Query         psy9445
Match_columns 243
No_of_seqs    281 out of 2064
Neff          8.0 
Searched_HMMs 46136
Date          Fri Aug 16 19:31:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9445.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9445hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0243|consensus              100.0 3.7E-40   8E-45  317.5  10.1  160   80-243    53-215 (1041)
  2 cd01370 KISc_KIP3_like Kinesin 100.0 3.1E-38 6.7E-43  282.3  14.0  151   80-243     4-165 (338)
  3 cd01368 KISc_KIF23_like Kinesi 100.0 2.1E-37 4.6E-42  277.5  14.2  149   79-243     4-166 (345)
  4 KOG0245|consensus              100.0 2.9E-38 6.2E-43  300.7   8.7  155   79-243     7-170 (1221)
  5 cd01373 KISc_KLP2_like Kinesin 100.0 8.5E-37 1.9E-41  272.9  14.3  156   79-243     4-164 (337)
  6 KOG4280|consensus              100.0 6.5E-38 1.4E-42  290.0   6.5  153   80-243     9-165 (574)
  7 cd01365 KISc_KIF1A_KIF1B Kines 100.0 1.6E-36 3.5E-41  273.1  14.6  153   79-243     4-170 (356)
  8 KOG0242|consensus              100.0 6.9E-37 1.5E-41  292.0  12.6  151   80-243    10-163 (675)
  9 cd01367 KISc_KIF2_like Kinesin 100.0 1.1E-36 2.4E-41  270.6  12.1  150   79-243     4-159 (322)
 10 cd01364 KISc_BimC_Eg5 Kinesin  100.0 9.4E-36   2E-40  267.8  14.7  164   79-243     5-171 (352)
 11 cd01374 KISc_CENP_E Kinesin mo 100.0 1.7E-35 3.7E-40  263.0  13.9  147   80-243     4-150 (321)
 12 cd01376 KISc_KID_like Kinesin  100.0 3.6E-35 7.8E-40  260.7  14.5  150   80-243     4-156 (319)
 13 cd01371 KISc_KIF3 Kinesin moto 100.0 2.9E-35 6.4E-40  262.7  13.5  156   79-243     4-162 (333)
 14 cd01369 KISc_KHC_KIF5 Kinesin  100.0 7.3E-35 1.6E-39  259.4  13.3  152   79-243     5-157 (325)
 15 KOG0241|consensus              100.0 1.9E-35 4.2E-40  278.6   9.4  154   79-243     7-174 (1714)
 16 KOG0240|consensus              100.0 1.9E-35 4.1E-40  268.5   9.0  152   79-243    10-163 (607)
 17 cd01375 KISc_KIF9_like Kinesin 100.0 1.8E-34 3.9E-39  257.7  13.8  151   80-243     4-166 (334)
 18 cd01372 KISc_KIF4 Kinesin moto 100.0 3.8E-34 8.2E-39  256.3  13.4  153   80-243     5-160 (341)
 19 PLN03188 kinesin-12 family pro 100.0 2.6E-34 5.6E-39  280.1  13.0  152   79-243   101-258 (1320)
 20 KOG0239|consensus              100.0 2.8E-34 6.1E-39  273.3   8.5  163   69-243   303-473 (670)
 21 PF00225 Kinesin:  Kinesin moto 100.0 7.7E-34 1.7E-38  253.6  10.1  152   83-243     1-160 (335)
 22 cd00106 KISc Kinesin motor dom 100.0 7.4E-33 1.6E-37  246.6  15.0  152   80-243     4-159 (328)
 23 cd01366 KISc_C_terminal Kinesi 100.0 9.7E-33 2.1E-37  246.1  15.0  150   79-243     5-159 (329)
 24 smart00129 KISc Kinesin motor, 100.0 1.9E-32   4E-37  244.8  15.6  151   80-243     4-157 (335)
 25 KOG0246|consensus              100.0 1.2E-29 2.6E-34  230.5  11.6  156   80-243   212-375 (676)
 26 KOG0243|consensus               99.9 7.6E-28 1.6E-32  232.7   3.0   95    1-95    259-353 (1041)
 27 COG5059 KIP1 Kinesin-like prot  99.9 1.4E-26   3E-31  219.0   6.3  106  119-235    55-161 (568)
 28 KOG0247|consensus               99.9 7.4E-26 1.6E-30  210.9   6.6  141   79-233    34-248 (809)
 29 KOG0244|consensus               99.9 1.6E-25 3.5E-30  213.7   6.8  146   84-242     1-147 (913)
 30 KOG4280|consensus               99.9 2.8E-25   6E-30  206.2   6.0   94    1-94    204-298 (574)
 31 KOG0240|consensus               99.9 1.7E-23 3.8E-28  190.8   6.9   91    1-94    202-293 (607)
 32 KOG0245|consensus               99.9 6.1E-23 1.3E-27  196.6   3.5   92    1-92    209-308 (1221)
 33 KOG0247|consensus               99.8 7.1E-22 1.5E-26  184.5   5.7   91    1-92    301-396 (809)
 34 cd01363 Motor_domain Myosin an  99.8 1.9E-21 4.1E-26  160.2   6.9   96    1-96     76-171 (186)
 35 cd01373 KISc_KLP2_like Kinesin  99.8 4.3E-21 9.3E-26  171.7   8.2   95    1-96    203-301 (337)
 36 KOG0239|consensus               99.8 2.2E-21 4.8E-26  185.3   6.0   93    1-96    512-604 (670)
 37 cd01370 KISc_KIP3_like Kinesin  99.8 6.2E-21 1.4E-25  170.7   7.6   96    1-96    204-302 (338)
 38 cd01368 KISc_KIF23_like Kinesi  99.8 1.3E-20 2.8E-25  169.1   8.3   96    1-96    205-311 (345)
 39 PLN03188 kinesin-12 family pro  99.8 1.1E-20 2.5E-25  185.3   7.9   94    1-94    297-396 (1320)
 40 KOG0242|consensus               99.8 3.4E-21 7.3E-26  184.6   3.0   91    1-95    202-294 (675)
 41 cd01364 KISc_BimC_Eg5 Kinesin   99.8 9.1E-20   2E-24  164.1   8.2   96    1-96    212-307 (352)
 42 cd01371 KISc_KIF3 Kinesin moto  99.8 1.9E-19 4.1E-24  160.9   8.5   95    1-95    201-296 (333)
 43 KOG0246|consensus               99.8 1.3E-19 2.7E-24  165.5   6.1   90    1-96    414-504 (676)
 44 cd01375 KISc_KIF9_like Kinesin  99.8 4.9E-19 1.1E-23  158.3   8.4   95    1-96    205-300 (334)
 45 cd01376 KISc_KID_like Kinesin   99.8 5.3E-19 1.2E-23  157.2   7.9   91    1-96    195-285 (319)
 46 cd01367 KISc_KIF2_like Kinesin  99.8 6.6E-19 1.4E-23  156.7   7.8   90    1-96    198-288 (322)
 47 cd01365 KISc_KIF1A_KIF1B Kines  99.8 1.2E-18 2.7E-23  157.0   8.0   96    1-96    209-313 (356)
 48 cd01374 KISc_CENP_E Kinesin mo  99.8 1.1E-18 2.4E-23  155.3   7.5   95    1-96    189-285 (321)
 49 cd01369 KISc_KHC_KIF5 Kinesin   99.8 1.7E-18 3.6E-23  154.3   8.3   93    1-96    196-289 (325)
 50 cd01372 KISc_KIF4 Kinesin moto  99.7 2.6E-18 5.7E-23  154.0   8.5   96    1-96    199-304 (341)
 51 COG5059 KIP1 Kinesin-like prot  99.7 7.6E-19 1.6E-23  166.5   2.6  184    1-205   206-420 (568)
 52 cd01366 KISc_C_terminal Kinesi  99.7   8E-18 1.7E-22  150.2   8.1   93    1-96    198-290 (329)
 53 PF00225 Kinesin:  Kinesin moto  99.7 2.6E-17 5.6E-22  147.1   8.0   96    1-96    200-299 (335)
 54 cd00106 KISc Kinesin motor dom  99.7 1.7E-16 3.6E-21  141.5   8.5   94    1-95    198-293 (328)
 55 smart00129 KISc Kinesin motor,  99.7 2.1E-16 4.5E-21  141.4   8.7   95    1-96    196-292 (335)
 56 KOG0241|consensus               99.7 8.5E-17 1.8E-21  153.4   5.6   93    1-93    213-312 (1714)
 57 KOG0244|consensus               99.7 1.6E-18 3.5E-23  166.1  -6.3   90    1-92    186-277 (913)
 58 cd01363 Motor_domain Myosin an  99.5 4.8E-15   1E-19  122.0   5.2   57  137-205     8-64  (186)
 59 COG0556 UvrB Helicase subunit   95.5   0.024 5.1E-07   53.4   5.4   93  121-226     4-101 (663)
 60 COG2805 PilT Tfp pilus assembl  94.3   0.021 4.6E-07   50.3   1.6   31  142-172   113-143 (353)
 61 PF00308 Bac_DnaA:  Bacterial d  93.6   0.033 7.2E-07   46.9   1.3   50  121-173     4-53  (219)
 62 PRK06893 DNA replication initi  92.4   0.074 1.6E-06   45.0   1.8   47  121-173    12-58  (229)
 63 COG2804 PulE Type II secretory  91.7   0.077 1.7E-06   49.8   1.2   29  145-173   249-277 (500)
 64 TIGR02928 orc1/cdc6 family rep  89.8    0.14 3.1E-06   45.9   1.1   28  145-172    30-58  (365)
 65 PRK00411 cdc6 cell division co  88.8    0.19 4.1E-06   45.7   1.2   28  145-172    45-73  (394)
 66 PRK06526 transposase; Provisio  88.7    0.26 5.7E-06   42.5   1.9   18  156-173   100-117 (254)
 67 cd00009 AAA The AAA+ (ATPases   88.3     0.2 4.4E-06   37.5   0.9   25  148-172    13-37  (151)
 68 PRK12377 putative replication   88.2     0.3 6.4E-06   42.1   1.9   50  122-173    71-120 (248)
 69 PRK09087 hypothetical protein;  88.1     0.3 6.5E-06   41.3   1.8   48  120-173    16-63  (226)
 70 PRK14086 dnaA chromosomal repl  87.9    0.21 4.5E-06   48.4   0.8   51  120-173   283-333 (617)
 71 PRK05642 DNA replication initi  87.6     0.3 6.5E-06   41.5   1.6   19  155-173    46-64  (234)
 72 PRK08116 hypothetical protein;  87.6    0.22 4.7E-06   43.3   0.7   51  121-173    81-133 (268)
 73 PF13245 AAA_19:  Part of AAA d  87.5    0.25 5.4E-06   34.4   0.8   27  146-173     3-29  (76)
 74 PF01935 DUF87:  Domain of unkn  87.1     0.2 4.3E-06   42.0   0.2   16  156-171    25-40  (229)
 75 PRK00149 dnaA chromosomal repl  86.9    0.22 4.8E-06   46.4   0.4   52  119-173   116-167 (450)
 76 PRK14088 dnaA chromosomal repl  86.9    0.18 3.9E-06   47.0  -0.2   50  120-173   100-149 (440)
 77 COG1474 CDC6 Cdc6-related prot  86.8    0.27 5.9E-06   44.7   0.9   27  146-172    33-60  (366)
 78 COG5008 PilU Tfp pilus assembl  86.7    0.45 9.8E-06   41.5   2.1   30  142-171   115-144 (375)
 79 PRK08084 DNA replication initi  86.6    0.46   1E-05   40.3   2.2   47  121-173    18-64  (235)
 80 PRK10436 hypothetical protein;  86.4    0.28 6.1E-06   46.0   0.8   27  146-172   210-236 (462)
 81 cd00046 DEXDc DEAD-like helica  86.4    0.24 5.1E-06   36.7   0.3   18  157-174     3-20  (144)
 82 TIGR00362 DnaA chromosomal rep  86.2    0.26 5.6E-06   45.2   0.4   52  119-173   104-155 (405)
 83 PF13401 AAA_22:  AAA domain; P  86.1    0.22 4.7E-06   37.5  -0.1   18  154-171     4-21  (131)
 84 PF04851 ResIII:  Type III rest  86.1    0.28   6E-06   38.8   0.5   20  154-173    25-44  (184)
 85 TIGR02538 type_IV_pilB type IV  85.5    0.47   1E-05   45.7   1.9   29  145-173   307-335 (564)
 86 PRK08181 transposase; Validate  85.3    0.51 1.1E-05   41.1   1.8   18  157-174   109-126 (269)
 87 TIGR02533 type_II_gspE general  85.2    0.41   9E-06   45.2   1.3   28  146-173   234-261 (486)
 88 PRK06620 hypothetical protein;  85.1    0.41   9E-06   40.1   1.1   50  120-173    11-63  (214)
 89 PRK07952 DNA replication prote  84.9    0.57 1.2E-05   40.2   1.9   50  122-173    69-118 (244)
 90 KOG0989|consensus               84.8    0.46 9.9E-06   42.1   1.3   24  148-171    51-74  (346)
 91 TIGR00631 uvrb excinuclease AB  84.8    0.97 2.1E-05   44.4   3.7   88  125-225     5-97  (655)
 92 smart00382 AAA ATPases associa  84.8    0.32 6.9E-06   35.9   0.3   19  155-173     3-21  (148)
 93 PF12846 AAA_10:  AAA-like doma  84.7    0.31 6.8E-06   41.9   0.2   19  154-172     1-19  (304)
 94 PRK08727 hypothetical protein;  84.5    0.41 8.9E-06   40.6   0.8   19  155-173    42-60  (233)
 95 TIGR01420 pilT_fam pilus retra  84.4    0.46 9.9E-06   42.8   1.1   30  144-173   112-141 (343)
 96 TIGR02524 dot_icm_DotB Dot/Icm  84.1    0.51 1.1E-05   42.9   1.3   25  149-173   129-153 (358)
 97 cd01131 PilT Pilus retraction   83.8    0.38 8.2E-06   39.7   0.3   18  155-172     2-19  (198)
 98 PF01695 IstB_IS21:  IstB-like   83.3    0.61 1.3E-05   37.9   1.4   19  155-173    48-66  (178)
 99 PF00437 T2SE:  Type II/IV secr  83.3    0.41 8.9E-06   41.2   0.4   18  154-171   127-144 (270)
100 cd01129 PulE-GspE PulE/GspE Th  82.8    0.62 1.3E-05   40.4   1.3   27  146-172    72-98  (264)
101 PF13479 AAA_24:  AAA domain     82.6    0.52 1.1E-05   39.3   0.7   21  154-174     3-23  (213)
102 PRK09183 transposase/IS protei  82.3    0.76 1.7E-05   39.7   1.6   18  156-173   104-121 (259)
103 COG1484 DnaC DNA replication p  82.2    0.69 1.5E-05   39.9   1.4   38  133-173    87-124 (254)
104 TIGR02525 plasmid_TraJ plasmid  82.2    0.63 1.4E-05   42.5   1.1   27  145-172   141-167 (372)
105 PF13604 AAA_30:  AAA domain; P  82.0    0.62 1.3E-05   38.4   0.9   28  145-172     9-36  (196)
106 PF00270 DEAD:  DEAD/DEAH box h  81.6    0.95 2.1E-05   35.4   1.9   27  145-173     7-33  (169)
107 TIGR03420 DnaA_homol_Hda DnaA   81.5    0.84 1.8E-05   37.9   1.6   23  151-173    35-57  (226)
108 PRK08939 primosomal protein Dn  81.3    0.71 1.5E-05   40.9   1.1   41  133-174   135-176 (306)
109 PF00448 SRP54:  SRP54-type pro  81.2    0.52 1.1E-05   39.0   0.2   17  156-172     3-19  (196)
110 PRK06835 DNA replication prote  81.2    0.81 1.7E-05   41.1   1.4   29  144-173   174-202 (329)
111 PF00004 AAA:  ATPase family as  81.1    0.68 1.5E-05   34.5   0.8   50  157-206     1-56  (132)
112 PF05970 PIF1:  PIF1-like helic  80.0    0.88 1.9E-05   41.3   1.3   37  131-171     3-39  (364)
113 PF13207 AAA_17:  AAA domain; P  79.7    0.88 1.9E-05   33.7   1.0   16  156-171     1-16  (121)
114 PTZ00112 origin recognition co  79.3    0.97 2.1E-05   45.8   1.4   27  145-171   770-798 (1164)
115 PF13191 AAA_16:  AAA ATPase do  78.9    0.49 1.1E-05   37.7  -0.7   23  150-172    20-42  (185)
116 PF01637 Arch_ATPase:  Archaeal  78.7    0.57 1.2E-05   38.5  -0.3   28  145-172    11-38  (234)
117 PF13086 AAA_11:  AAA domain; P  78.7    0.89 1.9E-05   37.3   0.8   18  156-173    19-36  (236)
118 PRK14087 dnaA chromosomal repl  78.6    0.69 1.5E-05   43.3   0.1   50  121-173   111-160 (450)
119 TIGR03015 pepcterm_ATPase puta  78.6     1.1 2.5E-05   38.1   1.5   23  150-172    39-61  (269)
120 PF00910 RNA_helicase:  RNA hel  78.4    0.57 1.2E-05   34.6  -0.4   16  157-172     1-16  (107)
121 PF02562 PhoH:  PhoH-like prote  77.7     1.4 2.9E-05   36.9   1.6   21  153-173    18-38  (205)
122 PRK13894 conjugal transfer ATP  77.3     1.1 2.5E-05   39.9   1.2   28  144-172   139-166 (319)
123 TIGR02782 TrbB_P P-type conjug  76.8    0.97 2.1E-05   40.0   0.6   28  144-172   123-150 (299)
