Diaphorina citri psyllid: psy9434


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MKANQKNSDTVEPRLVDFDELLSEPRFRSIEKIKTVGACYMAASGLDPKHHSHLDELDHVCALIDFSLAIKQCLDQVNKHSFNHFFLRVGSGPFLIFQVV
cccccccccccccccccHHHHHcccccccEEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEc
***********EPRLVDFDELLSEPRFRSIEKIKTVGACYMAASGLDPKHHSHLDELDHVCALIDFSLAIKQCLDQVNKHSFNHFFLRVGSGPFLIFQVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKANQKNSDTVEPRLVDFDELLSEPRFRSIEKIKTVGACYMAASGLDPKHHSHLDELDHVCALIDFSLAIKQCLDQVNKHSFNHFFLRVGSGPFLIFQVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate cyclase type 8 This is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence.confidentP40146
Adenylate cyclase type 8 This is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence.confidentP40145
Adenylate cyclase type 8 This is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence.confidentP97490

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0007188 [BP]adenylate cyclase-modulating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0031000 [BP]response to caffeineprobableGO:0009719, GO:0050896, GO:1901698, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:0014074, GO:0010243, GO:0014070
GO:0010353 [BP]response to trehalose stimulusprobableGO:1901700, GO:0009743, GO:0034285, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0009744 [BP]response to sucrose stimulusprobableGO:1901700, GO:0009743, GO:0034285, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0008294 [MF]calcium- and calmodulin-responsive adenylate cyclase activityprobableGO:0009975, GO:0016829, GO:0016849, GO:0004016, GO:0003824, GO:0003674
GO:0006171 [BP]cAMP biosynthetic processprobableGO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0009259, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0046058, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0009987, GO:0006753, GO:0044281
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071361 [BP]cellular response to ethanolprobableGO:1901700, GO:1901701, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0045471, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0097305, GO:0010033, GO:0044699, GO:0097306
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019933 [BP]cAMP-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0019935, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0045937 [BP]positive regulation of phosphate metabolic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0031325, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AB8, chain A
Confidence level:very confident
Coverage over the Query: 3-99
View the alignment between query and template
View the model in PyMOL