BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9422
         (211 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZKR|LL Chain l, Structure Of A Mammalian Ribosomal 60s Subunit Within An
           80s Complex Obtained By Docking Homology Models Of The
           Rna And Proteins Into An 8.7 A Cryo-Em Map
          Length = 148

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/49 (75%), Positives = 45/49 (91%), Gaps = 2/49 (4%)

Query: 165 LVDI--AGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           ++D+  +GYYKVLGKG++PKQPVIVKAKFFS+ AEEKIK+VGGACVL A
Sbjct: 100 IIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA 148


>pdb|4A17|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With
           Initiation Factor 6. This File Contains 5s Rrna, 5.8s
           Rrna And Proteins Of Molecule 2.
 pdb|4A1A|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With
           Initiation Factor 6. This File Contains 5s Rrna, 5.8s
           Rrna And Proteins Of Molecule 3.
 pdb|4A1C|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With
           Initiation Factor 6. This File Contains 5s Rrna, 5.8s
           Rrna And Proteins Of Molecule 4.
 pdb|4A1E|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With
           Initiation Factor 6. This File Contains 5s Rrna, 5.8s
           Rrna And Proteins Of Molecule 1
          Length = 149

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (87%), Gaps = 2/49 (4%)

Query: 165 LVDI--AGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           ++D+  AG++KVLGKGR+P QPV+VKAK+FSK AE +I AVGGACVLTA
Sbjct: 101 VIDVTKAGFFKVLGKGRLPNQPVVVKAKYFSKTAERRIVAVGGACVLTA 149


>pdb|3O58|Y Chain Y, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit
           Of The First 80s In The Asymmetric Unit.
 pdb|3O5H|Y Chain Y, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit
           Of The Second 80s In The Asymmetric Unit
          Length = 149

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%)

Query: 162 TSLLVDI--AGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           T+ ++D   AGY K+LGKGRIP  PVIVKA+F SKLAEEKI+A GG   L A
Sbjct: 98  TAPVIDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA 149


>pdb|3IZS|O Chain O, Localization Of The Large Subunit Ribosomal Proteins Into
           A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae
           Translating 80s Ribosome
 pdb|3U5E|AA Chain a, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 60s
           Subunit, Ribosome A
 pdb|3U5I|AA Chain a, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 60s
           Subunit, Ribosome B
 pdb|4B6A|AA Chain a, Cryo-Em Structure Of The 60s Ribosomal Subunit In Complex
           With Arx1 And Rei1
          Length = 149

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%)

Query: 162 TSLLVDI--AGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           T+ ++D   AGY K+LGKGRIP  PVIVKA+F SKLAEEKI+A GG   L A
Sbjct: 98  TAPVIDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA 149


>pdb|1S1I|V Chain V, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From
           Yeast Obtained By Docking Atomic Models For Rna And
           Protein Components Into A 11.7 A Cryo-Em Map. This File,
           1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is
           In File 1s1h
          Length = 148

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%)

Query: 162 TSLLVDI--AGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           T+ ++D   AGY K+LGKGRIP  PVIVKA+F SKLAEEKI+A GG   L A
Sbjct: 97  TAPVIDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA 148


>pdb|3JYW|V Chain V, Structure Of The 60s Proteins For Eukaryotic Ribosome
           Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome
           At 8.9a Resolution
          Length = 142

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)

Query: 162 TSLLVDI--AGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVL 209
           T+ ++D   AGY K+LGKGRIP  PVIVKA+F SKLAEEKI+A GG   L
Sbjct: 92  TAPVIDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVEL 141


>pdb|3IZR|O Chain O, Localization Of The Large Subunit Ribosomal Proteins Into
           A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
           Ribosome
          Length = 144

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 3/50 (6%)

Query: 165 LVDIA--GYYKVLGKGRIP-KQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           ++D+   GY KVLGKG +P ++P++VKAK  SK+AE+KIKA GGA +LTA
Sbjct: 95  VIDVTQFGYTKVLGKGMLPPERPIVVKAKLISKVAEKKIKAAGGAVLLTA 144


>pdb|3ZF7|BB Chain b, High-resolution Cryo-electron Microscopy Structure Of The
           Trypanosoma Brucei Ribosome
          Length = 145

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 3/53 (5%)

Query: 159 LALTSLLVDIAGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLTA 211
           L +  LL +  GY K+LG G + + P IVKA++ SKLA++KI+  GGA VL A
Sbjct: 96  LPVIDLLAN--GYSKLLGNGHL-QAPCIVKARWVSKLADKKIRKAGGAVVLQA 145


>pdb|3J21|L Chain L, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
           Revealed By Cryo-em: Implications For Evolution Of
           Eukaryotic Ribosomes (50s Ribosomal Proteins)
          Length = 147

