-value=30  Score=27.25  Aligned_cols=24  Identities=21%  Similarity=0.198  Sum_probs=19.7

Q ss_pred             hhcccccccccCCCCchhHHHHHH
Q psy9383          84 ENSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        84 e~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      ++.|++||+|+|-|......+++.
T Consensus        65 ~~~~~vL~IG~G~G~l~~~l~~~~   88 (262)
T PRK04457         65 PRPQHILQIGLGGGSLAKFIYTYL   88 (262)
T ss_pred             CCCCEEEEECCCHhHHHHHHHHhC
Confidence            356899999999999888777764


No 46 
>PF06515 BDV_P10:  Borna disease virus P10 protein;  InterPro: IPR009485 This family consists of several Borna disease virus P10 (or X) proteins. Borna disease virus (BDV) is unique among the non-segmented negative-strand RNA viruses of animals and man because it transcribes and replicates its genome in the nucleus of the infected cell. It has been suggested that the p10 protein plays a role in viral RNA synthesis or ribonucleoprotein transport [].
Probab=23.50  E-value=75  Score=23.51  Aligned_cols=12  Identities=33%  Similarity=0.520  Sum_probs=9.8

Q ss_pred             HHHHHHHHHhhh
Q psy9383          64 DLILEMLARLSQ   75 (133)
Q Consensus        64 DylleLL~Rlg~   75 (133)
                      --|||||+||+-
T Consensus         7 LTLLELiRRlNG   18 (87)
T PF06515_consen    7 LTLLELIRRLNG   18 (87)
T ss_pred             hHHHHHHHHhcC
Confidence            468999999874


No 47 
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt.
Probab=23.34  E-value=35  Score=25.34  Aligned_cols=24  Identities=21%  Similarity=0.416  Sum_probs=19.3

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +....|+||+|-|-|+.....|+.
T Consensus        75 ~~~~~~VLDiG~GsG~~a~~la~~   98 (215)
T TIGR00080        75 LKPGMKVLEIGTGSGYQAAVLAEI   98 (215)
T ss_pred             CCCcCEEEEECCCccHHHHHHHHH
Confidence            345679999999999988776664


No 48 
>PRK01581 speE spermidine synthase; Validated
Probab=23.07  E-value=51  Score=28.90  Aligned_cols=45  Identities=20%  Similarity=0.147  Sum_probs=32.2

Q ss_pred             cCCCChHHHHHHHHHhhhhcccchhhhhcccccccccCCCCchhHHHHHH
Q psy9383          58 EGADQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        58 ~~~~d~DylleLL~Rlg~sil~~~dLe~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      -.+.|+..--|+|....   |.  -..+.||+|++|.|-|++-..+.||.
T Consensus       128 ~se~DE~iYHE~Lvhp~---m~--~h~~PkrVLIIGgGdG~tlrelLk~~  172 (374)
T PRK01581        128 FSSVDEQIYHEALVHPI---MS--KVIDPKRVLILGGGDGLALREVLKYE  172 (374)
T ss_pred             cccccHHHHHHHHHHHH---HH--hCCCCCEEEEECCCHHHHHHHHHhcC
Confidence            34446666678887744   11  34567899999999999888888874


No 49 
>PRK11207 tellurite resistance protein TehB; Provisional
Probab=22.41  E-value=24  Score=26.08  Aligned_cols=21  Identities=29%  Similarity=0.355  Sum_probs=17.7

Q ss_pred             cccccccccCCCCchhHHHHH
Q psy9383          86 SKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        86 ~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+++||+|-|.|......|++
T Consensus        31 ~~~vLDiGcG~G~~a~~La~~   51 (197)
T PRK11207         31 PGKTLDLGCGNGRNSLYLAAN   51 (197)
T ss_pred             CCcEEEECCCCCHHHHHHHHC
Confidence            578999999999987777764


No 50 
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=21.84  E-value=37  Score=25.25  Aligned_cols=22  Identities=18%  Similarity=0.389  Sum_probs=17.8

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ...++||+|-|-|+.....|+.
T Consensus        72 ~~~~VLDiG~GsG~~~~~la~~   93 (205)
T PRK13944         72 PGMKILEVGTGSGYQAAVCAEA   93 (205)
T ss_pred             CCCEEEEECcCccHHHHHHHHh
Confidence            4568999999999988766654


No 51 
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed
Probab=21.81  E-value=38  Score=24.82  Aligned_cols=22  Identities=23%  Similarity=0.477  Sum_probs=17.4

Q ss_pred             hhcccccccccCCCCchhHHHH
Q psy9383          84 ENSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        84 e~~KR~lDfGL~RG~SGsqaAK  105 (133)
                      ....|+||+|-|.|+.....|+
T Consensus        77 ~~~~~VLeiG~GsG~~t~~la~   98 (212)
T PRK00312         77 KPGDRVLEIGTGSGYQAAVLAH   98 (212)
T ss_pred             CCCCEEEEECCCccHHHHHHHH
Confidence            3457899999999998775554


