Query         psy9431
Match_columns 119
No_of_seqs    119 out of 478
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:11:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9431.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9431hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG5279 CYK3 Uncharacterized p  99.9 2.1E-26 4.5E-31  192.8   6.5   99    1-115   221-319 (521)
  2 smart00460 TGc Transglutaminas  99.5 5.1E-14 1.1E-18   88.0   6.0   50    2-53     19-68  (68)
  3 KOG4575|consensus               99.4 2.1E-14 4.6E-19  123.6   0.6  101    2-115   527-627 (874)
  4 PF01841 Transglut_core:  Trans  99.1 1.9E-10 4.1E-15   77.5   4.2   50    1-51     63-113 (113)
  5 COG1305 Transglutaminase-like   98.4 2.2E-07 4.7E-12   71.4   3.9   57    1-57    206-264 (319)
  6 KOG4575|consensus               98.0 1.1E-06 2.3E-11   76.8  -1.2  105    8-113   407-532 (874)
  7 PF04473 DUF553:  Transglutamin  96.9  0.0022 4.7E-08   47.2   5.3   42    2-54     88-129 (153)
  8 PF14381 EDR1:  Ethylene-respon  96.3  0.0072 1.6E-07   46.4   4.7   46    2-57    155-201 (204)
  9 PF00797 Acetyltransf_2:  N-ace  94.2    0.14   3E-06   38.9   5.6   51    2-56     59-109 (240)
 10 COG3012 Uncharacterized protei  92.4   0.088 1.9E-06   38.7   1.9   16   39-54    115-130 (151)
 11 PF14402 7TM_transglut:  7 tran  91.9    0.17 3.7E-06   41.3   3.2   48    2-56      6-53  (313)
 12 KOG0909|consensus               90.6   0.075 1.6E-06   45.3   0.0   39    1-55    232-272 (500)
 13 PF13471 Transglut_core3:  Tran  86.5    0.92   2E-05   31.0   3.2   34    2-46     68-101 (117)
 14 PF01473 CW_binding_1:  Putativ  85.6    0.79 1.7E-05   21.9   1.8   12   40-51      4-15  (19)
 15 PRK15047 N-hydroxyarylamine O-  85.5     2.9 6.3E-05   33.4   6.0   50    2-56     79-128 (281)
 16 PF15644 Tox-PL:  Papain fold t  70.6     4.6  0.0001   27.5   2.6   19   34-52     88-106 (111)
 17 PRK04233 hypothetical protein;  67.7     4.1 8.8E-05   29.2   1.9   14   38-51    115-128 (129)
 18 PF09027 GTPase_binding:  GTPas  67.0     2.2 4.8E-05   27.3   0.4   29   78-106    34-62  (66)
 19 cd06890 PX_Bem1p The phosphoin  55.5     3.8 8.2E-05   28.1  -0.1   38   45-100    15-52  (112)
 20 PF12893 Lumazine_bd_2:  Putati  53.6      16 0.00035   24.4   2.8   19   35-53     97-115 (116)
 21 PRK00183 hypothetical protein;  51.6     9.9 0.00021   28.1   1.6   16   38-53    115-130 (157)
 22 PRK01842 hypothetical protein;  48.4      11 0.00024   27.6   1.5   13   39-51    132-145 (149)
 23 PRK01617 hypothetical protein;  46.9      11 0.00025   27.6   1.3   15   39-53    117-131 (154)
 24 PF12419 DUF3670:  SNF2 Helicas  46.5      15 0.00032   26.2   1.8   20   36-55     96-115 (141)
 25 PF03835 Rad4:  Rad4 transgluta  45.1      37  0.0008   24.0   3.7   23   32-54     33-57  (145)
 26 PRK01752 hypothetical protein;  42.5      15 0.00032   27.1   1.3   15   39-53    117-131 (156)
 27 PRK02250 hypothetical protein;  41.7      16 0.00035   27.0   1.5   15   40-54    114-128 (166)
 28 PF12870 Lumazine_bd:  Lumazine  39.6      35 0.00077   21.7   2.7   15   35-49     97-111 (111)
 29 COG3549 HigB Plasmid maintenan  38.0      34 0.00074   23.4   2.4   17   34-50     61-77  (94)
 30 PF02099 Josephin:  Josephin;    37.8      54  0.0012   24.0   3.7   27   33-59    107-133 (157)
 31 COG1489 SfsA DNA-binding prote  37.3 1.1E+02  0.0023   24.3   5.4   49   10-58     27-87  (235)
 32 PF05015 Plasmid_killer:  Plasm  36.1      30 0.00065   22.8   2.0   14   36-49     63-76  (93)
 33 PF03749 SfsA:  Sugar fermentat  35.0      99  0.0021   23.8   4.9   27   32-58     50-77  (215)
 34 TIGR00230 sfsA sugar fermentat  32.4 1.6E+02  0.0034   23.0   5.7   27   32-58     63-89  (232)
 35 PRK09216 rplM 50S ribosomal pr  30.0      33 0.00072   25.0   1.5   13   42-54     11-23  (144)
 36 PF08272 Topo_Zn_Ribbon:  Topoi  29.1     7.1 0.00015   22.8  -1.8   16   33-48     24-39  (42)
 37 CHL00159 rpl13 ribosomal prote  28.9      36 0.00077   24.8   1.5   13   42-54     12-24  (143)
 38 COG0764 FabA 3-hydroxymyristoy  27.8      28 0.00061   25.3   0.8   19   84-102    38-57  (147)
 39 PF02982 Scytalone_dh:  Scytalo  27.1      69  0.0015   23.9   2.7   17   33-49    117-136 (160)
 40 PF13610 DDE_Tnp_IS240:  DDE do  26.8      52  0.0011   23.0   2.0   16   40-55     11-26  (140)
 41 PF03543 Peptidase_C58:  Yersin  24.8      77  0.0017   24.0   2.7   27   33-59    142-168 (204)
 42 PF00391 PEP-utilizers:  PEP-ut  24.6      24 0.00052   22.5  -0.0   13    1-13     47-59  (80)
 43 PF11447 DUF3201:  Protein of u  23.7      61  0.0013   23.8   1.9   11   40-50     37-47  (150)
 44 PF12883 DUF3828:  Protein of u  23.1 1.1E+02  0.0024   20.9   3.1   18   35-52    100-117 (120)
 45 PF09724 DUF2036:  Uncharacteri  22.1      42 0.00091   26.8   0.9   23   36-58    148-170 (325)
 46 PF15232 DUF4585:  Domain of un  21.8      77  0.0017   20.8   1.9   15   39-53      9-26  (75)
 47 PLN00205 ribisomal protein L13  21.7      53  0.0011   25.1   1.3   11   44-54     15-25  (191)
 48 PF09173 eIF2_C:  Initiation fa  21.7      64  0.0014   21.6   1.6   11   40-50     74-84  (88)
 49 PF04276 DUF443:  Protein of un  21.6      97  0.0021   23.3   2.7   14   38-51      5-18  (199)
 50 smart00785 AARP2CN AARP2CN (NU  21.2 1.1E+02  0.0023   20.0   2.5   17   10-26     45-61  (83)
 51 PF03736 EPTP:  EPTP domain;  I  21.1 1.5E+02  0.0033   16.5   2.9   22   32-53     12-33  (44)
 52 smart00849 Lactamase_B Metallo  20.3 1.5E+02  0.0033   20.1   3.4   24   33-56      4-27  (183)
 53 cd01287 FabA FabA, beta-hydrox  20.1      48   0.001   23.8   0.8   16   87-102    35-51  (150)

No 1  
>COG5279 CYK3 Uncharacterized protein involved in cytokinesis, contains TGc (transglutaminase/protease-like) domain [Cell division and chromosome partitioning]
Probab=99.93  E-value=2.1e-26  Score=192.81  Aligned_cols=99  Identities=22%  Similarity=0.456  Sum_probs=83.3

