Diaphorina citri psyllid: psy9412

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MNENVKNNISITLTEVAIKKVSHLIKKKGNLNLKLRVFIQGGGCSGFQYGFMFDEHTNKDDIIFKKNGIQLLIDSVSYQYLIGSEIDYKDDLDGSKFVIKNPNAVTTCGCGSSFSTYK
ccccccccccEEEcHHHHHHHHHHHHHHccccccEEEEEEcccccccccccEEccccccccEEEEEccEEEEEEccccccccccEEEccccccccccEEccccccccccccccccccc
*******NISITLTEVAIKKVSHLIKKKGNLNLKLRVFIQGGGCSGFQYGFMFDEHTNKDDIIFKKNGIQLLIDSVSYQYLIGSEIDYKDDLDGSKFVIKNPNAVTTCGCGSSFS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNENVKNNISITLTEVAIKKVSHLIKKKGNLNLKLRVFIQGGGCSGFQYGFMFDEHTNKDDIIFKKNGIQLLIDSVSYQYLIGSEIDYKDDLDGSKFVIKNPNAVTTCGCGSSFSTYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative iron--sulfur cluster insertion protein ErpA Required for insertion of 4Fe-4S clusters.very confidentA9AH79
Putative iron-sulfur cluster insertion protein ErpA Required for insertion of 4Fe-4S clusters.very confidentQ62HB8
Putative iron-sulfur cluster insertion protein ErpA Required for insertion of 4Fe-4S clusters.very confidentQ7NRT6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingconfidentGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0008198 [MF]ferrous iron bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0051604 [BP]protein maturationprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016226 [BP]iron-sulfur cluster assemblyprobableGO:0022607, GO:0009058, GO:0016043, GO:0031163, GO:0044085, GO:0008150, GO:0008152, GO:0071840
GO:0005198 [MF]structural molecule activityprobableGO:0003674
GO:0009061 [BP]anaerobic respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0009060 [BP]aerobic respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2APN, chain A
Confidence level:very confident
Coverage over the Query: 7-116
View the alignment between query and template
View the model in PyMOL