124 PF13671 AAA_33:  AAA domain; P  76.6     1.1 2.4E-05   34.1   0.8   17  157-173     2-18  (143)
125 PF00580 UvrD-helicase:  UvrD/R  76.5    0.97 2.1E-05   39.1   0.5   21  153-173    12-32  (315)
126 PHA00729 NTP-binding motif con  76.4     1.7 3.8E-05   36.8   2.0   30  144-173     7-36  (226)
127 PRK08903 DnaA regulatory inact  76.1     1.8 3.9E-05   36.1   2.0   22  152-173    40-61  (227)
128 PF01580 FtsK_SpoIIIE:  FtsK/Sp  76.0    0.82 1.8E-05   37.6  -0.1   17  156-172    40-56  (205)
129 PRK12402 replication factor C   75.9     1.2 2.5E-05   39.4   0.9   21  151-171    33-53  (337)
130 PRK06921 hypothetical protein;  75.6     1.3 2.8E-05   38.5   1.0   21  154-174   117-137 (266)
131 COG0593 DnaA ATPase involved i  75.3    0.96 2.1E-05   41.7   0.1   52  119-173    81-132 (408)
132 COG1223 Predicted ATPase (AAA+  75.1     1.1 2.5E-05   39.0   0.5   51  154-205   151-208 (368)
133 PF07693 KAP_NTPase:  KAP famil  74.0     1.2 2.7E-05   39.1   0.5   54  152-205    18-82  (325)
134 PF07728 AAA_5:  AAA domain (dy  73.9     1.4 3.1E-05   33.6   0.8   15  157-171     2-16  (139)
135 PF07724 AAA_2:  AAA domain (Cd  73.7     1.4 3.1E-05   35.5   0.7   17  155-171     4-20  (171)
136 PF06309 Torsin:  Torsin;  Inte  73.6     1.3 2.8E-05   34.2   0.4   17  155-171    53-70  (127)
137 PF13238 AAA_18:  AAA domain; P  73.3     1.5 3.3E-05   32.4   0.8   15  157-171     1-15  (129)
138 PHA02544 44 clamp loader, smal  73.2     1.6 3.5E-05   38.3   1.0   23  151-173    39-62  (316)
139 PF05496 RuvB_N:  Holliday junc  73.1     2.4 5.2E-05   36.0   2.0   41  128-169    23-65  (233)
140 TIGR02881 spore_V_K stage V sp  72.5     1.4   3E-05   37.9   0.4   18  154-171    42-59  (261)
141 PRK13833 conjugal transfer pro  72.3     1.7 3.7E-05   38.9   1.0   28  144-172   135-162 (323)
142 cd01130 VirB11-like_ATPase Typ  72.1     1.9 4.1E-05   35.0   1.1   28  144-172    16-43  (186)
143 TIGR03499 FlhF flagellar biosy  71.5     1.5 3.2E-05   38.4   0.4   18  156-173   196-213 (282)
144 PRK12723 flagellar biosynthesi  71.3     1.4 3.1E-05   40.4   0.3   19  154-172   174-192 (388)
145 PF06414 Zeta_toxin:  Zeta toxi  71.3     1.5 3.3E-05   35.9   0.4   20  153-172    14-33  (199)
146 smart00487 DEXDc DEAD-like hel  71.1     2.2 4.7E-05   33.5   1.3   27  146-173    17-43  (201)
147 PF00063 Myosin_head:  Myosin h  71.0     1.7 3.8E-05   42.8   0.8   21  151-171    82-102 (689)
148 PRK13851 type IV secretion sys  70.7     1.5 3.2E-05   39.6   0.2   28  145-173   154-181 (344)
149 PRK06547 hypothetical protein;  70.1     3.2 6.9E-05   33.5   2.0   26  146-171     7-32  (172)
150 PLN03025 replication factor C   69.2     2.3 5.1E-05   37.6   1.2   22  152-173    32-53  (319)
151 KOG2543|consensus               68.6     1.7 3.7E-05   39.7   0.2   19  155-173    31-49  (438)
152 PRK13764 ATPase; Provisional    68.5     2.3   5E-05   41.3   1.0   20  154-173   257-276 (602)
153 PRK10536 hypothetical protein;  68.4     2.3 4.9E-05   36.9   0.9   17  155-171    75-91  (262)
154 PLN00020 ribulose bisphosphate  67.8     2.8   6E-05   38.4   1.3   84  120-205   110-205 (413)
155 PRK11776 ATP-dependent RNA hel  67.8     3.5 7.7E-05   38.4   2.1   24  145-170    34-57  (460)
156 PF03215 Rad17:  Rad17 cell cyc  67.5     2.5 5.5E-05   40.3   1.0   29  143-171    32-62  (519)
157 cd00268 DEADc DEAD-box helicas  67.4     3.1 6.7E-05   33.7   1.5   25  145-171    29-53  (203)
158 PRK14722 flhF flagellar biosyn  67.1     2.1 4.5E-05   39.1   0.4   19  154-172   137-155 (374)
159 COG4962 CpaF Flp pilus assembl  67.0     2.4 5.3E-05   38.2   0.8   24  148-172   168-191 (355)
160 PF00735 Septin:  Septin;  Inte  66.5     2.6 5.6E-05   36.9   0.9   21  151-171     1-21  (281)
161 PRK13342 recombination factor   66.4     3.7   8E-05   37.9   1.9   25  148-172    30-54  (413)
162 TIGR01242 26Sp45 26S proteasom  65.9     2.2 4.8E-05   38.6   0.3   19  154-172   156-174 (364)
163 PRK13900 type IV secretion sys  65.7       2 4.4E-05   38.5   0.0   27  145-172   152-178 (332)
164 PRK04837 ATP-dependent RNA hel  64.8     3.3 7.1E-05   38.1   1.2   25  145-171    38-62  (423)
165 TIGR00635 ruvB Holliday juncti  64.7     2.7 5.9E-05   36.6   0.7   18  155-172    31-48  (305)
166 PF13555 AAA_29:  P-loop contai  64.6     2.5 5.3E-05   28.3   0.3   15  157-171    26-40  (62)
167 COG1419 FlhF Flagellar GTP-bin  64.5     2.9 6.3E-05   38.5   0.8   18  154-171   203-220 (407)
168 PF02456 Adeno_IVa2:  Adenoviru  64.5       3 6.6E-05   37.2   0.9   75  157-232    90-186 (369)
169 PRK04328 hypothetical protein;  64.5     5.3 0.00011   34.2   2.4   26  144-169    10-38  (249)
170 PF12775 AAA_7:  P-loop contain  64.5     3.4 7.3E-05   36.0   1.2   28  145-173    25-52  (272)
171 CHL00081 chlI Mg-protoporyphyr  64.4     1.7 3.8E-05   39.3  -0.7   46  120-173    12-57  (350)
172 PF05729 NACHT:  NACHT domain    64.3     2.7 5.9E-05   32.5   0.5   18  156-173     2-19  (166)
173 COG2256 MGS1 ATPase related to  64.2     4.7  0.0001   37.1   2.1   41  129-170    24-64  (436)
174 COG1222 RPT1 ATP-dependent 26S  64.2     3.2   7E-05   37.7   1.0   36  134-169   160-200 (406)
175 KOG3859|consensus               64.2     3.7 8.1E-05   36.1   1.4   29  143-171    30-59  (406)
176 PTZ00424 helicase 45; Provisio  63.8     4.5 9.8E-05   36.6   2.0   26  144-171    57-82  (401)
177 smart00242 MYSc Myosin. Large   63.4     3.9 8.5E-05   40.3   1.5   21  151-171    89-109 (677)
178 cd01850 CDC_Septin CDC/Septin.  63.0     3.3 7.1E-05   36.1   0.8   21  151-171     1-21  (276)
179 TIGR01618 phage_P_loop phage n  62.8     3.3 7.3E-05   34.9   0.8   21  154-174    12-32  (220)
180 PRK12422 chromosomal replicati  62.7     3.3 7.1E-05   38.7   0.8   52  119-173   105-160 (445)
181 COG1219 ClpX ATP-dependent pro  62.5     3.5 7.7E-05   37.0   0.9   15  155-169    98-112 (408)
182 cd01120 RecA-like_NTPases RecA  62.3     3.5 7.6E-05   31.5   0.8   15  157-171     2-16  (165)
183 PF05673 DUF815:  Protein of un  61.7       4 8.6E-05   35.1   1.1   28  146-173    43-71  (249)
184 PRK00440 rfc replication facto  61.6     3.6 7.7E-05   35.9   0.8   21  151-171    35-55  (319)
185 PRK11192 ATP-dependent RNA hel  61.6     5.3 0.00012   36.8   2.0   24  145-170    31-54  (434)
186 cd01383 MYSc_type_VIII Myosin   61.6       5 0.00011   39.6   1.9   21  151-171    89-109 (677)
187 PF10236 DAP3:  Mitochondrial r  61.6     3.5 7.5E-05   36.6   0.8   24  150-173    19-42  (309)
188 cd02021 GntK Gluconate kinase   61.5     3.7   8E-05   31.7   0.8   15  157-171     2-16  (150)
189 TIGR01359 UMP_CMP_kin_fam UMP-  61.5     3.8 8.2E-05   32.8   0.9   14  157-170     2-15  (183)
190 cd01384 MYSc_type_XI Myosin mo  61.2     4.8  0.0001   39.7   1.7   21  151-171    85-105 (674)
191 cd01123 Rad51_DMC1_radA Rad51_  61.1     6.4 0.00014   32.8   2.3   28  144-171     6-36  (235)
192 PRK00131 aroK shikimate kinase  61.0     4.2 9.2E-05   31.9   1.1   17  155-171     5-21  (175)
193 PF06048 DUF927:  Domain of unk  61.0     3.7   8E-05   35.9   0.8   29  142-171   182-210 (286)
194 PRK07261 topology modulation p  60.8     3.9 8.5E-05   32.8   0.9   15  157-171     3-17  (171)
195 PRK10590 ATP-dependent RNA hel  60.7     5.9 0.00013   36.9   2.2   25  145-171    31-55  (456)
196 COG1125 OpuBA ABC-type proline  60.6     3.1 6.8E-05   36.2   0.3   13  160-172    33-45  (309)
197 PRK11331 5-methylcytosine-spec  60.6     4.6  0.0001   37.8   1.4   27  143-171   185-211 (459)
198 cd00124 MYSc Myosin motor doma  60.6     4.7  0.0001   39.8   1.5   21  151-171    83-103 (679)
199 cd01126 TraG_VirD4 The TraG/Tr  60.4     5.5 0.00012   36.2   1.9   16  157-172     2-17  (384)
200 PRK03992 proteasome-activating  60.2       4 8.8E-05   37.4   0.9   18  154-171   165-182 (389)
201 cd01377 MYSc_type_II Myosin mo  60.1     4.8  0.0001   39.9   1.5   21  151-171    88-108 (693)
202 cd01381 MYSc_type_VII Myosin m  60.1     5.4 0.00012   39.3   1.9   21  151-171    83-103 (671)
203 cd01385 MYSc_type_IX Myosin mo  59.7     5.1 0.00011   39.7   1.6   21  151-171    91-111 (692)
204 PRK08118 topology modulation p  59.7     4.2 9.2E-05   32.5   0.9   14  157-170     4-17  (167)
205 PF06745 KaiC:  KaiC;  InterPro  59.4     7.3 0.00016   32.4   2.3   28  144-171     6-36  (226)
206 cd01378 MYSc_type_I Myosin mot  59.3     5.5 0.00012   39.3   1.8   21  151-171    83-103 (674)
207 KOG1803|consensus               59.2     3.8 8.3E-05   39.5   0.6   17  156-172   203-219 (649)
208 CHL00181 cbbX CbbX; Provisiona  59.1     4.2 9.1E-05   35.7   0.8   15  157-171    62-76  (287)
209 PRK00080 ruvB Holliday junctio  59.1       4 8.7E-05   36.3   0.7   17  155-171    52-68  (328)
210 PF13476 AAA_23:  AAA domain; P  59.0     3.7 8.1E-05   32.8   0.5   17  155-171    20-36  (202)
211 cd01382 MYSc_type_VI Myosin mo  59.0       5 0.00011   39.9   1.4   21  151-171    88-108 (717)
212 PF12774 AAA_6:  Hydrolytic ATP  58.9     4.4 9.6E-05   34.4   0.9   18  156-173    34-51  (231)
213 TIGR00376 DNA helicase, putati  58.8     4.8  0.0001   39.4   1.2   18  156-173   175-192 (637)
214 PRK05703 flhF flagellar biosyn  58.2     3.8 8.2E-05   38.1   0.4   18  156-173   223-240 (424)
215 TIGR02903 spore_lon_C ATP-depe  58.2     5.6 0.00012   38.8   1.6   27  145-171   166-192 (615)
216 KOG0953|consensus               58.1      13 0.00028   35.8   3.9   45  156-205   193-237 (700)
217 PRK04195 replication factor C   58.0     4.8  0.0001   38.0   1.0   28  144-171    28-56  (482)
218 cd01380 MYSc_type_V Myosin mot  58.0     5.5 0.00012   39.4   1.5   21  151-171    83-103 (691)
219 TIGR02237 recomb_radB DNA repa  57.7       7 0.00015   32.0   1.9   18  154-171    12-29  (209)
220 PHA02653 RNA helicase NPH-II;   57.7     7.6 0.00016   38.4   2.4   24  145-170   172-195 (675)
221 KOG0739|consensus               57.4     4.9 0.00011   35.9   0.9   83  125-207   133-225 (439)
222 cd00464 SK Shikimate kinase (S  57.4     4.7  0.0001   31.0   0.7   16  156-171     1-16  (154)
223 PRK11634 ATP-dependent RNA hel  57.4       7 0.00015   38.3   2.1   25  145-171    36-60  (629)
224 cd01387 MYSc_type_XV Myosin mo  57.1     6.5 0.00014   38.8   1.9   21  151-171    84-104 (677)
225 PRK06995 flhF flagellar biosyn  56.9       4 8.6E-05   38.6   0.3   18  155-172   257-274 (484)
226 PF04548 AIG1:  AIG1 family;  I  56.8     4.8  0.0001   33.4   0.8   21  155-175     1-24  (212)
227 cd01428 ADK Adenylate kinase (  56.8       5 0.00011   32.2   0.9   15  157-171     2-16  (194)
228 PTZ00454 26S protease regulato  56.5     5.3 0.00011   36.8   1.1   18  154-171   179-196 (398)
229 TIGR02880 cbbX_cfxQ probable R  56.3       5 0.00011   35.1   0.8   16  156-171    60-75  (284)
230 TIGR02640 gas_vesic_GvpN gas v  56.0     7.3 0.00016   33.5   1.8   26  144-171    13-38  (262)
231 cd01124 KaiC KaiC is a circadi  55.9     5.6 0.00012   31.7   1.0   15  157-171     2-16  (187)
232 smart00763 AAA_PrkA PrkA AAA d  55.8      24 0.00051   32.2   5.0   17  153-169    77-93  (361)
233 PHA01747 putative ATP-dependen  55.7     5.3 0.00011   36.6   0.9   32  142-173   178-209 (425)
234 cd00820 PEPCK_HprK Phosphoenol  55.6     4.7  0.0001   30.1   0.5   16  156-171    17-32  (107)
235 COG5019 CDC3 Septin family pro  55.6     7.7 0.00017   35.2   1.9   21  150-170    19-39  (373)
236 PF13173 AAA_14:  AAA domain     55.5     4.4 9.6E-05   30.6   0.3   17  156-172     4-20  (128)
237 KOG0926|consensus               55.5     6.9 0.00015   39.2   1.7   19  153-171   270-288 (1172)
238 PRK06217 hypothetical protein;  55.3     5.4 0.00012   32.1   0.8   14  157-170     4-17  (183)
239 PF14532 Sigma54_activ_2:  Sigm  55.2     5.7 0.00012   30.4   0.9   21  151-171    18-38  (138)
240 cd01127 TrwB Bacterial conjuga  55.2     4.2 9.1E-05   37.5   0.2   18  154-171    42-59  (410)
241 TIGR01313 therm_gnt_kin carboh  55.2     4.5 9.7E-05   31.7   0.3   13  158-170     2-14  (163)
242 PTZ00361 26 proteosome regulat  54.8     4.2   9E-05   38.0   0.1   17  155-171   218-234 (438)
243 TIGR00348 hsdR type I site-spe  54.6     6.4 0.00014   38.8   1.4   31  142-173   247-282 (667)
244 TIGR01241 FtsH_fam ATP-depende  54.6     5.5 0.00012   37.6   0.9   18  155-172    89-106 (495)
245 TIGR03744 traC_PFL_4706 conjug  54.5     4.2 9.2E-05   41.4   0.1   19  153-171   474-492 (893)
246 TIGR00614 recQ_fam ATP-depende  54.5     9.1  0.0002   35.9   2.3   26  144-171    18-43  (470)
247 PF08477 Miro:  Miro-like prote  54.5     6.5 0.00014   28.7   1.1   16  157-172     2-17  (119)
248 cd02020 CMPK Cytidine monophos  54.5     5.9 0.00013   30.1   0.9   15  157-171     2-16  (147)