Q ss_pred             CcccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccCCCccccCCccccccccCCCCCCccccc
Q psy9431           1 MFESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPKVGAKGKSDSLRYEY   80 (119)
Q Consensus         1 ~lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Twgag~~~~~~~~p~~~~~~~~~~f~~~~   80 (119)
                      +||.++||+|++|.||+|+.-+ .+.++   ..|||||+|+||++||+||+|||++...+.+          ..+  ...
T Consensus       221 ~lcn~lgIp~~iIegf~k~~~~-~~~~~---~iNHaWN~VkiD~~yy~VDtTwgdPI~~d~~----------~~~--~~~  284 (521)
T COG5279         221 ELCNALGIPCEIIEGFLKSPIY-YTRDI---NINHAWNIVKIDNEYYLVDTTWGDPIHPDQN----------SKS--SKI  284 (521)
T ss_pred             HHHHhcCCceEEEeeccccccc-ccCCc---cccceeeEEEECCeEEEEeeecCCCCccccc----------ccc--ccc
Confidence            5999999999999999999832 23333   4799999999999999999999999765421          111  367


Q ss_pred             CccccccCchhchhhccCCCCCcccccCCCccccC
Q psy9431          81 DDHYFLTDPREFIYEFFPLQPEWRTHVYQASVLTT  115 (119)
Q Consensus        81 ~~~YFl~~P~~fi~tH~P~d~~wQll~~pis~~~~  115 (119)
                      +.+||++.|.++|.||+|..++||++.+|++.+++
T Consensus       285 n~~YF~lap~qMi~tH~p~k~~wq~~~~~~d~~~~  319 (521)
T COG5279         285 NHSYFLLAPNQMIATHVPEKDDWQFIKPDLDMPIV  319 (521)
T ss_pred             CchhccCChHHHhhhcCCCcchhhccCCchhhhhh
Confidence            89999999999999999999999999999997654


No 2  
>smart00460 TGc Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
Probab=99.50  E-value=5.1e-14  Score=87.97  Aligned_cols=50  Identities=24%  Similarity=0.434  Sum_probs=41.9

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccC
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNW   53 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Tw   53 (119)
                      |||++||+|++|.|+.++.+...+..  ....+|+|++|+++|+|+.+|+||
T Consensus        19 llr~~GIpar~v~g~~~~~~~~~~~~--~~~~~H~W~ev~~~~~W~~~D~~~   68 (68)
T smart00460       19 LLRSLGIPARVVSGYLKAPDTIGGLR--SIWEAHAWAEVYLEGGWVPVDPTP   68 (68)
T ss_pred             HHHHCCCCeEEEeeeecCCCCCcccc--cCCCcEEEEEEEECCCeEEEeCCC
Confidence            79999999999999999875433221  124799999999999999999998


No 3  
>KOG4575|consensus
Probab=99.43  E-value=2.1e-14  Score=123.64  Aligned_cols=101  Identities=22%  Similarity=0.187  Sum_probs=77.1

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccCCCccccCCccccccccCCCCCCcccccC
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPKVGAKGKSDSLRYEYD   81 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Twgag~~~~~~~~p~~~~~~~~~~f~~~~~   81 (119)
                      |...+||.|+||.||.|.+.... -.   .+.||+|+.|++|.+|++||+..++..   + .+++.    ...+.. ..+
T Consensus       527 ~~~sLdlwCEvi~gflK~P~~i~-~~---fkyNh~w~~~~~d~e~r~iD~s~~~s~---p-ih~~~----~~~s~~-~~~  593 (874)
T KOG4575|consen  527 RPLSLDLWCEVILGFLKIPFVIS-LF---FKYNHSWIDNKLDEETRYIDKSGAASI---P-IHLPP----KGDSLI-FHY  593 (874)
T ss_pred             hhhhcchhHHHHHhhhcCcccee-ee---eecchhhhhhhccceeEEEeecccccc---c-cccCc----CCcchh-ccc
Confidence            56789999999999999874321 11   246999999999999999999874431   1 23321    222322 335


Q ss_pred             ccccccCchhchhhccCCCCCcccccCCCccccC
Q psy9431          82 DHYFLTDPREFIYEFFPLQPEWRTHVYQASVLTT  115 (119)
Q Consensus        82 ~~YFl~~P~~fi~tH~P~d~~wQll~~pis~~~~  115 (119)
                      ++|||+.|+|.|+||+|++|..|++.+-|+.+..
T Consensus       594 n~yFlm~P~E~i~Th~penp~~qfImpsv~~~~~  627 (874)
T KOG4575|consen  594 NLYFLMSPEENIITHMPENPLKQFIMPSVTEDVC  627 (874)
T ss_pred             cceeecChhhheecCCCCchhhhhccccccchhe
Confidence            6899999999999999999999999999987653


No 4  
>PF01841 Transglut_core:  Transglutaminase-like superfamily;  InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i.e. which cross-link proteins through an acyl-transfer reaction between the gamma-carboxamide group of peptide-bound glutamine and the epsilon-amino group of peptide-bound lysine, resulting in a epsilon-(gamma-glutamyl)lysine isopeptide bond. Tranglutaminases have been found in a diverse range of species, from bacteria through to mammals. The enzymes require calcium binding and their activity leads to post-translational modification of proteins through acyl-transfer reactions, involving peptidyl glutamine residues as acyl donors and a variety of primary amines as acyl acceptors, with the generation of proteinase resistant isopeptide bonds [].  Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterised transglutaminase, the human blood clotting factor XIIIa' []. On the basis of the experimentally demonstrated activity of the Methanobacterium phage psiM2 pseudomurein endoisopeptidase [], it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease [].  A subunit of plasma Factor XIII revealed that each Factor XIIIA subunit is composed of four domains (termed N-terminal beta-sandwich, core domain (containing the catalytic and the regulatory sites), and C-terminal beta-barrels 1 and 2) and that two monomers assemble into the native dimer through the surfaces in domains 1 and 2, in opposite orientation. This organisation in four domains is highly conserved during evolution among transglutaminase isoforms [].; PDB: 2F4M_A 2F4O_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B ....
Probab=99.05  E-value=1.9e-10  Score=77.51  Aligned_cols=50  Identities=20%  Similarity=0.420  Sum_probs=36.3

Q ss_pred             CcccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEE-CCeEEEEec
Q psy9431           1 MFESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYV-AGAWRFVQC   51 (119)
Q Consensus         1 ~lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~l-dg~W~liD~   51 (119)
                      .|||++||+|++|.|+.++.+........ ....|+||+|++ +|+|+.+|+
T Consensus        63 allr~~Gipar~v~g~~~~~~~~~~~~~~-~~~~H~w~ev~~~~~~W~~~Dp  113 (113)
T PF01841_consen   63 ALLRALGIPARVVSGYVKGPDPDGDYSVD-GNDNHAWVEVYLPGGGWIPLDP  113 (113)
T ss_dssp             HHHHHHT--EEEEEEEEEECSSTTCTSTS-SEEEEEEEEEEETTTEEEEEET
T ss_pred             HHHhhCCCceEEEEEEcCCccccccccCC-CCCCEEEEEEEEcCCcEEEcCC
Confidence            38999999999999999975321111111 236899999999 899999996


No 5  
>COG1305 Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism]
Probab=98.43  E-value=2.2e-07  Score=71.42  Aligned_cols=57  Identities=19%  Similarity=0.312  Sum_probs=43.3

Q ss_pred             CcccccCCcEEEEEEEeCCCCCCCCCc-CCCCCCCceEEEEEECC-eEEEEeccCCCcc
Q psy9431           1 MFESYAGLHCVVIKGYSKSAGYQPGVK-FEDNRFRNSWNAVYVAG-AWRFVQCNWGARH   57 (119)
Q Consensus         1 ~lc~~aGi~~~~V~G~~k~~~~~pg~~-~~~~~~~HaWN~V~ldg-~W~liD~Twgag~   57 (119)
                      .|||++||+|++|+||.-+.....+.. .......|||.+|+++| .|+-+|+|-+...
T Consensus       206 al~Ra~GIpAR~V~Gy~~~~~~~~~~~~~~~~~~~Haw~ev~~~~~gW~~~Dpt~~~~~  264 (319)
T COG1305         206 ALLRAAGIPARYVSGYLGAEVEPLSGRPLVRNDDAHAWAEVYLPGRGWVPLDPTNGLLA  264 (319)
T ss_pred             HHHHHcCCcceeeeccccCCCCcccccccccCcccceeeeeecCCCccEeecCCCCCcc
Confidence            389999999999999987763222111 12234689999999999 5999999988753


No 6  
>KOG4575|consensus
Probab=97.95  E-value=1.1e-06  Score=76.75  Aligned_cols=105  Identities=57%  Similarity=1.030  Sum_probs=73.7

Q ss_pred             Cc--EEEEEEEe--CCCC-CCCCCc-CCCCC------CCceEEEEEECC----eEEEEeccCCCccccCCccccccccCC
Q psy9431           8 LH--CVVIKGYS--KSAG-YQPGVK-FEDNR------FRNSWNAVYVAG----AWRFVQCNWGARHLVNAKEVPKVGAKG   71 (119)
Q Consensus         8 i~--~~~V~G~~--k~~~-~~pg~~-~~~~~------~~HaWN~V~ldg----~W~liD~Twgag~~~~~~~~p~~~~~~   71 (119)
                      ++  |.++.|+.  +..| +.||+- +...+      ..-.||+|.+||    .|+++-++|+|+.+....+ .-|+.+.
T Consensus       407 lhvy~~v~~g~~ci~v~gd~~Pgq~sv~~~~~Nmnfsa~~tw~r~i~dgrvqvSw~~~q~n~~Ar~~~tal~-~~r~~~i  485 (874)
T KOG4575|consen  407 LHVYCVVIKGFSCIKVAGDYQPGQYSVDDHRFNMNFSARNTWNRVILDGRVQVSWRFVQCNWGARHLVTALD-GSREAKI  485 (874)
T ss_pred             ccchhhhhcccchhhhccCCCceeEeccccccccchhhhhchheeeecCcccccHHHHhhccCcchhhhHhh-hccceee
Confidence            55  77888877  5554 667622 32222      245899999999    8999999999995533211 0111111


Q ss_pred             CCCCcccccCccccccCc---hhchh--hccCCCCCcccccCCCccc
Q psy9431          72 KSDSLRYEYDDHYFLTDP---REFIY--EFFPLQPEWRTHVYQASVL  113 (119)
Q Consensus        72 ~~~~f~~~~~~~YFl~~P---~~fi~--tH~P~d~~wQll~~pis~~  113 (119)
                      .-...+...|+.||.+++   ++||+  .-+|.+-.|++.+.|.|+.
T Consensus       486 ~~~E~~~~tdd~~~~~e~rtse~~iyeg~~tP~e~awl~k~~~~sLd  532 (874)
T KOG4575|consen  486 DGNELRYETDDHYFMTESRTSEEFIYEGEFTPSEHAWLLKPRPLSLD  532 (874)
T ss_pred             eeeeeeEeeccccccccccchhhheeccccChhHHHHHhhhhhhhcc
Confidence            122234678999999999   89999  7889999999999999883


No 7  
>PF04473 DUF553:  Transglutaminase-like domain;  InterPro: IPR007562 This entry represents a transglutaminase-like domain found in a family of uncharacterised archaeal proteins that had previously been called DUF553 and UPF0252.
Probab=96.92  E-value=0.0022  Score=47.24  Aligned_cols=42  Identities=14%  Similarity=0.071  Sum_probs=30.6

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccCC
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWG   54 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Twg   54 (119)
                      |+-.+|+....|.+..-..          .. .|||++|+|||+||++|.+.-
T Consensus        88 lLl~~g~~~~yi~~~~~~~----------~~-~Haa~aV~ing~~yvlDq~~p  129 (153)
T PF04473_consen   88 LLLNMGYSPVYILHIEFDN----------DP-GHAAVAVKINGKYYVLDQHLP  129 (153)
T ss_pred             HHHHCCCCceEEEEEecCC----------CC-CeEEEEEEECCEEEEEeCCCC
Confidence            4556788777666655221          12 599999999999999998753


No 8  
>PF14381 EDR1:  Ethylene-responsive protein kinase Le-CTR1
Probab=96.30  E-value=0.0072  Score=46.40  Aligned_cols=46  Identities=17%  Similarity=0.164  Sum_probs=36.4

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEEC-CeEEEEeccCCCcc
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVA-GAWRFVQCNWGARH   57 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ld-g~W~liD~Twgag~   57 (119)
                      ||+..||+|++|.|.-....          ...||||.|+++ ++=|+||..-.=|.
T Consensus       155 LAD~iglpCrLvrG~~y~g~----------~~~~a~~~V~~~~~~eyiVDLm~~PG~  201 (204)
T PF14381_consen  155 LADRIGLPCRLVRGCYYCGW----------DDDDASNLVKFDDGREYIVDLMGAPGQ  201 (204)
T ss_pred             HHHhcCCCceEEeeccCCcc----------CCCCceEEEEcCCCcEEEEEcCCCCCC
Confidence            79999999999999754321          147999999997 67799998766554


No 9  
>PF00797 Acetyltransf_2:  N-acetyltransferase;  InterPro: IPR001447 Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30 kDa. It facilitates the transfer of an acetyl group from acetyl coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (Mycobacterium tuberculosis, Mycobacterium smegmatis etc) to Homo sapiens (Human). It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid. NAT catalyses the reaction:  Acetyl-coA + arylamine = coA + N-acetylarylamine   NAT is the target of a common genetic polymorphism of clinical relevance in humans. The N-acetylation polymorphism is determined by low or high NAT activity in liver. NAT has been implicated in the action and toxicity of amine-containing drugs, and in the susceptibility to cancer and systematic lupus erythematosus. Two highly similar human genes for NAT, termed NAT1 and NAT2, encode genetically invariant and variant NAT proteins, respectively. ; GO: 0016407 acetyltransferase activity, 0008152 metabolic process; PDB: 1W6F_A 1W5R_A 1GX3_D 2PQT_A 2IJA_A 1W4T_A 2BSZ_B 3D9W_B 3LTW_A 3LNB_A ....
Probab=94.18  E-value=0.14  Score=38.92  Aligned_cols=51  Identities=14%  Similarity=0.124  Sum_probs=38.8

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccCCCc
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGAR   56 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Twgag   56 (119)
                      +.+.+|.++..+.|-....+....  .  ....|.=+.|.+||+.|+||+.+|++
T Consensus        59 lL~~lGf~v~~~~arv~~~~~~~~--~--~~~~H~~liV~~~~~~ylvDvGfG~~  109 (240)
T PF00797_consen   59 LLRELGFDVTLVSARVYSPGGPDY--W--PPRTHLVLIVTLDGERYLVDVGFGGP  109 (240)
T ss_dssp             HHHHCT-EEEEEEEEEETTTTTCC--S--SSEEEEEEEEEETTEEEEE-SSSTTC
T ss_pred             HHHHCCCeEEEEEEEEEeCCCCCC--C--CCCceEEEEEEECCEEEEEeccCCCc
Confidence            457899999999998877632210  1  23589999999999999999999998


No 10 
>COG3012 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=92.41  E-value=0.088  Score=38.67  Aligned_cols=16  Identities=19%  Similarity=0.493  Sum_probs=14.4

Q ss_pred             EEEECCeEEEEeccCC
Q psy9431          39 AVYVAGAWRFVQCNWG   54 (119)
Q Consensus        39 ~V~ldg~W~liD~Twg   54 (119)
                      -|+|||+||+||.|-.
T Consensus       115 Fvk~ngrWyyiDgtv~  130 (151)
T COG3012         115 FVKINGRWYYIDGTVP  130 (151)
T ss_pred             heEECCEEEEECCCCC
Confidence            4899999999999876


No 11 
>PF14402 7TM_transglut:  7 transmembrane helices usually fused to an inactive transglutaminase
Probab=91.90  E-value=0.17  Score=41.26  Aligned_cols=48  Identities=21%  Similarity=0.470  Sum_probs=37.9

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccCCCc
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGAR   56 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Twgag   56 (119)
                      |++.+|||+++|.|.-=..+-    .   ...-+-|.+|+-+++|.++|+.=|..
T Consensus         6 lL~~a~Ipar~v~gl~Led~r----r---~q~l~~~lev~~~~~W~~f~p~tg~~   53 (313)
T PF14402_consen    6 LLAMAGIPARVVHGLKLEDGR----R---RQSLEPWLEVFNGGKWVLFNPRTGEQ   53 (313)
T ss_pred             HHHhCCCCccEeeeEEecCCc----c---ccCcHhHHheeeCCeEEEECCCCCCc
Confidence            678999999999997654321    1   13568999999999999999976664


No 12 
>KOG0909|consensus
Probab=90.65  E-value=0.075  Score=45.31  Aligned_cols=39  Identities=23%  Similarity=0.346  Sum_probs=32.3

