Diaphorina citri psyllid: psy9383


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MLTFKTESEFFVSFSISPLGMRHFSELLDQLQFFEFIGRRDKFQDQSSFVIKQYDNVEGADQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKHLMGLAAANYAGGPGRRRRSDSDQYLSS
ccccccccEEEEEEECccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHcccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHccc
*******SEFFVSFSISPLGMRHFSELLDQLQFFEFIGRRDKFQDQSSFVIKQYDNVEGADQPDLILEMLARLSQ****************LGLSRGFSGSQAAKHLMGLAA*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTFKTESEFFVSFSISPLGMRHFSELLDQLQFFEFIGRRDKFQDQSSFVIKQYDNVEGADQPDLILEMLARLSQSILRENDLENSKRGLDLGLSRGFSGSQAAKHLMGLAAANYAGGPGRRRRSDSDQYLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Diuretic hormone class 2 Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a nonselective effect on Na(+)/K(+) ion transport. In vitro, primarily elevates intracellular Ca(2+).very confidentP85830
Diuretic hormone class 2 Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a nonselective effect on Na(+)/K(+) ion transport. In vitro, primarily elevates intracellular Ca(2+). Has synergistic effects with the larger diuretic hormone DH(46) which co-occurs with it.confidentP82372
Diuretic hormone class 2 Regulation of fluid secretion. Stimulates primary urine secretion by the Malpighian tubules. Increases the frequency of contraction in the heart and hindgut. Causes a dose-dependent stimulation of cAMP levels in the dorsal vessel and hindgut, but not in Malpighian tubules. Has synergistic effects on urine secretion by Malpighian tubules with serotonin.confidentP85826

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteconfidentGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonconfidentGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030816 [BP]positive regulation of cAMP metabolic processconfidentGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0045981, GO:0080090, GO:0030814, GO:0050789, GO:0065007, GO:0048518, GO:0045935, GO:0045937, GO:0019219, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:1900542, GO:1900544, GO:0030801, GO:0006140, GO:0010562, GO:0048522
GO:0007589 [BP]body fluid secretionconfidentGO:0051234, GO:0046903, GO:0032501, GO:0050878, GO:0044707, GO:0006810, GO:0044765, GO:0065007, GO:0008150, GO:0065008, GO:0051179, GO:0044699
GO:0035810 [BP]positive regulation of urine volumeconfidentGO:0032501, GO:0050878, GO:0044707, GO:0008150, GO:0035809, GO:0003014, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0008016 [BP]regulation of heart contractionconfidentGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789
GO:0043204 [CC]perikaryonconfidentGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0005576 [CC]extracellular regionconfidentGO:0005575
GO:0043134 [BP]regulation of hindgut contractionconfidentGO:0044057, GO:0006937, GO:0044058, GO:0006940, GO:0065007, GO:0090257, GO:0051239, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted