Diaphorina citri psyllid: psy9401

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---

MNFKSIGLHELVLKALVKVGYTKPTGVQEQAIPAAISGRDLIVSSQTGSGKTAAFMLPALHKFASSKNKIPVMKKNLNQNNNKIYTHKERLRFKPAQPRMLVLTPTRELALQVTAATERYGLYMKKIKAISILGGMPYLRQMQLLSRNPEILLATPGRLIDHMNSGKINFSHLQILVLDEADRMLDMGFINDIEKIVDATPVTRQTMLFSATLDGIVGNMAENITKDPLILKVNSIEKKQKNITQSILFVDDILHKNRLLDYLLRDKRVGQAVVFTATKRDADIIADRLNISGFLAAPLHGDLHQNARNRTLENLRRGRIKILVATDVAARGIDVPAITHVFNYDLPKFPEDYVHRIGRTGRAGRNGFAVSLVNHAERMNIKKIERFTKQQIPIEVINGFEPKKRIRTYYSRYRFNNNNWKTHNINKSNITKRFYRQIKKTSISASSKNSINY

cccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHcccccccccHHccccccccccHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHccccEEEEccccHHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHcccccEEEEcccccccccEEEEEEEccccccHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEHHccccccccccccEEEcccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MNFKSIGLHELVLKALVKVGYTKPTGVQEQAIPAAISGRDLIVSSQTGSGKTAAFMLPALHKFAS******************************AQPRMLVLTPTRELALQVTAATERYGLYMKKIKAISILGGMPYLRQMQLLSRNPEILLATPGRLIDHMNSGKINFSHLQILVLDEADRMLDMGFINDIEKIVDATPVTRQTMLFSATLDGIVGNMAENITKDPLILKVNSIEKKQKNITQSILFVDDILHKNRLLDYLLRDKRVGQAVVFTATKRDADIIADRLNISGFLAAPLHGDLHQNARNRTLENLRRGRIKILVATDVAARGIDVPAITHVFNYDLPKFPEDYVHRIGRTGRAGRNGFAVSLVNHAERMNIKKIERFTKQQIPIEVINGFEPK**************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-dependent RNA helicase SrmB homolog	RNA-dependent ATPase activity.	confident	P44701
DEAD-box ATP-dependent RNA helicase CshA	May work in conjunction with the cold shock proteins to ensure proper initiation of transcription at low and optimal temperatures. Unwinds dsRNA in both 5'- and 3'-directions and shows RNA-dependent ATPase activity.	confident	Q73EU1
DEAD-box ATP-dependent RNA helicase CshA	May work in conjunction with the cold shock proteins to ensure proper initiation of transcription at low and optimal temperatures. Unwinds dsRNA in both 5'- and 3'-directions and shows RNA-dependent ATPase activity.	confident	Q63GX5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030687 [CC]	preribosome, large subunit precursor	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0042254 [BP]	ribosome biogenesis	probable	GO:0022613, GO:0044085, GO:0008150, GO:0071840
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0010494 [CC]	cytoplasmic stress granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0043186 [CC]	P granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016442 [CC]	RNA-induced silencing complex	probable	GO:0032991, GO:0031332, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0006200 [BP]	ATP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0033592 [MF]	RNA strand annealing activity	probable	GO:0097159, GO:0003727, GO:0003725, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0005488
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0033962 [BP]	cytoplasmic mRNA processing body assembly	probable	GO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0071840, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0044699, GO:0044085
GO:0005777 [CC]	peroxisome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0033677 [MF]	DNA/RNA helicase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0004386
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010501 [BP]	RNA secondary structure unwinding	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0019843 [MF]	rRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0043590 [CC]	bacterial nucleoid	probable	GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005622, GO:0009295
GO:0003712 [MF]	transcription cofactor activity	probable	GO:0003674, GO:0000989, GO:0000988
GO:0005840 [CC]	ribosome	probable	GO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0010467 [BP]	gene expression	probable	GO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0006401 [BP]	RNA catabolic process	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0034459 [MF]	ATP-dependent 3'-5' RNA helicase activity	probable	GO:0016787, GO:0016818, GO:0016817, GO:0008026, GO:0042623, GO:0034458, GO:0017111, GO:0004004, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462, GO:0003824
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.6.-.-	Acting on acid anhydrides.	probable
3.6.4.-	Acting on acid anhydrides; involved in cellular and subcellular movement.	probable
3.6.4.13	RNA helicase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WP9, chain A
Confidence level:very confident
Coverage over the Query: 23-65,96-378
View the alignment between query and template
View the model in PyMOL

Template: 3FE2, chain A
Confidence level:very confident
Coverage over the Query: 1-69,93-235
View the alignment between query and template
View the model in PyMOL

Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 1-72,83-390
View the alignment between query and template
View the model in PyMOL

Template: 3SQX, chain A
Confidence level:confident
Coverage over the Query: 8-75,100-408
View the alignment between query and template
View the model in PyMOL