Q ss_pred             CcccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEEC--CeEEEEeccCCC
Q psy9431           1 MFESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVA--GAWRFVQCNWGA   55 (119)
Q Consensus         1 ~lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ld--g~W~liD~Twga   55 (119)
                      .+|+++|+.+++|=-                ...|-|++|+.+  .+|..||++=+.
T Consensus       232 llcralg~daR~i~d----------------~tDHVWtEvYS~~qqRW~HvDpcE~v  272 (500)
T KOG0909|consen  232 LLCRALGLDARYIWD----------------RTDHVWTEVYSNAQQRWVHVDPCENV  272 (500)
T ss_pred             HHHHHcCCcceEEee----------------cCcchhHHhhhhhhheeEeecccccc
Confidence            379999999999832                247999999998  689999997554


No 13 
>PF13471 Transglut_core3:  Transglutaminase-like superfamily
Probab=86.47  E-value=0.92  Score=31.03  Aligned_cols=34  Identities=18%  Similarity=0.381  Sum_probs=27.0

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeE
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAW   46 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W   46 (119)
                      |++..||++.++.|..|..+     ++    ..|||-+  .||+=
T Consensus        68 ~L~~~gi~~~l~iGv~~~~~-----~~----~aHAWve--~~g~~  101 (117)
T PF13471_consen   68 LLRRRGIPATLVIGVRKDDD-----PF----AAHAWVE--CGGRV  101 (117)
T ss_pred             HHHhcCCCcEEEEEEeeCCC-----Cc----eEEEEEE--ECCEE
Confidence            67888999999999999863     33    4899987  56553


No 14 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=85.57  E-value=0.79  Score=21.87  Aligned_cols=12  Identities=25%  Similarity=0.650  Sum_probs=9.8

Q ss_pred             EEECCeEEEEec
Q psy9431          40 VYVAGAWRFVQC   51 (119)
Q Consensus        40 V~ldg~W~liD~   51 (119)
                      |+++|+||.+|.
T Consensus         4 ~~~~~~wYy~~~   15 (19)
T PF01473_consen    4 VQDNGNWYYFDS   15 (19)
T ss_dssp             EEETTEEEEETT
T ss_pred             EEECCEEEEeCC
Confidence            567899999975


No 15 
>PRK15047 N-hydroxyarylamine O-acetyltransferase; Provisional
Probab=85.47  E-value=2.9  Score=33.39  Aligned_cols=50  Identities=12%  Similarity=0.127  Sum_probs=37.9

Q ss_pred             cccccCCcEEEEEEEeCCCCCCCCCcCCCCCCCceEEEEEECCeEEEEeccCCCc
Q psy9431           2 FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGAR   56 (119)
Q Consensus         2 lc~~aGi~~~~V~G~~k~~~~~pg~~~~~~~~~HaWN~V~ldg~W~liD~Twgag   56 (119)
                      +.+++|..+..+.|-....+. ++  .  ....|.=+.|.|||+-||+|+-.|+.
T Consensus        79 ~L~~LGF~v~~~~arV~~~~~-~~--~--~~~tH~~l~V~i~~~~yLvDVGFG~~  128 (281)
T PRK15047         79 VLRELGFNVRSLLGRVVLSNP-PA--L--PPRTHRLLLVELEGEKWIADVGFGGQ  128 (281)
T ss_pred             HHHHcCCcEEEEEEEEEecCC-CC--C--CCcCcEEEEEEECCeeEEEEecCCCC
Confidence            457889999998888764311 11  1  12489999999999999999999964


No 16 
>PF15644 Tox-PL:  Papain fold toxin 1; PDB: 3B21_A.
Probab=70.60  E-value=4.6  Score=27.46  Aligned_cols=19  Identities=21%  Similarity=0.330  Sum_probs=16.0

Q ss_pred             CceEEEEEECCeEEEEecc
Q psy9431          34 RNSWNAVYVAGAWRFVQCN   52 (119)
Q Consensus        34 ~HaWN~V~ldg~W~liD~T   52 (119)
                      .|+||+|.-+|+=.++|+=
T Consensus        88 gHa~nvv~~~G~i~~~D~Q  106 (111)
T PF15644_consen   88 GHAFNVVNQNGKIVFLDPQ  106 (111)
T ss_dssp             TTEEEEEEE-SSEEEEBTT
T ss_pred             ceEEEEEeCCCeEEEEeCC
Confidence            7999999999998888863


No 17 
>PRK04233 hypothetical protein; Provisional
Probab=67.69  E-value=4.1  Score=29.17  Aligned_cols=14  Identities=21%  Similarity=0.574  Sum_probs=11.4

Q ss_pred             EEEEECCeEEEEec
Q psy9431          38 NAVYVAGAWRFVQC   51 (119)
Q Consensus        38 N~V~ldg~W~liD~   51 (119)
                      .=|+.||+|+++|.
T Consensus       115 ~F~r~~g~W~YvDg  128 (129)
T PRK04233        115 RFVREDGRWYYLDA  128 (129)
T ss_pred             eEEEECCEEEEecC
Confidence            34778999999984


No 18 
>PF09027 GTPase_binding:  GTPase binding;  InterPro: IPR015116 The GTPase binding domain binds to the G protein Cdc42, inhibiting both its intrinsic and stimulated GTPase activity. The domain is largely unstructured in the absence of Cdc42 []. ; PDB: 1CF4_B.
Probab=66.99  E-value=2.2  Score=27.33  Aligned_cols=29  Identities=21%  Similarity=0.351  Sum_probs=2.7

Q ss_pred             cccCccccccCchhchhhccCCCCCcccc
Q psy9431          78 YEYDDHYFLTDPREFIYEFFPLQPEWRTH  106 (119)
Q Consensus        78 ~~~~~~YFl~~P~~fi~tH~P~d~~wQll  106 (119)
                      .++++.||.++|-.+++.......-.|++
T Consensus        34 ~~idn~yl~mdp~~~~~~~~s~a~p~~~~   62 (66)
T PF09027_consen   34 SEIDNNYLNMDPIDMAYNLNSTARPQQHL   62 (66)
T ss_dssp             ----TTT----------------------
T ss_pred             hhhhhhhhcccccchhhcccccccccccc
Confidence            36688899999999998865544334544


No 19 
>cd06890 PX_Bem1p The phosphoinositide binding Phox Homology domain of Bem1p. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions such as cell signaling, vesicular trafficking, protein sorting, and lipid modification, among others. Members of this subfamily bear similarity to Saccharomyces cerevisiae Bem1p, containing two Src Homology 3 (SH3) domains at the N-terminus, a central PX domain, and a C-terminal PB1 domain. Bem1p is a scaffolding protein that is critical for proper Cdc42p activation during bud formation in yeast. During budding and mating, Bem1p migrates to the plasma membrane where it can serve as an adaptor for Cdc42p and some other proteins. Bem1p also functions as an effector of the G1 cyclin Cln3p and the cyclin-dependent kinase Cdc28p in promoting vacuolar fusion. The PX domain is involved in targeting of proteins to PI-enriched membranes, and may also be involved in protein-protein interaction. The PX domain of Bem1p 
Probab=55.49  E-value=3.8  Score=28.12  Aligned_cols=38  Identities=24%  Similarity=0.384  Sum_probs=23.0

Q ss_pred             eEEEEeccCCCccccCCccccccccCCCCCCcccccCccccccCchhchhhccCCC
Q psy9431          45 AWRFVQCNWGARHLVNAKEVPKVGAKGKSDSLRYEYDDHYFLTDPREFIYEFFPLQ  100 (119)
Q Consensus        45 ~W~liD~Twgag~~~~~~~~p~~~~~~~~~~f~~~~~~~YFl~~P~~fi~tH~P~d  100 (119)
                      -||.|+++|.+|..               -...+.|.+||=|-.   =+...||.+
T Consensus        15 y~Y~i~v~~s~~~~---------------~~v~RrY~dFy~Lh~---~L~~~fp~e   52 (112)
T cd06890          15 YWYRVRATLSDGKT---------------RYLCRYYQDFYKLHI---ALLDLFPAE   52 (112)
T ss_pred             EEEEEEEEEcCCcE---------------EEEEEEHHHHHHHHH---HHHHhCcHh
Confidence            39999999988631               122356777765522   244555543


No 20 
>PF12893 Lumazine_bd_2:  Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C.
Probab=53.56  E-value=16  Score=24.43  Aligned_cols=19  Identities=21%  Similarity=0.560  Sum_probs=15.6