249 COG3829 RocR Transcriptional r  54.4     6.2 0.00014   37.7   1.2   19  149-167   263-281 (560)
250 PRK11448 hsdR type I restricti  54.3     4.5 9.8E-05   42.2   0.3   30  143-173   423-452 (1123)
251 TIGR02746 TraC-F-type type-IV   54.3     4.3 9.4E-05   40.6   0.1   18  154-171   430-447 (797)
252 KOG2373|consensus               54.0      11 0.00024   34.3   2.6   30  143-173   260-292 (514)
253 KOG0652|consensus               54.0     6.4 0.00014   34.5   1.1   15  155-169   206-220 (424)
254 PRK08233 hypothetical protein;  53.7       6 0.00013   31.3   0.8   15  157-171     6-20  (182)
255 PHA02244 ATPase-like protein    53.7     8.4 0.00018   35.3   1.8   20  150-171   117-136 (383)
256 PRK14531 adenylate kinase; Pro  53.7     6.1 0.00013   31.9   0.9   15  156-170     4-18  (183)
257 PF00158 Sigma54_activat:  Sigm  53.1     7.9 0.00017   31.1   1.4   21  150-170    18-38  (168)
258 PRK13341 recombination factor   53.1     7.7 0.00017   38.6   1.6   23  151-173    49-71  (725)
259 KOG0340|consensus               53.1      12 0.00027   34.0   2.8   29  144-174    36-64  (442)
260 CHL00195 ycf46 Ycf46; Provisio  52.9     5.2 0.00011   37.9   0.4   18  154-171   259-276 (489)
261 PRK01297 ATP-dependent RNA hel  52.6     8.5 0.00018   36.0   1.8   26  144-171   116-141 (475)
262 KOG0729|consensus               52.5     7.7 0.00017   34.1   1.3   20  152-171   207-228 (435)
263 KOG1547|consensus               51.9      11 0.00023   32.7   2.1   22  149-170    41-62  (336)
264 PRK09361 radB DNA repair and r  51.8      13 0.00028   30.9   2.6   30  143-172     9-41  (225)
265 TIGR01360 aden_kin_iso1 adenyl  51.7       7 0.00015   31.1   0.9   16  156-171     5-20  (188)
266 PF02534 T4SS-DNA_transf:  Type  51.5      12 0.00026   34.8   2.6   18  155-172    45-62  (469)
267 PRK04040 adenylate kinase; Pro  51.5       7 0.00015   32.0   0.9   17  156-172     4-20  (188)
268 TIGR02322 phosphon_PhnN phosph  51.4     5.6 0.00012   31.7   0.3   16  156-171     3-18  (179)
269 COG1201 Lhr Lhr-like helicases  50.9      11 0.00023   38.1   2.2   25  145-171    30-54  (814)
270 KOG0335|consensus               50.7     7.6 0.00016   36.5   1.1   25  148-174   107-131 (482)
271 cd01983 Fer4_NifH The Fer4_Nif  50.7     6.3 0.00014   27.1   0.5   16  157-172     2-17  (99)
272 PLN00206 DEAD-box ATP-dependen  50.6      12 0.00027   35.5   2.6   24  145-170   151-174 (518)
273 TIGR00064 ftsY signal recognit  50.5     5.7 0.00012   34.6   0.3   18  155-172    73-90  (272)
274 PRK04537 ATP-dependent RNA hel  50.5      11 0.00023   36.5   2.1   25  145-171    39-63  (572)
275 TIGR01817 nifA Nif-specific re  50.5       7 0.00015   37.3   0.8   45  121-171   192-236 (534)
276 TIGR02902 spore_lonB ATP-depen  50.5     9.1  0.0002   36.6   1.6   25  147-171    79-103 (531)
277 TIGR03689 pup_AAA proteasome A  50.3     6.9 0.00015   37.3   0.8   17  155-171   217-233 (512)
278 PRK14532 adenylate kinase; Pro  50.3     8.2 0.00018   31.0   1.1   15  156-170     2-16  (188)
279 TIGR03877 thermo_KaiC_1 KaiC d  50.2      14 0.00029   31.2   2.5   25  145-169     9-36  (237)
280 TIGR03819 heli_sec_ATPase heli  50.0       7 0.00015   35.2   0.8   29  143-172   168-196 (340)
281 COG3842 PotA ABC-type spermidi  50.0     5.6 0.00012   36.0   0.1   14  159-172    36-49  (352)
282 TIGR02173 cyt_kin_arch cytidyl  50.0     7.5 0.00016   30.4   0.8   16  156-171     2-17  (171)
283 PRK06067 flagellar accessory p  49.9      12 0.00026   31.3   2.2   29  143-171    11-42  (234)
284 COG1126 GlnQ ABC-type polar am  49.8       6 0.00013   33.6   0.2   14  158-171    32-45  (240)
285 cd01386 MYSc_type_XVIII Myosin  49.7     8.7 0.00019   38.5   1.4   21  151-171    83-103 (767)
286 PRK11889 flhF flagellar biosyn  49.5     6.1 0.00013   36.7   0.3   18  155-172   242-259 (436)
287 PRK11057 ATP-dependent DNA hel  49.5      11 0.00024   36.6   2.1   25  145-171    33-57  (607)
288 PF10412 TrwB_AAD_bind:  Type I  49.2     5.4 0.00012   36.5  -0.1   17  155-171    16-32  (386)
289 TIGR03158 cas3_cyano CRISPR-as  49.0      13 0.00027   33.6   2.2   27  145-171     5-31  (357)
290 TIGR02788 VirB11 P-type DNA tr  48.9     8.1 0.00018   34.1   1.0   28  144-172   135-162 (308)
291 cd01853 Toc34_like Toc34-like   48.8       7 0.00015   33.5   0.5   20  152-171    29-48  (249)
292 KOG0742|consensus               48.8     8.9 0.00019   35.7   1.2   13  156-168   386-398 (630)
293 cd01379 MYSc_type_III Myosin m  48.6     7.8 0.00017   38.1   0.9   21  151-171    83-103 (653)
294 PRK12726 flagellar biosynthesi  48.6     6.7 0.00015   36.1   0.4   19  155-173   207-225 (407)
295 PRK00771 signal recognition pa  48.5     8.7 0.00019   35.9   1.1   21  153-173    94-114 (437)
296 PRK14974 cell division protein  48.4       8 0.00017   34.8   0.9   19  154-172   140-158 (336)
297 PRK14723 flhF flagellar biosyn  48.3     6.8 0.00015   39.2   0.4   18  155-172   186-203 (767)
298 COG3839 MalK ABC-type sugar tr  48.1     6.3 0.00014   35.5   0.1   14  158-171    33-46  (338)
299 cd02027 APSK Adenosine 5'-phos  47.8       8 0.00017   30.2   0.7   13  157-169     2-14  (149)
300 COG1131 CcmA ABC-type multidru  47.6     6.5 0.00014   34.6   0.1   12  160-171    37-48  (293)
301 cd02025 PanK Pantothenate kina  47.6     4.6  0.0001   33.9  -0.8   12  160-171     5-16  (220)
302 PRK03839 putative kinase; Prov  47.5     8.5 0.00018   30.7   0.8   14  157-170     3-16  (180)
303 PRK14721 flhF flagellar biosyn  47.5     6.5 0.00014   36.5   0.2   18  155-172   192-209 (420)
304 KOG0727|consensus               47.3     9.4  0.0002   33.3   1.1   76  129-205   159-246 (408)
305 TIGR00231 small_GTP small GTP-  47.3     6.5 0.00014   29.3   0.1   17  156-172     3-19  (161)
306 PRK10917 ATP-dependent DNA hel  47.2      12 0.00027   36.8   2.1   21  151-171   279-299 (681)
307 PHA02624 large T antigen; Prov  47.2      11 0.00024   36.8   1.6   27  146-172   421-449 (647)
308 PRK10416 signal recognition pa  47.1       7 0.00015   34.9   0.3   18  155-172   115-132 (318)
309 PRK05342 clpX ATP-dependent pr  47.0     9.1  0.0002   35.5   1.0   18  154-171   108-125 (412)
310 cd03274 ABC_SMC4_euk Eukaryoti  46.9     7.4 0.00016   32.4   0.4   13  159-171    30-42  (212)
311 TIGR02030 BchI-ChlI magnesium   46.9     7.1 0.00015   35.2   0.3   29  145-173    16-44  (337)
312 PRK06696 uridine kinase; Valid  46.9      13 0.00028   31.0   1.9   27  143-169     8-37  (223)
313 COG0563 Adk Adenylate kinase a  46.9     9.4  0.0002   31.0   1.0   13  157-169     3-15  (178)
314 PRK14530 adenylate kinase; Pro  46.6     8.9 0.00019   31.7   0.8   15  156-170     5-19  (215)
315 TIGR01650 PD_CobS cobaltochela  46.5      12 0.00027   33.5   1.7   18  154-171    64-81  (327)
316 PRK06762 hypothetical protein;  46.4      10 0.00022   29.8   1.1   14  156-169     4-17  (166)
317 COG1136 SalX ABC-type antimicr  46.2     6.9 0.00015   33.2   0.1   14  158-171    35-48  (226)
318 TIGR00929 VirB4_CagE type IV s  46.2     7.2 0.00016   38.8   0.2   18  154-171   434-451 (785)
319 cd02023 UMPK Uridine monophosp  46.2     6.9 0.00015   31.8   0.1   14  158-171     3-16  (198)
320 TIGR03881 KaiC_arch_4 KaiC dom  46.1      16 0.00034   30.4   2.2   27  145-171     8-37  (229)
321 PF00931 NB-ARC:  NB-ARC domain  46.1      14 0.00031   31.5   2.1   29  143-171     6-36  (287)
322 cd01394 radB RadB. The archaea  46.0      18  0.0004   29.7   2.6   28  144-171     6-36  (218)
323 KOG0354|consensus               46.0      15 0.00033   36.4   2.4   24  144-170    69-92  (746)
324 TIGR01351 adk adenylate kinase  45.8     9.6 0.00021   31.4   0.9   13  157-169     2-14  (210)
325 COG0630 VirB11 Type IV secreto  45.7     6.9 0.00015   34.8   0.0   20  154-173   143-162 (312)
326 PF00025 Arf:  ADP-ribosylation  45.7      15 0.00032   29.3   2.0   27  145-171     4-31  (175)
327 KOG0735|consensus               45.7     9.5  0.0002   37.9   0.9   18  154-171   701-718 (952)
328 PF10923 DUF2791:  P-loop Domai  45.6      10 0.00022   35.2   1.1   27  145-171    40-66  (416)
329 PRK14527 adenylate kinase; Pro  45.5      11 0.00023   30.6   1.1   17  155-171     7-23  (191)
330 PTZ00014 myosin-A; Provisional  45.4      12 0.00026   37.9   1.6   21  151-171   180-200 (821)
331 smart00488 DEXDc2 DEAD-like he  45.1     9.4  0.0002   33.5   0.8   40  128-173     7-46  (289)
332 smart00489 DEXDc3 DEAD-like he  45.1     9.4  0.0002   33.5   0.8   40  128-173     7-46  (289)
333 PF00485 PRK:  Phosphoribulokin  45.1     9.6 0.00021   31.0   0.8   15  157-171     2-16  (194)
334 PRK14729 miaA tRNA delta(2)-is  44.8      11 0.00024   33.4   1.1   15  156-170     6-20  (300)
335 PF01926 MMR_HSR1:  50S ribosom  44.6      11 0.00025   27.5   1.1   15  157-171     2-16  (116)
336 cd03240 ABC_Rad50 The catalyti  44.6     8.3 0.00018   31.8   0.3   18  156-173    24-41  (204)
337 cd02019 NK Nucleoside/nucleoti  44.5      12 0.00027   25.0   1.1   15  157-171     2-16  (69)
338 PRK10078 ribose 1,5-bisphospho  44.3     8.3 0.00018   31.1   0.3   16  156-171     4-19  (186)
339 COG0606 Predicted ATPase with   44.3     9.9 0.00021   35.8   0.8   22  149-172   195-216 (490)
340 PRK01172 ski2-like helicase; P  44.3      14 0.00031   36.2   2.0   24  145-170    30-53  (674)
341 cd01393 recA_like RecA is a  b  44.0      20 0.00044   29.5   2.6   30  143-172     5-37  (226)
342 PRK09270 nucleoside triphospha  44.0      16 0.00034   30.6   2.0   18  154-171    33-50  (229)
343 KOG0745|consensus               44.0      11 0.00024   35.2   1.1   15  155-169   227-241 (564)
344 KOG2035|consensus               44.0      14  0.0003   32.7   1.6   33  139-171    18-51  (351)
345 PRK12724 flagellar biosynthesi  43.9     8.7 0.00019   35.8   0.4   18  155-172   224-241 (432)
346 TIGR02688 conserved hypothetic  43.8      10 0.00022   35.4   0.8   21  151-173   208-228 (449)
347 TIGR01389 recQ ATP-dependent D  43.8      15 0.00032   35.6   1.9   27  143-171    19-45  (591)
348 PRK10820 DNA-binding transcrip  43.8     9.9 0.00022   36.2   0.8   21  151-171   224-244 (520)
349 PF02367 UPF0079:  Uncharacteri  43.7      13 0.00027   28.5   1.2   19  155-173    16-34  (123)
350 KOG0741|consensus               43.7      13 0.00028   35.8   1.4   15  155-169   257-271 (744)
351 TIGR03263 guanyl_kin guanylate  43.6      12 0.00026   29.7   1.1   15  156-170     3-17  (180)
352 PRK05580 primosome assembly pr  43.3      14  0.0003   36.5   1.7   18  155-172   163-180 (679)
353 TIGR03238 dnd_assoc_3 dnd syst  43.2      13 0.00028   35.3   1.4   28  146-173    18-51  (504)
354 COG1122 CbiO ABC-type cobalt t  43.1      12 0.00026   31.9   1.1   17  155-171    31-47  (235)
355 TIGR01243 CDC48 AAA family ATP  42.9      12 0.00026   37.2   1.2   17  155-171   213-229 (733)
356 COG1137 YhbG ABC-type (unclass  42.8      14 0.00031   31.1   1.5   15  159-173    35-49  (243)
357 PRK15429 formate hydrogenlyase  42.8      11 0.00024   37.2   0.9   22  150-171   395-416 (686)
358 COG0552 FtsY Signal recognitio  42.7      14 0.00029   33.3   1.4   20  152-171   137-156 (340)
359 TIGR00382 clpX endopeptidase C  42.7      12 0.00025   34.8   1.0   17  155-171   117-133 (413)
360 PRK00279 adk adenylate kinase;  42.6      12 0.00025   31.1   0.9   14  157-170     3-16  (215)
361 TIGR01074 rep ATP-dependent DN  42.6      10 0.00022   37.1   0.7   20  154-173    14-33  (664)
362 PF03193 DUF258:  Protein of un  42.5      19 0.00042   28.8   2.1   24  146-171    29-52  (161)
363 PRK10865 protein disaggregatio  42.3      13 0.00027   37.9   1.3   17  155-171   599-615 (857)
364 cd00071 GMPK Guanosine monopho  42.1      13 0.00029   28.5   1.1   14  157-170     2-15  (137)
365 PRK15424 propionate catabolism  42.1      12 0.00025   36.0   0.9   21  150-170   238-258 (538)
366 PRK02496 adk adenylate kinase;  41.8      12 0.00026   29.9   0.9   14  157-170     4-17  (184)
367 TIGR02329 propionate_PrpR prop  41.8      11 0.00024   36.1   0.7   22  150-171   231-252 (526)
368 PF03668 ATP_bind_2:  P-loop AT  41.7      30 0.00064   30.5   3.3   16  156-171     3-18  (284)
369 PRK13721 conjugal transfer ATP  41.6     9.1  0.0002   38.8   0.2   18  154-171   449-466 (844)
370 KOG1534|consensus               41.6      16 0.00035   31.0   1.6   16  155-170     4-19  (273)
371 PRK00300 gmk guanylate kinase;  41.5      15 0.00032   29.9   1.4   17  155-171     6-22  (205)
372 PF08298 AAA_PrkA:  PrkA AAA do  41.4      30 0.00065   31.4   3.4   48  146-201    77-142 (358)
373 cd03279 ABC_sbcCD SbcCD and ot  41.4      10 0.00022   31.4   0.4   17  156-172    30-46  (213)
374 cd00227 CPT Chloramphenicol (C  40.9      13 0.00027   29.7   0.8   16  156-171     4-19  (175)