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 10/67 (14%)

Query: 144 MNMGIVRSATGRQVLLALTSLLVDIAGYY-KVLGKGRIPKQPVIVKAKFFSKLAEEKIKA 202
           M MGI     G+        ++VD+  +  KVLG G++ + P+++KA+ FS  AEEKIKA
Sbjct: 89  MQMGIAYEEGGK--------IIVDVTQFADKVLGTGKLTR-PLVIKARAFSPKAEEKIKA 139

Query: 203 VGGACVL 209
            GG  VL
Sbjct: 140 AGGEAVL 146


>pdb|1S72|L Chain L, Refined Crystal Structure Of The Haloarcula Marismortui
           Large Ribosomal Subunit At 2.4 Angstrom Resolution
 pdb|1YHQ|L Chain L, Crystal Structure Of Azithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YI2|L Chain L, Crystal Structure Of Erythromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIJ|L Chain L, Crystal Structure Of Telithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIT|L Chain L, Crystal Structure Of Virginiamycin M And S Bound To The
           50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJ9|L Chain L, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
           Haloarcula Marismortui Containing A Three Residue
           Deletion In L22
 pdb|1YJN|L Chain L, Crystal Structure Of Clindamycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJW|L Chain L, Crystal Structure Of Quinupristin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ4|L Chain L, The Structure Of The Transition State Analogue "daa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ5|L Chain L, The Structure Of The Transition State Analogue "raa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ6|L Chain L, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ7|L Chain L, The Structure Of The Transition State Analogue "dca" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ8|L Chain L, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQ9|L Chain L, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQK|L Chain L, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
           The Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQL|L Chain L, The Structure Of The Transition State Analogue "dcsn"
           Bound To The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1VQM|L Chain L, The Structure Of The Transition State Analogue "dan" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQN|L Chain L, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQO|L Chain L, The Structure Of Ccpmn Bound To The Large Ribosomal
           Subunit Haloarcula Marismortui
 pdb|1VQP|L Chain L, The Structure Of The Transition State Analogue "rap" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2OTJ|L Chain L, 13-Deoxytedanolide Bound To The Large Subunit Of
           Haloarcula Marismortui
 pdb|2OTL|L Chain L, Girodazole Bound To The Large Subunit Of Haloarcula
           Marismortui
 pdb|2QA4|L Chain L, A More Complete Structure Of The The L7L12 STALK OF THE
           Haloarcula Marismortui 50s Large Ribosomal Subunit
 pdb|3CC2|L Chain L, The Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution With Rrna Sequence For The 23s Rrna And
           Genome-Derived Sequences For R-Proteins
 pdb|3CC4|L Chain L, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|3CC7|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2487u
 pdb|3CCE|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535a
 pdb|3CCJ|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2534u
 pdb|3CCL|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535c. Density For Anisomycin Is
           Visible But Not Included In Model.
 pdb|3CCM|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2611u
 pdb|3CCQ|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488u
 pdb|3CCR|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488c. Density For Anisomycin Is
           Visible But Not Included In The Model.
 pdb|3CCS|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482a
 pdb|3CCU|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482c
 pdb|3CCV|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2616a
 pdb|3CD6|L Chain L, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
           Cc-puromycin
 pdb|3CPW|K Chain K, The Structure Of The Antibiotic Linezolid Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CMA|L Chain L, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CME|L Chain L, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The Large
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2QEX|L Chain L, Negamycin Binds To The Wall Of The Nascent Chain Exit
           Tunnel Of The 50s Ribosomal Subunit
 pdb|3G4S|L Chain L, Co-Crystal Structure Of Tiamulin Bound To The Large
           Ribosomal Subunit
 pdb|3G6E|L Chain L, Co-Crystal Structure Of Homoharringtonine Bound To The
           Large Ribosomal Subunit
 pdb|3G71|L Chain L, Co-crystal Structure Of Bruceantin Bound To The Large
           Ribosomal Subunit
 pdb|3I55|L Chain L, Co-Crystal Structure Of Mycalamide A Bound To The Large
           Ribosomal Subunit
 pdb|3I56|L Chain L, Co-Crystal Structure Of Triacetyloleandomcyin Bound To The
           Large Ribosomal Subunit
 pdb|4ADX|L Chain L, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
           Subunit In Complex With Initiation Factor 6
          Length = 165

 Score = 35.8 bits (81), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 166 VDIAGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLT 210
            D A Y KVLG G++  +  ++ A  FS+ A EK++  GG+  LT
Sbjct: 101 ADDADYVKVLGAGQVRHELTLI-ADDFSEGAREKVEGAGGSVELT 144