Q ss_pred             ceEEEEEECCeEEEEeccC
Q psy9431          35 NSWNAVYVAGAWRFVQCNW   53 (119)
Q Consensus        35 HaWN~V~ldg~W~liD~Tw   53 (119)
                      -....+++||+|.+|.-.|
T Consensus        97 d~~~L~K~dg~WkIv~k~~  115 (116)
T PF12893_consen   97 DYFTLVKTDGGWKIVSKVY  115 (116)
T ss_dssp             EEEEEEEETTEEEEEEEEE
T ss_pred             EEEEEEEECCEEEEEEEec
Confidence            4577899999999998765


No 21 
>PRK00183 hypothetical protein; Provisional
Probab=51.59  E-value=9.9  Score=28.09  Aligned_cols=16  Identities=25%  Similarity=0.440  Sum_probs=12.5

Q ss_pred             EEEEECCeEEEEeccC
Q psy9431          38 NAVYVAGAWRFVQCNW   53 (119)
Q Consensus        38 N~V~ldg~W~liD~Tw   53 (119)
                      +-|+.||+||.||..-
T Consensus       115 ~F~r~~g~W~YvDG~~  130 (157)
T PRK00183        115 AFVQHQGRWYFIDPTV  130 (157)
T ss_pred             eeeEeCCEEEeccccC
Confidence            3477899999999533


No 22 
>PRK01842 hypothetical protein; Provisional
Probab=48.42  E-value=11  Score=27.62  Aligned_cols=13  Identities=38%  Similarity=0.731  Sum_probs=10.4

Q ss_pred             EEEE-CCeEEEEec
Q psy9431          39 AVYV-AGAWRFVQC   51 (119)
Q Consensus        39 ~V~l-dg~W~liD~   51 (119)
                      =|+. ||+||++|-
T Consensus       132 F~r~~~G~W~YvDG  145 (149)
T PRK01842        132 FVRDEQGRWRYVDG  145 (149)
T ss_pred             eEECCCCeEEEeCC
Confidence            3676 899999994


No 23 
>PRK01617 hypothetical protein; Provisional
Probab=46.95  E-value=11  Score=27.60  Aligned_cols=15  Identities=13%  Similarity=0.446  Sum_probs=12.1

Q ss_pred             EEEECCeEEEEeccC
Q psy9431          39 AVYVAGAWRFVQCNW   53 (119)
Q Consensus        39 ~V~ldg~W~liD~Tw   53 (119)
                      =|+.||+|+++|..-
T Consensus       117 F~r~~g~W~Yvdg~~  131 (154)
T PRK01617        117 FLKENGQWYYIDGTR  131 (154)
T ss_pred             eEEeCCCEEecCCCC
Confidence            378899999999643


No 24 
>PF12419 DUF3670:  SNF2 Helicase protein ;  InterPro: IPR022138  This domain family is found in bacteria, archaea and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF00271 from PFAM, PF00176 from PFAM. Most of the proteins in this family are annotated as SNF2 helicases but there is little accompanying literature to confirm this. 
Probab=46.46  E-value=15  Score=26.18  Aligned_cols=20  Identities=15%  Similarity=0.053  Sum_probs=15.4

Q ss_pred             eEEEEEECCeEEEEeccCCC
Q psy9431          36 SWNAVYVAGAWRFVQCNWGA   55 (119)
Q Consensus        36 aWN~V~ldg~W~liD~Twga   55 (119)
                      .--.|++.|+|..+|+---.
T Consensus        96 ~~~LV~~rg~WV~ld~~~l~  115 (141)
T PF12419_consen   96 KRPLVRFRGRWVELDPEELR  115 (141)
T ss_pred             CCCeEEECCEEEEECHHHHH
Confidence            34469999999999985533


No 25 
>PF03835 Rad4:  Rad4 transglutaminase-like domain;  InterPro: IPR018325 RAD4/Xp-C proteins contain an ancient transglutaminase fold that is also found in peptide-N-glycanases (PNGases), which remove glycans from glycoproteins during their degradation. The PNGases retain the catalytic triad that is typical of this fold and are predicted to have a reaction mechanism similar to that involved in transglutamination. In contrast, the RAD4/Xp-C proteins are predicted to be inactive and are likely to only possess the interaction function in DNA repair []. ; GO: 0003684 damaged DNA binding, 0006289 nucleotide-excision repair, 0005634 nucleus; PDB: 2QSG_A 2QSF_A 2QSH_A 1X3W_A 1X3Z_A 3ESW_A.
Probab=45.07  E-value=37  Score=24.03  Aligned_cols=23  Identities=30%  Similarity=0.577  Sum_probs=20.4

Q ss_pred             CCCceEEEEEEC--CeEEEEeccCC
Q psy9431          32 RFRNSWNAVYVA--GAWRFVQCNWG   54 (119)
Q Consensus        32 ~~~HaWN~V~ld--g~W~liD~Twg   54 (119)
                      ...|-|.+|+..  .+|.-||+.=+
T Consensus        33 ~~~~~W~EV~~~~~~rWI~VDp~~~   57 (145)
T PF03835_consen   33 PYPNFWVEVYSPEEKRWIHVDPVVG   57 (145)
T ss_dssp             TTTCEEEEEEETTTTEEEEEETTTS
T ss_pred             CCCeEEEEEEecCCCeEEEeeeecc
Confidence            368999999996  89999999987


No 26 
>PRK01752 hypothetical protein; Provisional
Probab=42.50  E-value=15  Score=27.14  Aligned_cols=15  Identities=27%  Similarity=0.448  Sum_probs=12.3

Q ss_pred             EEEECCeEEEEeccC
Q psy9431          39 AVYVAGAWRFVQCNW   53 (119)
Q Consensus        39 ~V~ldg~W~liD~Tw   53 (119)
                      -++.||+|+.+|-+-
T Consensus       117 F~r~~g~W~YvDG~~  131 (156)
T PRK01752        117 FVKIDNRWYFVDPTV  131 (156)
T ss_pred             heeccCCEEEecCCC
Confidence            467899999999655


No 27 
>PRK02250 hypothetical protein; Provisional
Probab=41.73  E-value=16  Score=27.01  Aligned_cols=15  Identities=13%  Similarity=0.554  Sum_probs=12.1

Q ss_pred             EEECCeEEEEeccCC
Q psy9431          40 VYVAGAWRFVQCNWG   54 (119)
Q Consensus        40 V~ldg~W~liD~Twg   54 (119)
                      ++.||+|+++|-...
T Consensus       114 ~r~~g~W~Yvdg~~~  128 (166)
T PRK02250        114 LKENGLWYYIDGTFP  128 (166)
T ss_pred             EeeCCEEEecCCCcC
Confidence            677999999996543


No 28 
>PF12870 Lumazine_bd:  Lumazine-binding domain;  InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria. Lumazine is a fluorescent accessory protein having 6,7-dimethyl-8-(1'-D-ribityl) lumazine (DMRL) as its authentic chromophore; it modulates the emission of bacterial luciferase to shorter wavelengths with increasing luminous strength.; PDB: 3K7C_C.
Probab=39.62  E-value=35  Score=21.67  Aligned_cols=15  Identities=20%  Similarity=0.357  Sum_probs=12.3

Q ss_pred             ceEEEEEECCeEEEE
Q psy9431          35 NSWNAVYVAGAWRFV   49 (119)
Q Consensus        35 HaWN~V~ldg~W~li   49 (119)
                      -....|+.||+|++.
T Consensus        97 ~~~~lvk~dg~Wkv~  111 (111)
T PF12870_consen   97 FTVPLVKEDGKWKVC  111 (111)
T ss_dssp             EEEEEEEETTEEEE-
T ss_pred             EEEEEEEECCEEEeC
Confidence            478899999999974


No 29 
>COG3549 HigB Plasmid maintenance system killer protein [General function prediction only]
Probab=38.00  E-value=34  Score=23.35  Aligned_cols=17  Identities=18%  Similarity=0.444  Sum_probs=13.9

Q ss_pred             CceEEEEEECCeEEEEe
Q psy9431          34 RNSWNAVYVAGAWRFVQ   50 (119)
Q Consensus        34 ~HaWN~V~ldg~W~liD   50 (119)
                      .--|-.+.||++|+||=
T Consensus        61 ~~g~ySIrvN~QwrLiF   77 (94)
T COG3549          61 LKGLYSIRVNQQWRLIF   77 (94)
T ss_pred             ccCcEEEEECCEEEEEE
Confidence            34578899999999983