375 KOG0736|consensus               40.9      14  0.0003   37.1   1.2   23  185-207   783-805 (953)
376 TIGR01243 CDC48 AAA family ATP  40.9      13 0.00028   37.0   1.1   17  155-171   488-504 (733)
377 PRK14528 adenylate kinase; Pro  40.9      13 0.00028   30.2   0.9   16  156-171     3-18  (186)
378 TIGR00643 recG ATP-dependent D  40.8      17 0.00038   35.4   2.0   20  152-171   254-273 (630)
379 TIGR00235 udk uridine kinase.   40.6      13 0.00027   30.6   0.8   16  156-171     8-23  (207)
380 TIGR03878 thermo_KaiC_2 KaiC d  40.6      16 0.00034   31.5   1.4   16  154-169    36-51  (259)
381 PHA02530 pseT polynucleotide k  40.6      13 0.00029   32.2   1.1   15  156-170     4-18  (300)
382 PLN02200 adenylate kinase fami  40.5      13 0.00028   31.5   0.9   16  155-170    44-59  (234)
383 PHA02774 E1; Provisional        40.1      19 0.00042   34.9   2.1   26  146-171   424-451 (613)
384 PTZ00301 uridine kinase; Provi  40.0     9.3  0.0002   31.9  -0.1   12  160-171     9-20  (210)
385 TIGR03880 KaiC_arch_3 KaiC dom  39.9      24 0.00051   29.3   2.4   26  146-171     5-33  (224)
386 PRK10867 signal recognition pa  39.8      15 0.00032   34.4   1.2   19  154-172   100-118 (433)
387 PRK13889 conjugal transfer rel  39.8      14 0.00031   38.1   1.2   27  145-172   354-380 (988)
388 TIGR00390 hslU ATP-dependent p  39.5      14  0.0003   34.5   0.9   17  155-171    48-64  (441)
389 TIGR00602 rad24 checkpoint pro  39.4     8.5 0.00018   37.7  -0.4   16  156-171   112-127 (637)
390 PF09439 SRPRB:  Signal recogni  39.3      16 0.00035   29.8   1.3   17  155-171     4-20  (181)
391 KOG1532|consensus               39.3      13 0.00029   32.7   0.8   20  153-172    18-37  (366)
392 TIGR02238 recomb_DMC1 meiotic   39.2      28 0.00061   30.9   2.9   29  143-171    82-113 (313)
393 PF05872 DUF853:  Bacterial pro  39.2      11 0.00024   35.4   0.3   15  159-173    24-38  (502)
394 CHL00176 ftsH cell division pr  39.0      13 0.00029   36.4   0.9   17  155-171   217-233 (638)
395 COG4096 HsdR Type I site-speci  38.9      24 0.00052   35.5   2.5   31  141-172   173-203 (875)
396 PRK08533 flagellar accessory p  38.9      16 0.00034   30.9   1.2   17  155-171    25-41  (230)
397 cd03115 SRP The signal recogni  38.9      12 0.00025   29.7   0.4   16  157-172     3-18  (173)
398 PRK06851 hypothetical protein;  38.8      15 0.00032   33.6   1.0   28  145-172    21-48  (367)
399 PF01745 IPT:  Isopentenyl tran  38.8      15 0.00034   31.1   1.1   14  157-170     4-17  (233)
400 TIGR02639 ClpA ATP-dependent C  38.7      10 0.00022   37.7   0.0   31  144-174   193-223 (731)
401 TIGR03574 selen_PSTK L-seryl-t  38.6      14  0.0003   31.3   0.8   16  157-172     2-17  (249)
402 PRK04296 thymidine kinase; Pro  38.6     8.3 0.00018   31.5  -0.6   18  156-173     4-21  (190)
403 PRK14962 DNA polymerase III su  38.5      15 0.00033   34.7   1.1   22  150-171    31-53  (472)
404 TIGR02236 recomb_radA DNA repa  38.5      26 0.00056   30.8   2.5   28  144-171    82-112 (310)
405 PRK14961 DNA polymerase III su  38.5      11 0.00025   34.0   0.3   18  154-171    38-55  (363)
406 PRK14970 DNA polymerase III su  38.3      16 0.00035   32.8   1.2   27  145-171    29-56  (367)
407 PRK09825 idnK D-gluconate kina  38.3      16 0.00034   29.5   1.0   16  156-171     5-20  (176)
408 TIGR02397 dnaX_nterm DNA polym  38.2      16 0.00034   32.5   1.1   24  148-171    29-53  (355)
409 PRK13949 shikimate kinase; Pro  38.2      15 0.00033   29.3   0.9   16  156-171     3-18  (169)
410 COG0467 RAD55 RecA-superfamily  38.1      18 0.00039   30.8   1.4   25  146-170    12-39  (260)
411 PRK12727 flagellar biosynthesi  38.0      12 0.00026   36.0   0.3   17  155-171   351-367 (559)
412 cd00544 CobU Adenosylcobinamid  38.0      17 0.00036   29.3   1.1   14  157-170     2-15  (169)
413 TIGR00959 ffh signal recogniti  38.0      15 0.00033   34.2   1.0   18  154-171    99-116 (428)
414 PRK09302 circadian clock prote  38.0      24 0.00052   33.4   2.4   29  143-171    17-48  (509)
415 TIGR01587 cas3_core CRISPR-ass  37.9      16 0.00036   32.5   1.2   15  157-171     2-16  (358)
416 PRK13891 conjugal transfer pro  37.9      12 0.00025   38.1   0.3   18  154-171   488-505 (852)
417 KOG0922|consensus               37.8      20 0.00043   35.1   1.8   18  154-171    66-83  (674)
418 PRK13873 conjugal transfer ATP  37.7      13 0.00028   37.5   0.5   17  155-171   442-458 (811)
419 KOG0924|consensus               37.6      19 0.00042   35.6   1.7   20  152-171   369-388 (1042)
420 PRK11664 ATP-dependent RNA hel  37.6      21 0.00045   36.2   1.9   28  143-172    11-38  (812)
421 KOG2655|consensus               37.5      23  0.0005   32.3   2.0   23  148-170    15-37  (366)
422 KOG0328|consensus               37.5      29 0.00063   30.8   2.6   24  146-171    58-81  (400)
423 cd03272 ABC_SMC3_euk Eukaryoti  37.5      13 0.00028   31.2   0.4   15  157-171    26-40  (243)
424 PF02463 SMC_N:  RecF/RecN/SMC   37.3      18 0.00038   29.8   1.2   16  156-171    26-41  (220)
425 PRK05800 cobU adenosylcobinami  37.2      17 0.00037   29.2   1.1   15  156-170     3-17  (170)
426 PRK05057 aroK shikimate kinase  37.1      19 0.00041   28.8   1.3   16  156-171     6-21  (172)
427 COG0396 sufC Cysteine desulfur  37.1      19  0.0004   30.9   1.3   29  148-176    18-55  (251)
428 COG4185 Uncharacterized protei  37.1      22 0.00048   28.9   1.6   16  157-173     6-21  (187)
429 cd02028 UMPK_like Uridine mono  37.0      16 0.00034   29.5   0.8   15  157-171     2-16  (179)
430 PF13481 AAA_25:  AAA domain; P  36.9      16 0.00034   29.3   0.8   17  156-172    34-50  (193)
431 PRK05541 adenylylsulfate kinas  36.8      17 0.00037   28.8   1.0   16  156-171     9-24  (176)
432 PRK11545 gntK gluconate kinase  36.7      11 0.00023   29.9  -0.2   13  160-172     1-13  (163)
433 PRK11034 clpA ATP-dependent Cl  36.7      22 0.00047   35.7   1.9   35  134-169   463-503 (758)
434 KOG0925|consensus               36.6      21 0.00045   34.0   1.6   20  152-171    60-79  (699)
435 TIGR02655 circ_KaiC circadian   36.5      27 0.00058   33.0   2.4   26  144-169     8-36  (484)
436 TIGR01425 SRP54_euk signal rec  36.5      15 0.00034   34.2   0.8   19  154-172   100-118 (429)
437 PF05707 Zot:  Zonular occluden  36.5      15 0.00033   29.9   0.7   16  157-172     3-18  (193)
438 PRK00091 miaA tRNA delta(2)-is  36.4      18 0.00038   32.2   1.1   15  156-170     6-20  (307)
439 PRK13853 type IV secretion sys  36.3      12 0.00025   37.7  -0.1   17  155-171   427-443 (789)
440 PRK01184 hypothetical protein;  36.3      16 0.00035   29.1   0.8   15  156-170     3-17  (184)
441 TIGR03783 Bac_Flav_CT_G Bacter  36.2      12 0.00026   38.0  -0.0   18  154-171   438-455 (829)
442 PRK13880 conjugal transfer cou  36.1      25 0.00053   34.6   2.2   19  154-172   175-193 (636)
443 TIGR01447 recD exodeoxyribonuc  36.0      13 0.00028   36.1   0.2   25  146-172   154-178 (586)
444 PLN03187 meiotic recombination  36.0      32  0.0007   31.1   2.8   30  142-171   111-143 (344)
445 PRK05480 uridine/cytidine kina  35.8      17 0.00036   29.8   0.8   16  156-171     8-23  (209)
446 COG0464 SpoVK ATPases of the A  35.8      17 0.00036   34.3   0.9   54  152-205   274-333 (494)
447 TIGR02012 tigrfam_recA protein  35.7      30 0.00066   30.9   2.5   30  142-171    39-72  (321)
448 PRK04182 cytidylate kinase; Pr  35.7      17 0.00037   28.6   0.8   14  157-170     3-16  (180)
449 KOG0743|consensus               35.6      16 0.00035   34.1   0.8   14  158-171   239-252 (457)
450 PF01078 Mg_chelatase:  Magnesi  35.6      19  0.0004   30.2   1.1   18  155-172    23-40  (206)
451 PRK11131 ATP-dependent RNA hel  35.5      17 0.00038   38.5   1.1   22  149-171    85-106 (1294)
452 PRK13767 ATP-dependent helicas  35.5      24 0.00051   36.1   2.0   25  145-171    40-64  (876)
453 COG0324 MiaA tRNA delta(2)-iso  35.4      19 0.00041   32.0   1.2   16  156-171     5-20  (308)
454 TIGR00174 miaA tRNA isopenteny  35.4      19 0.00041   31.7   1.1   15  157-171     2-16  (287)
455 TIGR02759 TraD_Ftype type IV c  35.3      13 0.00028   35.9   0.1   15  156-170   178-192 (566)
456 PRK05416 glmZ(sRNA)-inactivati  35.3      13 0.00028   32.8   0.0   18  156-173     8-25  (288)
457 PRK13531 regulatory ATPase Rav  35.3      18 0.00039   34.4   1.0   25  145-171    32-56  (498)
458 cd01876 YihA_EngB The YihA (En  35.2      13 0.00028   28.3   0.0   16  157-172     2-17  (170)
459 PRK06645 DNA polymerase III su  35.0      18 0.00039   34.5   1.0   23  149-171    37-60  (507)
460 TIGR00176 mobB molybdopterin-g  35.0      13 0.00029   29.3   0.1   14  158-171     3-16  (155)
461 PTZ00088 adenylate kinase 1; P  34.9      18 0.00039   30.6   0.9   13  157-169     9-21  (229)
462 cd03238 ABC_UvrA The excision   34.9      13 0.00029   30.0   0.1   14  158-171    25-38  (176)
463 TIGR02768 TraA_Ti Ti-type conj  34.7      19 0.00041   36.0   1.1   27  146-173   361-387 (744)
464 PF00005 ABC_tran:  ABC transpo  34.7      22 0.00048   26.6   1.3   16  156-171    13-28  (137)
465 PTZ00110 helicase; Provisional  34.5      24 0.00052   33.9   1.8   25  145-171   160-184 (545)
466 cd01860 Rab5_related Rab5-rela  34.5      24 0.00051   27.0   1.5   17  155-171     2-18  (163)
467 PRK15483 type III restriction-  34.4     9.1  0.0002   39.3  -1.1   15  160-174    65-79  (986)
468 PRK13946 shikimate kinase; Pro  34.3      19 0.00042   29.0   1.0   17  155-171    11-27  (184)
469 cd01864 Rab19 Rab19 subfamily.  34.3      25 0.00054   27.1   1.6   17  155-171     4-20  (165)
470 PRK09401 reverse gyrase; Revie  34.1      27 0.00059   36.8   2.2   24  145-170    88-111 (1176)
471 PRK04301 radA DNA repair and r  34.1      34 0.00074   30.2   2.6   29  144-172    89-120 (317)
472 cd02022 DPCK Dephospho-coenzym  34.0      19  0.0004   28.9   0.8   15  157-171     2-16  (179)
473 cd04139 RalA_RalB RalA/RalB su  33.8      21 0.00046   27.2   1.1   15  157-171     3-17  (164)
474 COG4650 RtcR Sigma54-dependent  33.7      21 0.00046   31.8   1.2   36  134-170   189-224 (531)
475 cd01852 AIG1 AIG1 (avrRpt2-ind  33.4      18 0.00038   29.4   0.6   16  156-171     2-17  (196)
476 PF13304 AAA_21:  AAA domain; P  33.4      14  0.0003   29.9   0.0   15  159-173     4-18  (303)
477 PLN02165 adenylate isopentenyl  33.3      21 0.00045   32.2   1.0   16  156-171    45-60  (334)
478 COG4525 TauB ABC-type taurine   33.3      22 0.00048   30.0   1.1   16  156-171    33-48  (259)
479 cd00876 Ras Ras family.  The R  33.3      22 0.00047   26.9   1.1   15  157-171     2-16  (160)
480 PRK13947 shikimate kinase; Pro  33.2      20 0.00044   28.1   0.9   15  156-170     3-17  (171)
481 PRK13830 conjugal transfer pro  33.1      16 0.00034   37.0   0.3   18  154-171   456-473 (818)
482 PRK11608 pspF phage shock prot  33.1      20 0.00042   32.0   0.9   20  152-171    27-46  (326)
483 PRK05973 replicative DNA helic  33.1      31 0.00068   29.4   2.1   26  146-171    54-81  (237)
484 PF04670 Gtr1_RagA:  Gtr1/RagA   33.0      22 0.00047   30.3   1.1   13  157-169     2-14  (232)
485 TIGR00678 holB DNA polymerase   33.0      37 0.00081   27.2   2.5   24  148-171     7-31  (188)
486 KOG1970|consensus               32.9      18 0.00039   34.8   0.6   16  156-171   112-127 (634)
487 PRK14952 DNA polymerase III su  32.7      19 0.00041   35.0   0.8   23  149-171    29-52  (584)
488 COG0513 SrmB Superfamily II DN  32.6      26 0.00056   33.4   1.6   25  145-171    59-83  (513)
489 PF01293 PEPCK_ATP:  Phosphoeno  32.6      24 0.00052   33.3   1.4   20  156-175   212-238 (466)
490 PRK05201 hslU ATP-dependent pr  32.5      20 0.00043   33.5   0.8   16  155-170    51-66  (443)
491 KOG3354|consensus               32.5      29 0.00062   28.1   1.6   19  151-169     9-27  (191)
492 KOG0923|consensus               32.5      27 0.00059   34.5   1.7   19  153-171   279-297 (902)
493 cd04164 trmE TrmE (MnmE, ThdF,  32.5      16 0.00034   27.6   0.1   15  157-171     4-18  (157)
494 TIGR03345 VI_ClpV1 type VI sec  32.3      30 0.00064   35.3   2.1   17  155-171   597-613 (852)
495 PF11406 Tachystatin_A:  Antimi  32.3      10 0.00022   22.5  -0.7   15  149-163     5-19  (44)
496 PRK00625 shikimate kinase; Pro  32.2      21 0.00045   28.8   0.8   15  156-170     2-16  (173)
497 cd03278 ABC_SMC_barmotin Barmo  32.2      16 0.00034   30.0   0.1   15  158-172    26-40  (197)
498 PF02702 KdpD:  Osmosensitive K  32.1      15 0.00033   30.7   0.0   19  156-174     7-25  (211)
499 TIGR01613 primase_Cterm phage/  32.0      10 0.00022   33.3  -1.1   29  143-171    62-93  (304)
500 PRK03731 aroL shikimate kinase  32.0      23  0.0005   27.8   1.0   16  156-171     4-19  (171)