>pdb|1FFK|J Chain J, Crystal Structure Of The Large Ribosomal Subunit From
           Haloarcula Marismortui At 2.4 Angstrom Resolution
 pdb|1GIY|O Chain O, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1giy, Contains The 50s Ribosome Subunit. The
           30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
           In The File 1gix
 pdb|1JJ2|K Chain K, Fully Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution
 pdb|1KQS|K Chain K, The Haloarcula Marismortui 50s Complexed With A
           Pretranslocational Intermediate In Protein Synthesis
 pdb|1K8A|M Chain M, Co-Crystal Structure Of Carbomycin A Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1K9M|M Chain M, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal
           Subunit Of Haloarcula Marismortui
 pdb|1KD1|M Chain M, Co-crystal Structure Of Spiramycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M1K|M Chain M, Co-Crystal Structure Of Azithromycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M90|M Chain M, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
           Sparsomycin Bound To The 50s Ribosomal Subunit
 pdb|1ML5|OO Chain o, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 pdb|1K73|M Chain M, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|1KC8|M Chain M, Co-Crystal Structure Of Blasticidin S Bound To The 50s
           Ribosomal Subunit
 pdb|1N8R|M Chain M, Structure Of Large Ribosomal Subunit In Complex With
           Virginiamycin M
 pdb|1NJI|M Chain M, Structure Of Chloramphenicol Bound To The 50s Ribosomal
           Subunit
 pdb|1Q7Y|M Chain M, Crystal Structure Of Ccdap-puromycin Bound At The Peptidyl
           Transferase Center Of The 50s Ribosomal Subunit
 pdb|1Q81|M Chain M, Crystal Structure Of Minihelix With 3' Puromycin Bound To
           A- Site Of The 50s Ribosomal Subunit.
 pdb|1Q82|M Chain M, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
           The 50s Ribosomal Subunit
 pdb|1Q86|M Chain M, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
           Simultaneously At Half Occupancy To Both The A-Site And
           P- Site Of The The 50s Ribosomal Subunit.
 pdb|1QVF|K Chain K, Structure Of A Deacylated Trna Minihelix Bound To The E
           Site Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1QVG|K Chain K, Structure Of Cca Oligonucleotide Bound To The Trna Binding
           Sites Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1W2B|K Chain K, Trigger Factor Ribosome Binding Domain In Complex With 50s
 pdb|1YL3|O Chain O, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 pdb|2B66|P Chain P, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 pdb|2B9N|P Chain P, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 pdb|2B9P|P Chain P, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 pdb|3CXC|K Chain K, The Structure Of An Enhanced Oxazolidinone Inhibitor Bound
           To The 50s Ribosomal Subunit Of H. Marismortui
          Length = 164

 Score = 35.8 bits (81), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 166 VDIAGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLT 210
            D A Y KVLG G++  +  ++ A  FS+ A EK++  GG+  LT
Sbjct: 100 ADDADYVKVLGAGQVRHELTLI-ADDFSEGAREKVEGAGGSVELT 143


>pdb|3OW2|K Chain K, Crystal Structure Of Enhanced Macrolide Bound To 50s
           Ribosomal Subunit
          Length = 150

 Score = 35.4 bits (80), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 166 VDIAGYYKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVLT 210
            D A Y KVLG G++  +  ++ A  FS+ A EK++  GG+  LT
Sbjct: 100 ADDADYVKVLGAGQVRHELTLI-ADDFSEGAREKVEGAGGSVELT 143