No 30 
>PF02099 Josephin:  Josephin;  InterPro: IPR006155 Human genes containing triplet repeats can markedly expand in length, leading to neuropsychiatric disease. Expansion of triplet repeats explains the phenomenon of anticipation, i.e. the increasing severity or earlier age of onset in successive generations in a pedigree []. A novel gene containing CAG repeats has been identified and mapped to chromosome 14q32.1, the genetic locus for Machado-Joseph disease (MJD). Normally, the gene contains 13-36 CAG repeats, but most clinically diagnosed patients and all affected members of a family with the clinical and pathological diagnosis of MJD show expansion of the repeat number, from 68-79 []. Similar abnormalities in related genes may give rise to diseases similar to MJD. MJD is a neurodegenerative disorder characterised by cerebellar ataxia, pyramidal and extra-pyramidal signs, peripheral nerve palsy, external ophtalmoplegia, facial and lingual fasciculation and bulging. The disease is autosomal dominant, with late onset of symptoms, generally after the fourth decade.; GO: 0008242 omega peptidase activity; PDB: 3O65_G 1YZB_A 2JRI_A 2DOS_A 2AGA_A.
Probab=37.81  E-value=54  Score=24.01  Aligned_cols=27  Identities=15%  Similarity=0.321  Sum_probs=22.0

Q ss_pred             CCceEEEEEECCeEEEEeccCCCcccc
Q psy9431          33 FRNSWNAVYVAGAWRFVQCNWGARHLV   59 (119)
Q Consensus        33 ~~HaWN~V~ldg~W~liD~Twgag~~~   59 (119)
                      ..|....=+|+|.||-+|....++.+.
T Consensus       107 ~~HWf~iRki~~~wyNLDS~l~~P~~i  133 (157)
T PF02099_consen  107 SRHWFAIRKIGGQWYNLDSKLKEPELI  133 (157)
T ss_dssp             TTEEEEEEEETTEEEEECTTTSS-EEE
T ss_pred             CcceEEEEeeCCeeEeccCCCCCCccc
Confidence            578888888999999999999887543


No 31 
>COG1489 SfsA DNA-binding protein, stimulates sugar fermentation [General function prediction only]
Probab=37.29  E-value=1.1e+02  Score=24.27  Aligned_cols=49  Identities=10%  Similarity=0.069  Sum_probs=34.2

Q ss_pred             EEEEEEEeCCCCCCCCCcCCC------------CCCCceEEEEEECCeEEEEeccCCCccc
Q psy9431          10 CVVIKGYSKSAGYQPGVKFED------------NRFRNSWNAVYVAGAWRFVQCNWGARHL   58 (119)
Q Consensus        10 ~~~V~G~~k~~~~~pg~~~~~------------~~~~HaWN~V~ldg~W~liD~Twgag~~   58 (119)
                      -++++.+....|-..|-..++            .+..|.|-.|+.++.|..||..+.+..+
T Consensus        27 G~~~~~H~~ntGrm~~l~~pG~~v~l~~sd~~~rK~~~~~~~~~~~~~~v~VnT~l~N~l~   87 (235)
T COG1489          27 GEEVTAHCPNTGRMTELLTPGNTVWLSRSDNPKRKYRYTLELVEADNTLVCVNTGLPNRLA   87 (235)
T ss_pred             CeEEEEEcCCCCccccccCCCCEEEEEEecCCCccceEEEEEEEcCCeEEEEeCCccHHHH
Confidence            345566665555444322222            2478999999999999999999988744


No 32 
>PF05015 Plasmid_killer:  Plasmid maintenance system killer protein;  InterPro: IPR007711 Several plasmids with proteic killer gene systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of those systems result in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.
Probab=36.06  E-value=30  Score=22.82  Aligned_cols=14  Identities=21%  Similarity=0.705  Sum_probs=11.3

Q ss_pred             eEEEEEECCeEEEE
Q psy9431          36 SWNAVYVAGAWRFV   49 (119)
Q Consensus        36 aWN~V~ldg~W~li   49 (119)
                      ---+|.|+|.|++|
T Consensus        63 g~~Si~i~~~~Rli   76 (93)
T PF05015_consen   63 GQWSIRINGNWRLI   76 (93)
T ss_pred             CcEEEEeCCCEEEE
Confidence            34579999999987


No 33 
>PF03749 SfsA:  Sugar fermentation stimulation protein;  InterPro: IPR005224 The sugar fermentation stimulation protein is a probable regulatory factor involved in maltose metabolism. It contains a putative DNA-binding domain, and was isolated as a gene which enabled Escherichia coli W3110 (strain MK2001) to use maltose [].
Probab=34.98  E-value=99  Score=23.79  Aligned_cols=27  Identities=19%  Similarity=0.302  Sum_probs=24.1

Q ss_pred             CCCceEEEEEEC-CeEEEEeccCCCccc
Q psy9431          32 RFRNSWNAVYVA-GAWRFVQCNWGARHL   58 (119)
Q Consensus        32 ~~~HaWN~V~ld-g~W~liD~Twgag~~   58 (119)
                      +..+.|-+|+.+ |.|..||+...+..+
T Consensus        50 Kt~y~l~av~~~~~~~V~int~~~N~lv   77 (215)
T PF03749_consen   50 KTKYTLEAVEKDNGVWVGINTQLPNRLV   77 (215)
T ss_pred             CCcEEEEEEEcCCCeEEEEccchHHHHH
Confidence            578999999999 999999999887655


No 34 
>TIGR00230 sfsA sugar fermentation stimulation protein. probable regulatory factor involved in maltose metabolism contains a putative DNA binding domain. Isolated as a gene which enabled E.coli strain MK2001 to use maltose.
Probab=32.35  E-value=1.6e+02  Score=23.00  Aligned_cols=27  Identities=26%  Similarity=0.641  Sum_probs=23.8

Q ss_pred             CCCceEEEEEECCeEEEEeccCCCccc
Q psy9431          32 RFRNSWNAVYVAGAWRFVQCNWGARHL   58 (119)
Q Consensus        32 ~~~HaWN~V~ldg~W~liD~Twgag~~   58 (119)
                      +..+.|-+|+.+|.|..||+...+..+
T Consensus        63 K~~y~l~~v~~~g~~V~int~~~N~l~   89 (232)
T TIGR00230        63 KLSYTWEAVQCDGGWVLVNTQLQNRLF   89 (232)
T ss_pred             CCCEEEEEEEECCeEEEEcCccHHHHH
Confidence            467999999999999999999987755


No 35 
>PRK09216 rplM 50S ribosomal protein L13; Reviewed
Probab=29.99  E-value=33  Score=24.96  Aligned_cols=13  Identities=15%  Similarity=0.381  Sum_probs=10.2

Q ss_pred             ECCeEEEEeccCC
Q psy9431          42 VAGAWRFVQCNWG   54 (119)
Q Consensus        42 ldg~W~liD~Twg   54 (119)
                      +..+|++|||+.-
T Consensus        11 ~~~~W~viDA~~~   23 (144)
T PRK09216         11 VERKWYVIDAEGK   23 (144)
T ss_pred             cCCCEEEEeCCCC
Confidence            3578999999763


No 36 
>PF08272 Topo_Zn_Ribbon:  Topoisomerase I zinc-ribbon-like ;  InterPro: IPR013263 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the C-terminal zinc-ribbon-like domain found in bacterial topoisomerase I (type IA) enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003918 DNA topoisomerase (ATP-hydrolyzing) activity, 0006265 DNA topological change, 0005694 chromosome; PDB: 1YUA_A.
Probab=29.15  E-value=7.1  Score=22.79  Aligned_cols=16  Identities=38%  Similarity=0.895  Sum_probs=11.9

Q ss_pred             CCceEEEEEECCeEEE
Q psy9431          33 FRNSWNAVYVAGAWRF   48 (119)
Q Consensus        33 ~~HaWN~V~ldg~W~l   48 (119)
                      -.-+|++.+.||+|+-
T Consensus        24 k~tgw~af~~~gkw~~   39 (42)
T PF08272_consen   24 KFTGWSAFYKDGKWRV   39 (42)
T ss_dssp             SEEEETCCCSSS-B-S
T ss_pred             cEeeeeEeccCCeEec
Confidence            3579999999999974