No 52 
>COG4122 Predicted O-methyltransferase [General function prediction only]
Probab=21.54  E-value=68  Score=25.85  Aligned_cols=22  Identities=32%  Similarity=0.397  Sum_probs=18.7

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.|++|.+|-+-|||+..-|-+
T Consensus        59 ~~k~iLEiGT~~GySal~mA~~   80 (219)
T COG4122          59 GPKRILEIGTAIGYSALWMALA   80 (219)
T ss_pred             CCceEEEeecccCHHHHHHHhh
Confidence            5899999999999999776543


No 53 
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=21.50  E-value=65  Score=24.06  Aligned_cols=23  Identities=35%  Similarity=0.322  Sum_probs=18.9

Q ss_pred             hcccccccccCCCCchhHHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHL  107 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~  107 (133)
                      ..+++||+|-|.|..+...|++.
T Consensus       108 ~~~~vLDiG~GsG~~~~~la~~~  130 (275)
T PRK09328        108 EPLRVLDLGTGSGAIALALAKER  130 (275)
T ss_pred             CCCEEEEEcCcHHHHHHHHHHHC
Confidence            45689999999998888777764


No 54 
>PF05193 Peptidase_M16_C:  Peptidase M16 inactive domain;  InterPro: IPR007863 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. These metallopeptidases belong to MEROPS peptidase family M16 (clan ME). They include proteins, which are classified as non-peptidase homologues either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.  The peptidases in this group of sequences include:  Insulinase, insulin-degrading enzyme (3.4.24.56 from EC) Mitochondrial processing peptidase alpha subunit, (Alpha-MPP, 3.4.24.64 from EC) Pitrlysin, Protease III precursor (3.4.24.55 from EC) Nardilysin, (3.4.24.61 from EC) Ubiquinol-cytochrome C reductase complex core protein I,mitochondrial precursor (1.10.2.2 from EC) Coenzyme PQQ synthesis protein F (3.4.99 from EC)  These proteins do not share many regions of sequence similarity; the most noticeable is in the N-terminal section. This region includes a conserved histidine followed, two residues later by a glutamate and another histidine. In pitrilysin, it has been shown [] that this H-x-x-E-H motif is involved in enzymatic activity; the two histidines bind zinc and the glutamate is necessary for catalytic activity. The mitochondrial processing peptidase consists of two structurally related domains. One is the active peptidase whereas the other, the C-terminal region, is inactive. The two domains hold the substrate like a clamp [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis; PDB: 1BE3_B 1PP9_B 2A06_B 1SQB_B 1SQP_B 1L0N_B 1SQX_B 1NU1_B 1L0L_B 2FYU_B ....
Probab=21.36  E-value=56  Score=21.24  Aligned_cols=27  Identities=37%  Similarity=0.546  Sum_probs=18.9

Q ss_pred             HHHHHHHHHhhhhcccchhhhhccccc
Q psy9383          64 DLILEMLARLSQSILRENDLENSKRGL   90 (133)
Q Consensus        64 DylleLL~Rlg~sil~~~dLe~~KR~l   90 (133)
                      +.+.+.|.++....++.+++++.|+.|
T Consensus       158 ~~~~~~l~~l~~~~~s~~el~~~k~~L  184 (184)
T PF05193_consen  158 EAILQELKRLREGGISEEELERAKNQL  184 (184)
T ss_dssp             HHHHHHHHHHHHHCS-HHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCCHHHHHHHHhcC
Confidence            456666777777778889999887643


No 55 
>PF05175 MTS:  Methyltransferase small domain;  InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases.; GO: 0008168 methyltransferase activity; PDB: 1WY7_A 1DUS_A 2OZV_A 2PJD_A 1VQ1_A 1NV9_A 1SG9_C 1NV8_A 3Q87_B 3DMF_A ....
Probab=21.29  E-value=40  Score=24.28  Aligned_cols=24  Identities=33%  Similarity=0.289  Sum_probs=20.1

Q ss_pred             hcccccccccCCCCchhHHHHHHh
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKHLM  108 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh~m  108 (133)
                      ..+++||+|-|-|.=|..+|++..
T Consensus        31 ~~~~vLDlG~G~G~i~~~la~~~~   54 (170)
T PF05175_consen   31 KGGRVLDLGCGSGVISLALAKRGP   54 (170)
T ss_dssp             TTCEEEEETSTTSHHHHHHHHTST
T ss_pred             cCCeEEEecCChHHHHHHHHHhCC
Confidence            678899999999998888887643


No 56 
>smart00650 rADc Ribosomal RNA adenine dimethylases.
Probab=21.21  E-value=32  Score=24.49  Aligned_cols=24  Identities=17%  Similarity=0.282  Sum_probs=19.2

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +....++||+|-|.|.-+..++++
T Consensus        11 ~~~~~~vLEiG~G~G~lt~~l~~~   34 (169)
T smart00650       11 LRPGDTVLEIGPGKGALTEELLER   34 (169)
T ss_pred             CCCcCEEEEECCCccHHHHHHHhc
Confidence            445568999999999988877765