No 1  
>KOG0243|consensus
Probab=100.00  E-value=3.7e-40  Score=317.50  Aligned_cols=160  Identities=49%  Similarity=0.867  Sum_probs=140.6

Q ss_pred             CCcccCCCcchhhcccceeeeecCC-ceEEEEecCCCC-CcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSS-SREITIKERVND-KISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTV  157 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~-~~ti~v~~~~~~-~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i  157 (243)
                      +.||+||++.+|...++..+|.+++ ++.|.+...... ...|+|+||+||+|.+.|.++|+.++.|+|+.++.||||||
T Consensus        53 VivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~GyNCTI  132 (1041)
T KOG0243|consen   53 VIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLEGYNCTI  132 (1041)
T ss_pred             EEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHHhccCCceE
Confidence            5689999999999889999999998 566888766332 36889999999999999999999999999999999999999


Q ss_pred             EEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCC-c
Q psy9445         158 FAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-T  236 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~-~  236 (243)
                      |||||||+||||||.|.....   .|..++.+|||||++.+||..++... ..|.|+|||+|+|||.++|||+|+... .
T Consensus       133 FAYGQTGTGKTyTMeG~~~~~---~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~~~~~~  208 (1041)
T KOG0243|consen  133 FAYGQTGTGKTYTMEGGERKK---NGELPSEAGIIPRALRQIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASEDTSDK  208 (1041)
T ss_pred             EEecCCCCCceeeeecCcccc---cCCCCccCCcchHHHHHHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCcccccc
Confidence            999999999999999975422   36677889999999999999999744 789999999999999999999998765 6