No 37 
>CHL00159 rpl13 ribosomal protein L13; Validated
Probab=28.86  E-value=36  Score=24.81  Aligned_cols=13  Identities=8%  Similarity=0.235  Sum_probs=10.1

Q ss_pred             ECCeEEEEeccCC
Q psy9431          42 VAGAWRFVQCNWG   54 (119)
Q Consensus        42 ldg~W~liD~Twg   54 (119)
                      +.-+|++|||+.-
T Consensus        12 ~~r~W~viDA~~~   24 (143)
T CHL00159         12 KNRKWYIIDAKDQ   24 (143)
T ss_pred             cCCCEEEEeCCCC
Confidence            3567999999764


No 38 
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism]
Probab=27.83  E-value=28  Score=25.27  Aligned_cols=19  Identities=21%  Similarity=0.219  Sum_probs=14.0

Q ss_pred             ccccCchhchhh-ccCCCCC
Q psy9431          84 YFLTDPREFIYE-FFPLQPE  102 (119)
Q Consensus        84 YFl~~P~~fi~t-H~P~d~~  102 (119)
                      |+++++++..++ |||.+|-
T Consensus        38 ~k~Vt~nepfF~gHFP~~Pi   57 (147)
T COG0764          38 IKNVTINEPFFTGHFPGDPI   57 (147)
T ss_pred             EEccCCCCCeeCCcCCCCCC
Confidence            677777765555 9999884


No 39 
>PF02982 Scytalone_dh:  Scytalone dehydratase;  InterPro: IPR004235 Scytalone dehydratase is a member of the group of enzymes involved in fungal melanin biosynthesis. It was first identified in a phytopathogenic fungus, Magnaporthe grisea (Rice blast fungus), which causes rice blast disease. Scytalone dehydratase is a molecular target of inhibitor design efforts aimed at protecting rice plants from fungal disease [, ].; GO: 0030411 scytalone dehydratase activity, 0006582 melanin metabolic process; PDB: 4STD_A 3STD_A 6STD_A 7STD_C 1STD_A 5STD_C 1IDP_B 2STD_A.
Probab=27.09  E-value=69  Score=23.91  Aligned_cols=17  Identities=29%  Similarity=0.610  Sum_probs=13.8

Q ss_pred             CCceEEE---EEECCeEEEE
Q psy9431          33 FRNSWNA---VYVAGAWRFV   49 (119)
Q Consensus        33 ~~HaWN~---V~ldg~W~li   49 (119)
                      ..|++|.   ++|||+|.+-
T Consensus       117 h~h~~~~h~Y~KvdG~WK~a  136 (160)
T PF02982_consen  117 HGHGTNTHWYRKVDGVWKFA  136 (160)
T ss_dssp             EEEEEEEEEEEEETTEEEEE
T ss_pred             ccceeEEEEEEEeCCEEEEe
Confidence            4689987   5799999984


No 40 
>PF13610 DDE_Tnp_IS240:  DDE domain
Probab=26.84  E-value=52  Score=22.95  Aligned_cols=16  Identities=19%  Similarity=0.565  Sum_probs=11.4

Q ss_pred             EEECCeEEEEeccCCC
Q psy9431          40 VYVAGAWRFVQCNWGA   55 (119)
Q Consensus        40 V~ldg~W~liD~Twga   55 (119)
                      |+|+|+|+.+-..-++
T Consensus        11 iki~G~~~yl~~aiD~   26 (140)
T PF13610_consen   11 IKIKGKWHYLWRAIDA   26 (140)
T ss_pred             EEECCEEEEEEEeecc
Confidence            8889998887444444


No 41 
>PF03543 Peptidase_C58:  Yersinia/Haemophilus virulence surface antigen;  InterPro: IPR022767 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases correspond to MEROPS peptidase family C58. Family C58 contains endopeptidases that also act as transamidases, attaching a lipid moiety to the newly exposed N terminus of the substrate. This entry includes protein YopT from Yersinia pestis involved in bacterial pathogenesis and Rhizobium sp. (strain NGR234) nodulation outer protein T (NopT).; GO: 0004197 cysteine-type endopeptidase activity; PDB: 1UKF_A.
Probab=24.77  E-value=77  Score=24.00  Aligned_cols=27  Identities=19%  Similarity=0.154  Sum_probs=23.4

Q ss_pred             CCceEEEEEECCeEEEEeccCCCcccc
Q psy9431          33 FRNSWNAVYVAGAWRFVQCNWGARHLV   59 (119)
Q Consensus        33 ~~HaWN~V~ldg~W~liD~Twgag~~~   59 (119)
                      .+||.-+..-+++|.++|+..|.-.+.
T Consensus       142 ~~Ha~a~~~~~~~~~fFDPN~Ge~~f~  168 (204)
T PF03543_consen  142 GGHAMAASVDGGKVTFFDPNYGEFSFP  168 (204)
T ss_dssp             EEEEEEEEEETTEEEEEETTTEEEEEE
T ss_pred             CCceEEEEEeCCEEEEECCCceEEEec
Confidence            589999998899999999999886553


No 42 
>PF00391 PEP-utilizers:  PEP-utilising enzyme, mobile domain;  InterPro: IPR008279 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ]. All these enzymes share the same catalytic mechanism: they bind PEP and transfer the phosphoryl group from it to a histidine residue. This domain is a "swivelling" beta/beta/alpha domain which is thought to be mobile in all proteins known to contain it []. It is often found associated with the pyruvate phosphate dikinase, PEP/pyruvate-binding domain (IPR002192 from INTERPRO) at its N terminus.; GO: 0016772 transferase activity, transferring phosphorus-containing groups, 0016310 phosphorylation; PDB: 2X0S_A 2OLS_A 2HRO_A 2E28_A 2WQD_A 3T05_D 3T0T_D 3T07_B 2DIK_A 2FM4_A ....
Probab=24.64  E-value=24  Score=22.46  Aligned_cols=13  Identities=15%  Similarity=0.289  Sum_probs=9.6

Q ss_pred             CcccccCCcEEEE
Q psy9431           1 MFESYAGLHCVVI   13 (119)
Q Consensus         1 ~lc~~aGi~~~~V   13 (119)
                      +|||..||||.+=
T Consensus        47 IlAr~~giP~ivg   59 (80)
T PF00391_consen   47 ILARELGIPAIVG   59 (80)
T ss_dssp             HHHHHTT-EEEES
T ss_pred             HHHHHcCCCEEEe
Confidence            4799999998763


No 43 
>PF11447 DUF3201:  Protein of unknown function (DUF3201);  InterPro: IPR024505 This archaeal family of proteins has no known function.; PDB: 1YB3_A.
Probab=23.69  E-value=61  Score=23.78  Aligned_cols=11  Identities=36%  Similarity=1.123  Sum_probs=8.5

Q ss_pred             EEECCeEEEEe
Q psy9431          40 VYVAGAWRFVQ   50 (119)
Q Consensus        40 V~ldg~W~liD   50 (119)
                      ++|||+|+.+-
T Consensus        37 i~lDgeW~em~   47 (150)
T PF11447_consen   37 IYLDGEWREMK   47 (150)
T ss_dssp             EEETTEEEE--
T ss_pred             EEecCeeeeec
Confidence            89999999864


No 44 
>PF12883 DUF3828:  Protein of unknown function (DUF3828);  InterPro: IPR024289 This domain currently has no known function.; PDB: 3KZT_A.
Probab=23.10  E-value=1.1e+02  Score=20.88  Aligned_cols=18  Identities=17%  Similarity=0.219  Sum_probs=15.7

Q ss_pred             ceEEEEEECCeEEEEecc
Q psy9431          35 NSWNAVYVAGAWRFVQCN   52 (119)
Q Consensus        35 HaWN~V~ldg~W~liD~T   52 (119)
                      =.+..|+.+|+|.+-|++
T Consensus       100 ~~~~l~ke~g~WkI~~V~  117 (120)
T PF12883_consen  100 VIVCLVKENGRWKIDDVR  117 (120)
T ss_dssp             EEEEEEEETTEEEEEEES
T ss_pred             EEEEEEEECCEEEEEEee
Confidence            378999999999998875