No 57 
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed
Probab=21.04  E-value=64  Score=24.47  Aligned_cols=24  Identities=38%  Similarity=0.537  Sum_probs=19.1

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      ++..+++||+|-|-|+.+...|++
T Consensus        43 l~~g~~VLDiGcGtG~~al~la~~   66 (187)
T PRK00107         43 LPGGERVLDVGSGAGFPGIPLAIA   66 (187)
T ss_pred             cCCCCeEEEEcCCCCHHHHHHHHH
Confidence            334789999999999988877653


No 58 
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase. Members of this small clade are methyltransferases of the pfam08241 family and are observed within operons for the biosynthesis of pseudaminic acid, a component of exopolysaccharide and flagellin glycosyl modifications. Notable among these genomes is Pseudomonas fluorescens PfO-1. Possibly one of the two hydroxyl groups of pseudaminic acid, at positions 4 and 8 is converted to a methoxy group by this enzyme
Probab=20.97  E-value=82  Score=23.88  Aligned_cols=24  Identities=21%  Similarity=0.235  Sum_probs=19.1

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.+.+++||+|-|-|+.....+++
T Consensus        41 ~~~~~~VLDiGCG~G~~~~~L~~~   64 (204)
T TIGR03587        41 LPKIASILELGANIGMNLAALKRL   64 (204)
T ss_pred             cCCCCcEEEEecCCCHHHHHHHHh
Confidence            445678999999999988776665


No 59 
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=20.85  E-value=39  Score=25.44  Aligned_cols=24  Identities=21%  Similarity=0.454  Sum_probs=18.9

Q ss_pred             hhhcccccccccCCCCchhHHHHH
Q psy9383          83 LENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        83 Le~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +....++||+|-|-||.....|+.
T Consensus        74 ~~~g~~VLdIG~GsG~~t~~la~~   97 (212)
T PRK13942         74 LKEGMKVLEIGTGSGYHAAVVAEI   97 (212)
T ss_pred             CCCcCEEEEECCcccHHHHHHHHh
Confidence            345678999999999988766654


No 60 
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase. This model represents an O-methyltransferase believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and fungi (COQ3). A separate methylase (MenG/UbiE) catalyzes the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase.
Probab=20.73  E-value=81  Score=22.72  Aligned_cols=22  Identities=27%  Similarity=0.312  Sum_probs=17.6

Q ss_pred             hcccccccccCCCCchhHHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      +.+++||+|-|.|......+++
T Consensus        45 ~~~~vLdlG~G~G~~~~~l~~~   66 (224)
T TIGR01983        45 FGLRVLDVGCGGGLLSEPLARL   66 (224)
T ss_pred             CCCeEEEECCCCCHHHHHHHhc
Confidence            4678999999999887776653


No 61 
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional
Probab=20.62  E-value=49  Score=27.78  Aligned_cols=25  Identities=36%  Similarity=0.413  Sum_probs=20.6

Q ss_pred             hhhhcccccccccCCCCchhHHHHH
Q psy9383          82 DLENSKRGLDLGLSRGFSGSQAAKH  106 (133)
Q Consensus        82 dLe~~KR~lDfGL~RG~SGsqaAKh  106 (133)
                      .+...+++||+|-|-|.-...+|++
T Consensus       164 ~l~~g~rVLDIGcG~G~~a~~la~~  188 (383)
T PRK11705        164 QLKPGMRVLDIGCGWGGLARYAAEH  188 (383)
T ss_pred             CCCCCCEEEEeCCCccHHHHHHHHH
Confidence            4455679999999999988888875


No 62 
>COG3394 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.48  E-value=58  Score=27.78  Aligned_cols=19  Identities=37%  Similarity=0.578  Sum_probs=13.0

Q ss_pred             ccccCCCCchhHHHHHHhh
Q psy9383          91 DLGLSRGFSGSQAAKHLMG  109 (133)
Q Consensus        91 DfGL~RG~SGsqaAKh~mG  109 (133)
                      |||||||.+--..--|+.|
T Consensus        11 DFGLs~G~nyGIiea~~~G   29 (257)
T COG3394          11 DFGLSKGVNYGIIEAHRTG   29 (257)
T ss_pred             ccCcCcccchhHHHHHhCC
Confidence            8999999875444444443


No 63 
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase
Probab=20.38  E-value=1.3e+02  Score=25.00  Aligned_cols=21  Identities=19%  Similarity=0.355  Sum_probs=16.0

Q ss_pred             hcccccccccCCCCchhHHHH
Q psy9383          85 NSKRGLDLGLSRGFSGSQAAK  105 (133)
Q Consensus        85 ~~KR~lDfGL~RG~SGsqaAK  105 (133)
                      ...++||+|-|-|.-+...|+
T Consensus       131 ~g~~ILDIGCG~G~~s~~La~  151 (322)
T PLN02396        131 EGLKFIDIGCGGGLLSEPLAR  151 (322)
T ss_pred             CCCEEEEeeCCCCHHHHHHHH
Confidence            346899999999987655554


Done!