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      .+++++|
T Consensus       209 ~~~~k~~  215 (1041)
T KOG0243|consen  209 KLRIKDD  215 (1041)
T ss_pred             ccccccC
Confidence            7777654


No 2  
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=100.00  E-value=3.1e-38  Score=282.28  Aligned_cols=151  Identities=40%  Similarity=0.687  Sum_probs=131.6

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCC----------CCcceEEecceeecCCCcchhhhccccchhHHHH
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVN----------DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEV  149 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~----------~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~  149 (243)
                      ..+|+||+...|...+...+|.+.++..+.+.+...          ...++.|.||+||+++++|.+||+.++.|+|+.+
T Consensus         4 V~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vf~~~~~plv~~~   83 (338)
T cd01370           4 VAVRVRPFNEKEKQEGTRRVVKVVDDRMLVFDPKDEEDAFRNLRARRNKELKYSFDRVFDETSTQEEVYENTTKPLVDGV   83 (338)
T ss_pred             EEEEcCCCChhhhhcCCceEEEEcCCCEEEEcCCcccccccchhcccCCceEEEeccccCCCCCHHHHHHHHHHHHHHHH
Confidence            578999999999877777888888877766655432          2346899999999999999999999999999999


Q ss_pred             hcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcC-CceEEEEEEEEEEECCeEEeC
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLG-DAEFTVRVSFLEIYNEELIDL  228 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~-~~~~~v~~S~~eiyne~v~DL  228 (243)
                      ++|||+||||||||||||||||+|+...           +|||||++++||+.++... +..|.|++||+|||||+|+||
T Consensus        84 ~~G~n~~i~ayGqtGSGKTyTm~G~~~~-----------~Giipr~~~~LF~~i~~~~~~~~~~v~vS~~EIyne~v~DL  152 (338)
T cd01370          84 LNGYNATVFAYGATGAGKTHTMLGTDSD-----------PGLMVLTMKDLFDKIEERKDDKEFEVSLSYLEIYNETIRDL  152 (338)
T ss_pred             HCCCCceEEeeCCCCCCCeEEEcCCCCC-----------CchHHHHHHHHHHhhhhcccCceEEEEEEEEEEECCEEEEC
Confidence            9999999999999999999999998643           4999999999999998754 678999999999999999999


Q ss_pred             CCCCCCCccceecCC
Q psy9445         229 LSPTDDITKLRLKKN  243 (243)
Q Consensus       229 L~~~~~~~~l~i~e~  243 (243)
                      |++.  ..+|+|+||
T Consensus       153 L~~~--~~~l~i~ed  165 (338)
T cd01370         153 LSPS--SGPLELRED  165 (338)
T ss_pred             CCCC--CCCceEEEc
Confidence            9985  456777775


No 3  
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=100.00  E-value=2.1e-37  Score=277.52  Aligned_cols=149  Identities=30%  Similarity=0.576  Sum_probs=129.3

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCC----------CCcceEEecceeecCCCcchhhhccccchhHHH
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVN----------DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDE  148 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~----------~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~  148 (243)
                      +..+|+||+...|...+...+|.+.++.++.+.++..          ...++.|.||+||+++++|++||+.++.|+|+.
T Consensus         4 ~V~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~tq~~vy~~~~~p~v~~   83 (345)
T cd01368           4 KVYLRVRPLSKDELESEDEGCIEVINSTTIQLHPPKGSAARKSERNGGQKETKFSFSKVFGPNTTQKEFFEGTALPLVQD   83 (345)
T ss_pred             EEEEEeCcCCchhhccCCCceEEEcCCCEEEEeCCccccccccccccCCCceEeecCeEECCCCCHHHHHHHHHHHHHHH
Confidence            3578999999998766666677777778888776543          235789999999999999999999999999999


Q ss_pred             HhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeC
Q psy9445         149 VLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDL  228 (243)
Q Consensus       149 ~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DL  228 (243)
                      +++|+|+||||||||||||||||+|....           +|||||++++||+.+..     |.|.+||+|||||+|+||
T Consensus        84 ~l~G~n~ti~aYGqtGSGKTyTm~G~~~~-----------~Gli~r~~~~lF~~~~~-----~~v~~S~~EIyne~v~DL  147 (345)
T cd01368          84 LLKGKNSLLFTYGVTNSGKTYTMQGSPGD-----------GGILPRSLDVIFNSIGG-----YSVFVSYVEIYNNYIYDL  147 (345)
T ss_pred             HhCCCceEEEEeCCCCCCCeEEecCCCCC-----------CchHHHHHHHHHHHHHh-----eeEEEEEEEEeCCEeEeC
Confidence            99999999999999999999999998643           49999999999999875     899999999999999999