>pdb|2J01|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 pdb|2J03|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 pdb|2HGJ|O Chain O, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 pdb|2HGQ|O Chain O, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 pdb|2HGU|O Chain O, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr.
 pdb|1VSA|J Chain J, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
           Subunit Is In The File 2ow8
 pdb|2V47|P Chain P, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 pdb|2V49|P Chain P, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 pdb|1VSP|J Chain J, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 1vsp, Contains The 50s
           Ribosome Subunit. 30s Ribosome Subunit Is In The File
           2qnh
 pdb|3D5B|P Chain P, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 pdb|3D5D|P Chain P, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 pdb|3F1F|P Chain P, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes As Described In
           Remark 400.
 pdb|3F1H|P Chain P, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes As
           Described In Remark 400.
 pdb|2WDI|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 pdb|2WDJ|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WDL|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 pdb|2WDN|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 pdb|2WH2|P Chain P, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|2WH4|P Chain P, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|3HUX|P Chain P, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 pdb|3HUZ|P Chain P, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WRJ|P Chain P, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 2 Of 4).
 pdb|2WRL|P Chain P, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State. (Part 4 Of
           4).
 pdb|2WRO|P Chain P, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 2 Of 4).
 pdb|2WRR|P Chain P, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 4 Of 4).
 pdb|3KIR|P Chain P, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 pdb|3KIT|P Chain P, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 pdb|3KIW|P Chain P, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 pdb|3KIY|P Chain P, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 pdb|3KNI|P Chain P, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 pdb|3KNK|P Chain P, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 pdb|3KNM|P Chain P, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 pdb|3KNO|P Chain P, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 pdb|3I8F|O Chain O, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 pdb|3I8I|O Chain O, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 pdb|3I9C|O Chain O, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 pdb|3I9E|O Chain O, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 pdb|2X9S|P Chain P, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2X9U|P Chain P, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|3MRZ|L Chain L, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (50s) And 3ms1 (30s).
 pdb|3MS1|L Chain L, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 pdb|2XG0|P Chain P, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 pdb|2XG2|P Chain P, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 pdb|3OH5|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OH7|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OHJ|P Chain P, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHK|P Chain P, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHZ|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI1|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI3|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI5|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2XQE|P Chain P, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 pdb|2XTG|P Chain P, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 pdb|2XUX|P Chain P, Trna Translocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 pdb|2Y0V|P Chain P, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0X|P Chain P, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0Z|P Chain P, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y11|P Chain P, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|2Y13|P Chain P, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y15|P Chain P, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 pdb|2Y17|P Chain P, Ef-Tu Complex 3
 pdb|2Y19|P Chain P, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|3ZVP|P Chain P, Crystal Structure Of The Hybrid State Of Ribosome In
           Complex With The Guanosine Triphosphatase Release Factor
           3
 pdb|3UXQ|P Chain P, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UXR|P Chain P, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3TVE|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
 pdb|3TVH|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
 pdb|3UYE|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UYG|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UZ1|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin
 pdb|3UZ2|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin.
 pdb|3UZ8|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZ9|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZF|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex
 pdb|3UZH|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex.
 pdb|3UZK|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex With Paromomycin
 pdb|3UZN|O Chain O, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-cognate
           Trna-tyr Complex With Paromomycin
 pdb|4ABS|P Chain P, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin
           With The 70s Ribosome
 pdb|4DHA|P Chain P, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHC|P Chain P, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V23|P Chain P, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V25|P Chain P, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|3V27|P Chain P, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V29|P Chain P, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Entry Contains The 50s Subunit Of The 2nd Molecule In
           The Asu.
 pdb|3V2D|P Chain P, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V2F|P Chain P, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|4G5L|O Chain O, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5N|O Chain O, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule B.
 pdb|4G5U|O Chain O, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5W|O Chain O, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule B
          Length = 150

 Score = 31.2 bits (69), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 170 GY-YKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVL 209
           GY  K+LG+G    +P+ V A  FSK A EK+KA GG  VL
Sbjct: 109 GYRLKILGEGEA--KPLKVVAHAFSKSALEKLKAAGGEPVL 147


>pdb|3FIN|P Chain P, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 50s Subunit.
 pdb|3PYO|L Chain L, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYR|L Chain L, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome.
 pdb|3PYT|L Chain L, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYV|L Chain L, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The Second 70s Ribosome
          Length = 146

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 170 GY-YKVLGKGRIPKQPVIVKAKFFSKLAEEKIKAVGGACVL 209
           GY  K+LG+G    +P+ V A  FSK A EK+KA GG  VL
Sbjct: 105 GYRLKILGEGEA--KPLKVVAHAFSKSALEKLKAAGGEPVL 143


>pdb|3B21|A Chain A, Crystal Structure Of Ospi From Shigella Flexineri
          Length = 220

 Score = 30.0 bits (66), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 32 GP-GTPNFKDRRVLIQGTQNFKVHQNRTRQEHVKLCERLKSTPPGPADRKLWISMT 86
          GP G+P F    V +QGT  ++ H         KL E L S   G  D+   ++ T
Sbjct: 1  GPLGSPEFMINGVSLQGTAGYEAHTEEGNVNVKKLLESLNSKSLGDMDKDSELAAT 56


>pdb|2AQM|A Chain A, CuZN SUPEROXIDE DISMUTASE FROM BRUCELLA ABORTUS
          Length = 154

 Score = 27.3 bits (59), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 63  VKLCERLKSTPPGPADRKLWISMTANGKYFHVGKRSLFKGHHQFNIHQR 111
           VK+ E L  T PG     + IS    G +F V    L  G+H F++H+ 
Sbjct: 5   VKMYEAL-PTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHEN 52


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,826,738
Number of Sequences: 62578
Number of extensions: 208863
Number of successful extensions: 378
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 360
Number of HSP's gapped (non-prelim): 19
length of query: 211
length of database: 14,973,337
effective HSP length: 95
effective length of query: 116
effective length of database: 9,028,427
effective search space: 1047297532
effective search space used: 1047297532
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)