Diaphorina citri psyllid: psy9416


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MSSAAIKTVLFVCGSYNPPTNMHLRMFELARDHLFKLGHTVCGGIMSPVHDKYGKKDLVSSKHRCEMVRLALEDSTWIKLSEWEAQQSEWTRTRVSLDHHEDELNQQLDAQCTNKTDVKRARHDQHNGSPRRKIQVMFLCGVDVLESMAVPNLWSADDINHIAGHHGIVVITRGDTNPAKFIYQHDILSKHMNKIIIVNEWIKNEISSTYLRRALRRGDSIKYLINDKVEQYIYQHGLYSVVESPHLEVSPILDLLSNLNNNFLPNGSPETHVNAPRDTCAQPASMHAHSKQQRALSRSNSSRGTLKSKSKVRATASGDKYDRVEFVIQDGVINVISDKEAQVW
cccccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHHHHHcccccEEEEHHHHcccccEEHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHHcccEEEEEcccccHHHHHHcHHHHHHccccEEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEEEcccEEEEcccccccc
****AIKTVLFVCGSYNPPTNMHLRMFELARDHLFKLGHTVCGGIMSPVHDKYGKKDLVSSKHRCEMVRLALEDSTWIKLSEWEAQQSEWTRTRVSLDHHEDELNQQLDA*******************PRRKIQVMFLCGVDVLESMAVPNLWSADDINHIAGHHGIVVITRGDTNPAKFIYQHDILSKHMNKIIIVNEWIKNEISSTYLRRALRRGDSIKYLINDKVEQYIYQHGLYSVVESPHLEVSPILDLLSNLNNNF*********************************************************YDRVEFVIQDGVINVISDK*AQVW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSAAIKTVLFVCGSYNPPTNMHLRMFELARDHLFKLGHTVCGGIMSPVHDKYGKKDLVSSKHRCEMVRLALEDSTWIKLSEWEAQQSEWTRTRVSLDHHEDELNQQLDAQCTNKTDVKRARHDQHNGSPRRKIQVMFLCGVDVLESMAVPNLWSADDINHIAGHHGIVVITRGDTNPAKFIYQHDILSKHMNKIIIVNEWIKNEISSTYLRRALRRGDSIKYLINDKVEQYIYQHGLYSVVESPHLEVSPILDLLSNLNNNFLPNGSPETHVNAPRDTCAQPASMHAHSKQQRALSRSNSSRGTLKSKSKVRATASGDKYDRVEFVIQDGVINVISDKEAQVW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nicotinamide mononucleotide adenylyltransferase 1 Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, prefers NAD(+) and NAAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Protects against axonal degeneration following mechanical or toxic insults.confidentQ9HAN9
Putative nicotinamide-nucleotide adenylyltransferase C806.06c confidentQ9UT53
Nicotinamide mononucleotide adenylyltransferase 1 Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, prefers NAD(+) and NAAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Protects against axonal degeneration following mechanical or toxic insults.confidentQ0VD50

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000309 [MF]nicotinamide-nucleotide adenylyltransferase activityprobableGO:0016779, GO:0016772, GO:0070566, GO:0003824, GO:0016740, GO:0003674
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004515 [MF]nicotinate-nucleotide adenylyltransferase activityprobableGO:0016779, GO:0016772, GO:0070566, GO:0003824, GO:0016740, GO:0003674
GO:0009435 [BP]NAD biosynthetic processprobableGO:0019674, GO:0006732, GO:0006733, GO:0044249, GO:0034641, GO:0009165, GO:0009108, GO:0046496, GO:1901362, GO:0072525, GO:1901360, GO:1901576, GO:0044710, GO:0051186, GO:0072524, GO:0051188, GO:0008150, GO:0071704, GO:0019359, GO:0044281, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006796, GO:0006807, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753, GO:0019363, GO:0019362

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KQN, chain A
Confidence level:very confident
Coverage over the Query: 5-106,132-245
View the alignment between query and template
View the model in PyMOL