Q ss_pred             CCCCCC----CccceecCC
Q psy9445         229 LSPTDD----ITKLRLKKN  243 (243)
Q Consensus       229 L~~~~~----~~~l~i~e~  243 (243)
                      |++.+.    ..+++|+||
T Consensus       148 L~~~~~~~~~~~~l~i~ed  166 (345)
T cd01368         148 LEDSPSSTKKRQSLRLRED  166 (345)
T ss_pred             CCCccccccCCCceEEEEC
Confidence            998653    356888775


No 4  
>KOG0245|consensus
Probab=100.00  E-value=2.9e-38  Score=300.73  Aligned_cols=155  Identities=30%  Similarity=0.532  Sum_probs=133.6

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecC-------CCcchhhhccccchhHHHHhc
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQ-------ESKQVDVYKYVVNPLIDEVLS  151 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~-------~a~q~ev~~~~~~~~v~~~~~  151 (243)
                      ...||+||++.+|....+.++|.+.++.+..+.+...... ..|+||+.|+.       .|+|..||+.+..++++.+|+
T Consensus         7 ~VAVRVRPfn~rE~s~~~k~Vvqm~gn~ttii~~~~~k~~-~~FtfD~SYWS~d~edPhfAsQ~qVYedlg~~mL~~AfE   85 (1221)
T KOG0245|consen    7 KVAVRVRPFNAREKSRDAKCVVQMQGNTTTIINPKGSKDA-PKFTFDYSYWSHDSEDPHFASQKQVYEDLGREMLDHAFE   85 (1221)
T ss_pred             EEEEEeccchhhhhhcccceEEEecCCceeeecCCCcccC-CceecceeeecCCCCCCchhhHHHHHHHHhHHHHHHHhc
Confidence            3568999999999999999999999887666665544333 34999999954       578999999999999999999


Q ss_pred             CCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHh--cCCceEEEEEEEEEEECCeEEeCC
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRL--LGDAEFTVRVSFLEIYNEELIDLL  229 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~--~~~~~~~v~~S~~eiyne~v~DLL  229 (243)
                      |||+||||||||||||||||+|.++.         .++|||||.|++||++|..  ..+..|.|.|||+|||||+|+|||
T Consensus        86 GYN~ClFAYGQTGSGKSYTMMG~~~~---------~e~GIIPrlCEeLF~ri~~nq~~~~sy~VevSymEIYcErVrDLL  156 (1221)
T KOG0245|consen   86 GYNVCLFAYGQTGSGKSYTMMGFQEP---------DEPGIIPRLCEELFSRIADNQSQQMSYSVEVSYMEIYCERVRDLL  156 (1221)
T ss_pred             ccceEEEEeccCCCCcceeeeccCCC---------CCCCchhHHHHHHHHHHhhcccccceEEEEEeehhHHHHHHHHHh
Confidence            99999999999999999999998631         2369999999999999987  345689999999999999999999


Q ss_pred             CCCCCCccceecCC
Q psy9445         230 SPTDDITKLRLKKN  243 (243)
Q Consensus       230 ~~~~~~~~l~i~e~  243 (243)
                      +..+....||+||+
T Consensus       157 ~~p~~kg~LRVREH  170 (1221)
T KOG0245|consen  157 NAPKSKGGLRVREH  170 (1221)
T ss_pred             hCCCCCCCceeecc
Confidence            94457788999986


No 5  
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=100.00  E-value=8.5e-37  Score=272.90  Aligned_cols=156  Identities=37%  Similarity=0.640  Sum_probs=125.3

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVF  158 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~  158 (243)
                      +..+|+||+...|...+...++...++.++.+...    ..+.|.||+||+++++|++||+.++.|+|+.+++|||+|||
T Consensus         4 ~V~vRvRP~~~~e~~~~~~~~v~~~~~~~~~~~~~----~~~~f~FD~vf~~~~~q~~vy~~~~~p~v~~~~~G~n~ti~   79 (337)
T cd01373           4 KVVVRIRPPNEIEADGGQGQCLKKLSSDTLVWHSH----PPRMFTFDHVADSNTNQEDVFQSVGKPLVEDCLSGYNGSIF   79 (337)
T ss_pred             EEEEEcCcCChhhcccCCCeEEEEcCCCcEEeeCC----CCcEEeCCeEeCCCCCHHHHHHHHHHHHHHHHhCCCceeEE
Confidence            35689999999887555555555555555554432    25799999999999999999999999999999999999999


Q ss_pred             EeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc-----CCceEEEEEEEEEEECCeEEeCCCCCC
Q psy9445         159 AYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL-----GDAEFTVRVSFLEIYNEELIDLLSPTD  233 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~-----~~~~~~v~~S~~eiyne~v~DLL~~~~  233 (243)
                      |||||||||||||+|+......   .....+|||||++++||+.++..     .+..|.|.+||+|||||+|+|||+|..
T Consensus        80 aYGqTGSGKTyTm~G~~~~~~~---~~~~~~Giipr~~~~Lf~~i~~~~~~~~~~~~~~v~~S~~EIyne~v~DLL~~~~  156 (337)
T cd01373          80 AYGQTGSGKTYTMMGPSSSDDE---SPHGLQGVIPRIFEYLFSLIQREEEKRGDGLKFLCKCSFLEIYNEQITDLLDPTS  156 (337)
T ss_pred             EeCCCCCCceEEecCCCCcccc---ccccCCCHHHHHHHHHHHHHHhhhhhcccCceEEEEEEEEeecCCEeeeCCCCCC
Confidence            9999999999999997543210   12345799999999999988753     345799999999999999999998854


Q ss_pred             CCccceecCC
Q psy9445         234 DITKLRLKKN  243 (243)
Q Consensus       234 ~~~~l~i~e~  243 (243)
                        ..++|+||
T Consensus       157 --~~l~i~e~  164 (337)
T cd01373         157 --RNLKIRED  164 (337)
T ss_pred             --CCceEEEC
Confidence              45777764


No 6  
>KOG4280|consensus
Probab=100.00  E-value=6.5e-38  Score=290.02  Aligned_cols=153  Identities=45%  Similarity=0.758  Sum_probs=127.5

Q ss_pred             CCcccCCCcchhhcccceeeeecCCce-EEEEecCCC--CCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSR-EITIKERVN--DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCT  156 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~-ti~v~~~~~--~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~  156 (243)
                      ..+++||+...+.......++.++... .+.+.++..  .+.+++|+||.||+++++|.+||+.++.|+|+++++|||+|
T Consensus         9 vvvr~rPl~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~GyNgt   88 (574)
T KOG4280|consen    9 VVVRVRPLSAAERSELLKSILSVDPAHGRVSLKNPVAGIEGKPKSFTFDAVFDSDSTQDDVYQETVAPLVESVLEGYNGT   88 (574)
T ss_pred             EEEeecCCCchhhhhhhccccccccccceeeecCCcccccCCCCCceeeeeecCCCCHHHHHHHHhHHHHHHHhcccCce
Confidence            467899999987766655555555443 455555443  35778899999999999999999999999999999999999


Q ss_pred             EEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcC-CceEEEEEEEEEEECCeEEeCCCCCCCC
Q psy9445         157 VFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLG-DAEFTVRVSFLEIYNEELIDLLSPTDDI  235 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~-~~~~~v~~S~~eiyne~v~DLL~~~~~~  235 (243)
                      |||||||||||||||+|+.  +        ...|||||++.+||..|+..+ ...|.|+|||+|||||+|+|||+|... 
T Consensus        89 vFaYGQTGsGKTyTM~G~~--~--------~~~GiiPraf~~LF~~I~~~~~~~~f~vrvS~lEiYnE~i~DLL~~~~~-  157 (574)
T KOG4280|consen   89 VFAYGQTGSGKTYTMIGPD--P--------ELRGLIPRAFEHLFRHIDERKEKTRFLVRVSYLEIYNESIRDLLSPVNP-  157 (574)
T ss_pred             EEEeccCCCCCceEeeCCC--h--------hhCCchhHHHHHHHHHHHhccccceEEEEeehHHHHhHHHHHHhCccCc-
Confidence            9999999999999999982  2        347999999999999999854 346999999999999999999999653 


Q ss_pred             ccceecCC
Q psy9445         236 TKLRLKKN  243 (243)
Q Consensus       236 ~~l~i~e~  243 (243)
                      ..|+|+||
T Consensus       158 ~~l~lre~  165 (574)
T KOG4280|consen  158 KGLELRED  165 (574)
T ss_pred             CCceeeEc
Confidence            66777765


No 7  
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=100.00  E-value=1.6e-36  Score=273.08  Aligned_cols=153  Identities=36%  Similarity=0.637  Sum_probs=131.8

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCC----CCcceEEecceeecCC-------CcchhhhccccchhHH
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVN----DKISKTFGFDRVFSQE-------SKQVDVYKYVVNPLID  147 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~----~~~~~~f~fD~vF~~~-------a~q~ev~~~~~~~~v~  147 (243)
                      +..+|+||+...|...+...++.+.+ +.+.+..+..    ....++|.||+||++.       ++|++||+.++.|+|+
T Consensus         4 ~V~vRvRP~~~~E~~~~~~~~~~~~~-~~v~v~~~~~~~~~~~~~~~f~FD~vf~~~~~~~~~~~tq~~vf~~~~~p~v~   82 (356)
T cd01365           4 KVAVRVRPFNSREKNRGSKCIVQMPG-KVTTLKNPKAADATRKKPKSFSFDHSYWSHDSEDPHYASQEDVFEDLGRELLD   82 (356)
T ss_pred             EEEEEeCcCChhhhccCCceEEEECC-CEEEEEcCCcccccccCceEEECCeEecccCCCCCCCCCHHHHHHHHHHHHHH
Confidence            35689999999998888888888877 6666665543    3467899999999998       9999999999999999


Q ss_pred             HHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcC--CceEEEEEEEEEEECCeE
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLG--DAEFTVRVSFLEIYNEEL  225 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~--~~~~~v~~S~~eiyne~v  225 (243)
                      .+++|+|+||||||||||||||||+|....           .|||||++++||+.++...  ...|.|.+||+|||||+|
T Consensus        83 ~~l~G~n~~i~ayGqtGSGKT~Tm~G~~~~-----------~Gli~r~~~~Lf~~~~~~~~~~~~~~v~~S~~EIy~e~v  151 (356)
T cd01365          83 HAFEGYNVCLFAYGQTGSGKSYTMMGYKEE-----------KGIIPRLCEELFQRIESKKEQNLSYEVEVSYMEIYNEKV  151 (356)
T ss_pred             HHhCCCceEEEEecCCCCCCeEEecCCCCC-----------CchHHHHHHHHHHHHhhccccCceEEEEEEEEEEECCee
Confidence            999999999999999999999999998542           4999999999999998743  468999999999999999


Q ss_pred             EeCCCCCC-CCccceecCC
Q psy9445         226 IDLLSPTD-DITKLRLKKN  243 (243)
Q Consensus       226 ~DLL~~~~-~~~~l~i~e~  243 (243)
                      +|||++.. ....++|+||
T Consensus       152 ~DLL~~~~~~~~~l~i~~~  170 (356)
T cd01365         152 RDLLNPKKKNKGNLKVREH  170 (356)
T ss_pred             eeCCCCCccCCcCceEEEC
Confidence            99999875 4456777764


No 8  
>KOG0242|consensus
Probab=100.00  E-value=6.9e-37  Score=291.99  Aligned_cols=151  Identities=44%  Similarity=0.737  Sum_probs=128.9

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCCC---CcceEEecceeecCCCcchhhhccccchhHHHHhcCCceE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVND---KISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCT  156 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~---~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~  156 (243)
                      ..|++||++..+...+..+.+.+..+..+...-....   ..+..|.||+||+++++|.+||+..+.|+|.+++.|+|+|
T Consensus        10 V~vrvRP~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~y~FD~VF~~~~t~~~VYe~~tkpiv~~~l~G~N~T   89 (675)
T KOG0242|consen   10 VSVRVRPLNEREDARGDRSDWHCINDTTLFKRVTKSLPEKSKPEKYEFDRVFGEESTQEDVYERTTKPLLLSVLEGFNAT   89 (675)
T ss_pred             EEEEeCCCCccccccCCccceEecCCceeEeeccccccccccccceeeeeecCCCCCHHHHHHhccHHHHHHHhcCcccc
Confidence            5688999999866656666666666665544322221   1157999999999999999999999999999999999999


