Diaphorina citri psyllid: psy9438

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----

MDLDFIIYLGVVVLEIERSIMWTTLAPVFFSFLVVQVLSEDFAGKIVAVAVLRPYASSPSVTSPSGNVTFIQHDDGTVTVKGFVTGLKKNTAGSQEHGFHIHEKGDLREGCASLGGHYNPQQGNSSPSVTSPSGNVTFIQHDDGTVTVKGFVTGLKKNTAGSQEHGFHIHEKGDLREGCASLGGHYNPQQKQHGAPDHEVRHIGDLGNIEASPSGVASFEFEDKIISLTGPYSILGRGLIVHSDKDDFGRGMFNDSTTTGHAGSRVACGVIGLV

ccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccEEEEEEEcccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccEECccccEEEEEEEEcEEEECcccccccCEEEEccccccccccccccccccccccccCEEEEEEEc

**LDFIIYLGVVVLEIERSIMWTTLAPVFFSFLVVQVLSEDFAGKIVAVAVLRPYASSPSVTSPSGNVTFIQHDDGTVTVKGFVTGLKKNTAGSQEHGFHIHEKGDLREGCASLGGHYNPQQGNSSPSVTSPSGNVTFIQHDDGTVTVKGFVTGLKKNTAGSQEHGFHIHEKGDLREGCASLGGHYNPQQKQHGAPDHEVRHIGDLGNIEASPSGVASFEFEDKIISLTGPYSILGRGLIVHSDKDDFGRGMFNDSTTTGHAGSRVACGVIGLV

xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Superoxide dismutase [Cu-Zn]	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	confident	P33431
Superoxide dismutase [Cu-Zn]	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	confident	P80566
Superoxide dismutase [Cu-Zn] 1	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	confident	Q0DRV6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0000303 [BP]	response to superoxide	probable	GO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0042554 [BP]	superoxide anion generation	probable	GO:0072593, GO:0009987, GO:0044237, GO:0008150, GO:0006801, GO:0008152
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005507 [MF]	copper ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0030312 [CC]	external encapsulating structure	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623
GO:0046688 [BP]	response to copper ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0045541 [BP]	negative regulation of cholesterol biosynthetic process	probable	GO:0051055, GO:0009892, GO:0080090, GO:0009890, GO:0019216, GO:0045939, GO:0019218, GO:0008150, GO:0090206, GO:0009889, GO:0090181, GO:0065007, GO:0045833, GO:0010894, GO:0048519, GO:0046890, GO:0050810, GO:0019222, GO:0045540, GO:0050789
GO:0010033 [BP]	response to organic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0031667 [BP]	response to nutrient levels	probable	GO:0009991, GO:0008150, GO:0050896, GO:0009605
GO:0009579 [CC]	thylakoid	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0071484 [BP]	cellular response to light intensity	probable	GO:0009628, GO:0051716, GO:0071478, GO:0071482, GO:0009314, GO:0050896, GO:0009987, GO:0008150, GO:0009416, GO:0044763, GO:0071214, GO:0009642, GO:0044699
GO:0071472 [BP]	cellular response to salt stress	probable	GO:0009628, GO:0051716, GO:0009987, GO:0050896, GO:0071470, GO:0044763, GO:0008150, GO:0006950, GO:0006970, GO:0033554, GO:0009651, GO:0071214, GO:0044699
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004784 [MF]	superoxide dismutase activity	probable	GO:0016721, GO:0016209, GO:0003674, GO:0003824, GO:0016491
GO:0051770 [BP]	positive regulation of nitric-oxide synthase biosynthetic process	probable	GO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0008150, GO:0010557, GO:0010556, GO:0051769, GO:0048518, GO:0065007, GO:0050789, GO:0010604
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0031012 [CC]	extracellular matrix	probable	GO:0005575
GO:0060047 [BP]	heart contraction	probable	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0003015, GO:0044699, GO:0003008
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0001819 [BP]	positive regulation of cytokine production	probable	GO:0051240, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789
GO:0030346 [MF]	protein phosphatase 2B binding	probable	GO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0010608 [BP]	posttranscriptional regulation of gene expression	probable	GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0010468
GO:0044419 [BP]	interspecies interaction between organisms	probable	GO:0008150, GO:0051704
GO:0032839 [CC]	dendrite cytoplasm	probable	GO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0071457 [BP]	cellular response to ozone	probable	GO:1901700, GO:1901701, GO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0034614, GO:0006950, GO:0000302, GO:0008150, GO:0070887, GO:0044763, GO:0010193, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:0044699
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0009650 [BP]	UV protection	probable	GO:0009628, GO:0009314, GO:0050896, GO:0009411, GO:0008150, GO:0009416
GO:0007568 [BP]	aging	probable	GO:0044767, GO:0032502, GO:0008150, GO:0044699
GO:0000187 [BP]	activation of MAPK activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0071493 [BP]	cellular response to UV-B	probable	GO:0009628, GO:0051716, GO:0071478, GO:0071482, GO:0009314, GO:0050896, GO:0009987, GO:0008150, GO:0009411, GO:0009416, GO:0071214, GO:0034644, GO:0044763, GO:0010224, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.15.-.-	Acting on superoxide as acceptor.	probable
1.15.1.-	Acting on superoxide as acceptor.	probable
1.15.1.1	Superoxide dismutase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WYT, chain A
Confidence level:very confident
Coverage over the Query: 131-274
View the alignment between query and template
View the model in PyMOL

Template: 2JLP, chain A
Confidence level:very confident
Coverage over the Query: 43-125,200-274
View the alignment between query and template
View the model in PyMOL