No 45 
>PF09724 DUF2036:  Uncharacterized conserved protein (DUF2036);  InterPro: IPR019128  Sister chromatid cohesion protein DCC1 is a component of the RFC-like complex CTF18-RFC. This complex is required for the efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC. The complex presumably provides bipartite ATP sites in which one subunit supplies a catalytic site for hydrolysis of ATP bound to the neighbouring subunit. Dissociation of RFC from the clamp leaves the clamp encircling DNA [, ].
Probab=22.08  E-value=42  Score=26.82  Aligned_cols=23  Identities=22%  Similarity=0.394  Sum_probs=18.6

Q ss_pred             eEEEEEECCeEEEEeccCCCccc
Q psy9431          36 SWNAVYVAGAWRFVQCNWGARHL   58 (119)
Q Consensus        36 aWN~V~ldg~W~liD~Twgag~~   58 (119)
                      .-+++.|||.||++|...-...+
T Consensus       148 ~l~~~ei~G~~r~Ls~~~~~~~L  170 (325)
T PF09724_consen  148 ELGACEIDGYWRLLSPSYLFEIL  170 (325)
T ss_pred             HCCEEEECCEEEECCHHHHHHHH
Confidence            45789999999999998766543


No 46 
>PF15232 DUF4585:  Domain of unknown function (DUF4585)
Probab=21.76  E-value=77  Score=20.77  Aligned_cols=15  Identities=20%  Similarity=0.253  Sum_probs=11.0

Q ss_pred             EEEEC---CeEEEEeccC
Q psy9431          39 AVYVA---GAWRFVQCNW   53 (119)
Q Consensus        39 ~V~ld---g~W~liD~Tw   53 (119)
                      .|.+|   |++|+||+--
T Consensus         9 KvL~DP~SG~Yy~vd~P~   26 (75)
T PF15232_consen    9 KVLQDPESGQYYVVDAPV   26 (75)
T ss_pred             cEeecCCCCCEEEEecCC
Confidence            35666   8899998755


No 47 
>PLN00205 ribisomal protein L13 family protein; Provisional
Probab=21.73  E-value=53  Score=25.14  Aligned_cols=11  Identities=18%  Similarity=0.344  Sum_probs=8.9

Q ss_pred             CeEEEEeccCC
Q psy9431          44 GAWRFVQCNWG   54 (119)
Q Consensus        44 g~W~liD~Twg   54 (119)
                      .+|++|||++-
T Consensus        15 r~W~VIDA~~~   25 (191)
T PLN00205         15 LRWRVFDAKGQ   25 (191)
T ss_pred             CcEEEEeCCCC
Confidence            47999998763


No 48 
>PF09173 eIF2_C:  Initiation factor eIF2 gamma, C terminal;  InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology. It is required for formation of the ternary complex with GTP and initiator tRNA []. ; PDB: 1S0U_A 1KK1_A 1KK0_A 1KK2_A 1KJZ_A 1KK3_A 2D74_A 2DCU_A 3P3M_A 3V11_A ....
Probab=21.72  E-value=64  Score=21.55  Aligned_cols=11  Identities=18%  Similarity=0.685  Sum_probs=8.8

Q ss_pred             EEECCeEEEEe
Q psy9431          40 VYVAGAWRFVQ   50 (119)
Q Consensus        40 V~ldg~W~liD   50 (119)
                      =+|+++|+||=
T Consensus        74 Rri~~rWRLIG   84 (88)
T PF09173_consen   74 RRIGNRWRLIG   84 (88)
T ss_dssp             EEETTSEEEEE
T ss_pred             hhccCeEEEEE
Confidence            36899999983


No 49 
>PF04276 DUF443:  Protein of unknown function (DUF443) ;  InterPro: IPR005915  The members of this family share 50 % or greater sequence identity. They are found as eleven tandem genes, arranged head-to-tail, in Staphylococcus aureus (strain COL). Distant full-length homologs are found in a Staphylococcus haemolyticus plasmid and in Bacillus halodurans. The function of these proteins is unknown.
Probab=21.59  E-value=97  Score=23.30  Aligned_cols=14  Identities=0%  Similarity=0.154  Sum_probs=12.6

Q ss_pred             EEEEECCeEEEEec
Q psy9431          38 NAVYVAGAWRFVQC   51 (119)
Q Consensus        38 N~V~ldg~W~liD~   51 (119)
                      ..++.||++|++|.
T Consensus         5 ~ii~~~~~yy~iD~   18 (199)
T PF04276_consen    5 KIIKYNNEYYMIDL   18 (199)
T ss_pred             EEEEECCEEEEEEc
Confidence            46899999999998


No 50 
>smart00785 AARP2CN AARP2CN (NUC121) domain. This domain is the central domain of AARP2. It is weakly similar to the GTP-binding domain of elongation factor TU PUBMED:15112237.
Probab=21.20  E-value=1.1e+02  Score=20.02  Aligned_cols=17  Identities=24%  Similarity=0.575  Sum_probs=12.9

Q ss_pred             EEEEEEEeCCCCCCCCC
Q psy9431          10 CVVIKGYSKSAGYQPGV   26 (119)
Q Consensus        10 ~~~V~G~~k~~~~~pg~   26 (119)
                      ...|.||.+|.+..+++
T Consensus        45 ~l~v~GyvRG~~l~~n~   61 (83)
T smart00785       45 TLVVYGYVRGTGLNANQ   61 (83)
T ss_pred             EEEEEEEEcCCCCCCCC
Confidence            47899999998655443


No 51 
>PF03736 EPTP:  EPTP domain;  InterPro: IPR005492 Mutations in the LGI/EPT gene can result in a special form of epilepsy, autosomal dominant lateral temporal epilepsy. The Epitempin protein (also known as Leucine-rich glioma-inactivated protein) was seen to contain a 130 amino acid repeat in its C-terminal section, although a sub-domain of 50 amino acids has now been further defined within this. The architecture and structural features of this repeat make it a likely member 7-bladed beta-propeller fold [].  This protein has now been found in a number of proteins associated with neurological disorders suggesting that it may play a role in the development of epilepsy and other related conditions [].
Probab=21.13  E-value=1.5e+02  Score=16.54  Aligned_cols=22  Identities=9%  Similarity=0.095  Sum_probs=17.8

Q ss_pred             CCCceEEEEEECCeEEEEeccC
Q psy9431          32 RFRNSWNAVYVAGAWRFVQCNW   53 (119)
Q Consensus        32 ~~~HaWN~V~ldg~W~liD~Tw   53 (119)
                      ...-+|-.+.|+|+.||+=+.-
T Consensus        12 ~~~~~~e~F~i~~~~fl~~a~~   33 (44)
T PF03736_consen   12 RGARDVEPFSIGGDQFLAVASF   33 (44)
T ss_pred             cceeEEEEEEECCEEEEEEEeC
Confidence            3567999999999999985543


No 52 
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily. Apart from the beta-lactamases a number of other proteins contain this domain PUBMED:7588620. These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.
Probab=20.31  E-value=1.5e+02  Score=20.08  Aligned_cols=24  Identities=13%  Similarity=-0.039  Sum_probs=18.5

Q ss_pred             CCceEEEEEECCeEEEEeccCCCc
Q psy9431          33 FRNSWNAVYVAGAWRFVQCNWGAR   56 (119)
Q Consensus        33 ~~HaWN~V~ldg~W~liD~Twgag   56 (119)
                      ..+.-..|..+|++.|||+-++..
T Consensus         4 ~~~~~~li~~~~~~iliD~g~~~~   27 (183)
T smart00849        4 VGVNSYLVEGDGGAILIDTGPGEA   27 (183)
T ss_pred             cceeEEEEEeCCceEEEeCCCChh
Confidence            356667788889999999886653


No 53 
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site. The FabA structure is a homodimer with two independent active sites located at the dimer interface.  Each active site is tunnel-shaped and completely inaccessible to solvent.  No metal ions or cofactors are required for ligand binding or catalysis.
Probab=20.06  E-value=48  Score=23.85  Aligned_cols=16  Identities=31%  Similarity=0.501  Sum_probs=10.7

Q ss_pred             cCchh-chhhccCCCCC
Q psy9431          87 TDPRE-FIYEFFPLQPE  102 (119)
Q Consensus        87 ~~P~~-fi~tH~P~d~~  102 (119)
                      +++++ |+.-|||.+|.
T Consensus        35 v~~~e~ff~gHFp~~pv   51 (150)
T cd01287          35 IDPDDWFFPCHFHGDPV   51 (150)
T ss_pred             cCCCCceEcCCCCCCCc
Confidence            33443 66779999873


Done!