Q ss_pred             EEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCCc
Q psy9445         157 VFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDIT  236 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~~  236 (243)
                      |||||||||||||||.|....|           ||||+++++||+.|....++.|.|.+||+|||||.|+|||+|+.  .
T Consensus        90 VFAYG~TgSGKTyTM~G~~~~P-----------Gii~la~~dif~~I~~~~~r~f~v~vSYlEIYNE~I~DLL~~~~--~  156 (675)
T KOG0242|consen   90 VFAYGQTGSGKTYTMSGSEDDP-----------GIIPLAMKDIFEKIDKSGEREFSVRVSYLEIYNERIRDLLNPDG--G  156 (675)
T ss_pred             eeeecCCCCCCceEEeccCCCC-----------CeeehHHHHHHHHHHhcCCceeEEEEEEEEEeccccccccCCCC--C
Confidence            9999999999999999987644           99999999999999998899999999999999999999999965  4


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      .|+|+||
T Consensus       157 ~L~irED  163 (675)
T KOG0242|consen  157 DLRLRED  163 (675)
T ss_pred             CceEeEc
Confidence            4888886


No 9  
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=100.00  E-value=1.1e-36  Score=270.62  Aligned_cols=150  Identities=37%  Similarity=0.603  Sum_probs=129.4

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCC------CcceEEecceeecCCCcchhhhccccchhHHHHhcC
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVND------KISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSG  152 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~------~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G  152 (243)
                      +..+|+||+...|...+...++.+.+++++.+.++...      ...++|.||+||++.++|++||+.++.|+|+.+++|
T Consensus         4 ~V~vRvRP~~~~e~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vf~~~~~plv~~~~~G   83 (322)
T cd01367           4 TVAVRKRPLNDKELSKGETDVVSCESNPTVTVHEPKTKVDLTKYIEKHTFRFDYVFDEAVTNEEVYRSTVKPLIPHVFEG   83 (322)
T ss_pred             EEEEEcCcCChhhhccCCceEEEECCCCEEEEecCccccccccccCCceEecceEECCCCCHHHHHHHHHHHHHHHHhCC
Confidence            35689999999998777777887777777877754322      136799999999999999999999999999999999


Q ss_pred             CceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCC
Q psy9445         153 YNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPT  232 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~  232 (243)
                      +|+||||||||||||||||+|+...           +|||||++++||+.++... ..|.|++||+|||||+|+|||++.
T Consensus        84 ~n~~i~ayGqtGSGKTyTm~G~~~~-----------~Glipr~~~~lf~~~~~~~-~~~~v~~S~~EIy~e~v~DLL~~~  151 (322)
T cd01367          84 GVATCFAYGQTGSGKTYTMLGDENQ-----------EGLYALAARDIFRLLAQPN-DDLGVTVSFFEIYGGKLFDLLNDR  151 (322)
T ss_pred             CceEEEeccCCCCCCceEecCcCCc-----------CccHHHHHHHHHHHHhccc-cccEEEEEEEeeecCchhhhccCc
Confidence            9999999999999999999998643           4999999999999998744 679999999999999999999983


Q ss_pred             CCCccceecCC
Q psy9445         233 DDITKLRLKKN  243 (243)
Q Consensus       233 ~~~~~l~i~e~  243 (243)
                         .+++|+||
T Consensus       152 ---~~l~i~~~  159 (322)
T cd01367         152 ---KRLSVLED  159 (322)
T ss_pred             ---cceeEEEc
Confidence               45777765


No 10 
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=100.00  E-value=9.4e-36  Score=267.78  Aligned_cols=164  Identities=47%  Similarity=0.831  Sum_probs=135.7

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCc-eEEEEecCCC-CCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSS-REITIKERVN-DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCT  156 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~-~ti~v~~~~~-~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~  156 (243)
                      +..||+||+...|...++..++.+.+. ++|.+.+... ....+.|.||+||+++++|++||+.++.|+|+.+++|+|+|
T Consensus         5 ~V~vRvRP~~~~e~~~~~~~~i~~~~~~~~i~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vy~~~~~plv~~~~~G~n~~   84 (352)
T cd01364           5 QVVVRCRPRNSRERKEKSSVVVEVSGSSKEIIVSTGGADKQSTKTYTFDKVFGPEADQIEVYSQVVSPILDEVLMGYNCT   84 (352)
T ss_pred             EEEEEcCcCCccccccCCCeEEEEcCCCcEEEEcCCCcccccceeEeccccCCCCCCHHHHHHHHHHHHHHHHhCCCeEE
Confidence            357899999999876666677777665 5776655432 23577999999999999999999999999999999999999


Q ss_pred             EEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCC-CC
Q psy9445         157 VFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTD-DI  235 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~-~~  235 (243)
                      |||||||||||||||+|........++.....+|||||++++||+.++.. +..|.|++||+|||||+|+|||++.. ..
T Consensus        85 i~ayG~tgSGKTyTl~G~~~~~~~~~~~~~~~~Glipr~~~~Lf~~~~~~-~~~~~v~~S~~EIy~e~v~DLL~~~~~~~  163 (352)
T cd01364          85 IFAYGQTGTGKTYTMEGDRTDNKGSTWELSPHAGIIPRALYQLFEKLESQ-NTEYSVKVSYLELYNEELFDLLSSESDLN  163 (352)
T ss_pred             EEECCCCCCCCcEEecCCCcccccccccccccCCchHHHHHHHHHHHHhc-cceeEEEEEEEEeeCCeeeeCCCCccccC
Confidence            99999999999999999865432222334456799999999999999875 66899999999999999999999875 34


Q ss_pred             ccceecCC
Q psy9445         236 TKLRLKKN  243 (243)
Q Consensus       236 ~~l~i~e~  243 (243)
                      .+++++||
T Consensus       164 ~~l~i~e~  171 (352)
T cd01364         164 KPLRIFDD  171 (352)
T ss_pred             ccceEEec
Confidence            66888775


No 11 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=100.00  E-value=1.7e-35  Score=263.02  Aligned_cols=147  Identities=41%  Similarity=0.738  Sum_probs=127.8

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFA  159 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~a  159 (243)
                      ..+|+||+...|.. +..+++.+.++.++.+.++   ...+.|.||+||+++++|++||+.++.|+|+.+++|+|+||||
T Consensus         4 V~vRvRP~~~~e~~-~~~~~~~~~~~~~v~~~~~---~~~~~f~fd~vf~~~~~q~~vy~~~~~p~v~~~l~G~n~~i~a   79 (321)
T cd01374           4 VSVRVRPLNPRESD-NEQVAWSIDNDNTISLEES---TPGQSFTFDRVFGGESTNREVYERIAKPVVRSALEGYNGTIFA   79 (321)
T ss_pred             EEEEcCcCCccccc-CCcceEEECCCCEEEEcCC---CCCeEEecCeEECCCCCHHHHHHHHHHHHHHHHHCCCceeEEe
Confidence            56899999998873 3455676777767777654   3478999999999999999999999999999999999999999


Q ss_pred             eccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCCccce
Q psy9445         160 YGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLR  239 (243)
Q Consensus       160 yG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~~~l~  239 (243)
                      ||||||||||||+|+...           +|||||++++||+.+....+..|.|.+||+|||||+|+|||+|..  ..++
T Consensus        80 yG~tgSGKT~T~~G~~~~-----------~Gli~r~~~~lf~~~~~~~~~~~~v~~S~~Eiy~e~v~DLL~~~~--~~l~  146 (321)
T cd01374          80 YGQTSSGKTFTMSGDEQE-----------PGIIPLAVRDIFQRIQDTPDREFLLRVSYLEIYNEKIKDLLSPSP--QELR  146 (321)
T ss_pred             ecCCCCCCceeccCCCCC-----------CchHHHHHHHHHHHHhcccCceEEEEEEEEEEEcCEeEEccCCCC--CCce
Confidence            999999999999998543           499999999999999887788999999999999999999999965  5677


Q ss_pred             ecCC
Q psy9445         240 LKKN  243 (243)
Q Consensus       240 i~e~  243 (243)
                      ++||
T Consensus       147 i~~~  150 (321)
T cd01374         147 IRED  150 (321)
T ss_pred             EEEC
Confidence            7664


No 12 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=100.00  E-value=3.6e-35  Score=260.69  Aligned_cols=150  Identities=33%  Similarity=0.571  Sum_probs=123.0

Q ss_pred             CCcccCCCcchhhcccceeeeecCCc---eEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSS---REITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCT  156 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~---~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~  156 (243)
                      ..+|+||+...|.....+..+...++   ..+.+..+.+...+++|.||+||+++++|++||+..+.|+|+.+++|+|+|
T Consensus         4 V~vRvRP~~~~e~~~~~~v~~~~~~~~~~~~v~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~~~G~n~~   83 (319)
T cd01376           4 VVVRVRPFLDCEEDSSSCVRGIDSDQGQAKSVEIENPRNRGETKKYQFDAFYGTECTQEDIFSREVKPIVPHLLSGQNAT   83 (319)
T ss_pred             EEEEeCcCCccccCCCceEEEeCCCCCcceEEEEeCCCCCCCccEEecCeEECCCCCHHHHHHHHHHHHHHHHhCCCceE
Confidence            46899999888843333322222211   467777665555678999999999999999999999999999999999999


Q ss_pred             EEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCCc
Q psy9445         157 VFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDIT  236 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~~  236 (243)
                      |||||||||||||||+|....           +|||||++++||+.++.. .+.+.|.+||+|||||+|+|||++..  .
T Consensus        84 i~ayG~tgSGKTyTm~G~~~~-----------~Glipr~~~~Lf~~~~~~-~~~~~v~~S~~EIy~e~v~DLL~~~~--~  149 (319)
T cd01376          84 VFAYGSTGAGKTHTMLGDPNE-----------PGLIPRTLSDLLRMGRKQ-AWTGAFSMSYYEIYNEKVYDLLEPAK--K  149 (319)
T ss_pred             EEEECCCCCCCcEEEeCCcCc-----------cchHHHHHHHHHHHHhhc-cccceEEEEEEEEECCEeeEccCCCC--C
Confidence            999999999999999998543           499999999999988764 46799999999999999999999853  4


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      .++|+||
T Consensus       150 ~l~i~~~  156 (319)
T cd01376         150 ELPIRED  156 (319)
T ss_pred             CceEEEc
Confidence            5666654


No 13 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=100.00  E-value=2.9e-35  Score=262.70  Aligned_cols=156  Identities=44%  Similarity=0.715  Sum_probs=130.7

Q ss_pred             CCCcccCCCcchhhcccceeeeecC-CceEEEEecCCC--CCcceEEecceeecCCCcchhhhccccchhHHHHhcCCce
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCS-SSREITIKERVN--DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNC  155 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~-~~~ti~v~~~~~--~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~  155 (243)
                      +..+|+||+...|...+...++..+ +..++.+..+..  ...+++|.||++|+++++|.+||+..+.|+|+.+++|+|+
T Consensus         4 ~V~vRvRP~~~~e~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~f~fd~vf~~~~~q~~vy~~~~~plv~~~~~G~n~   83 (333)
T cd01371           4 KVVVRCRPLNKREKSEGAPEIVGVDENRGQVTVHNPKADAKEPPKVFTFDAVYDPNSTQEDVYNETARPLVDSVLEGYNG   83 (333)
T ss_pred             EEEEEcCcCChhhhhcCCCeEEEEcCCCCEEEEeCCcccccCCCceeeeccccCCCccHHHHHHHHHHHHHHHHhCCCce
Confidence            3568999999988766665566554 445677766543  2467899999999999999999999999999999999999


Q ss_pred             EEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCC
Q psy9445         156 TVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI  235 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~  235 (243)
                      ||||||||||||||||+|....        ...+|||||++++||+.++...+..|.|.+||+|||||+|+|||++.. .
T Consensus        84 ~i~ayG~tgSGKTyTm~G~~~~--------~~~~Glipr~~~~Lf~~~~~~~~~~~~v~~S~~Eiy~e~v~DLL~~~~-~  154 (333)
T cd01371          84 TIFAYGQTGTGKTFTMEGVREP--------PELRGIIPNSFAHIFGHIAKAENVQFLVRVSYLEIYNEEVRDLLGKDQ-K  154 (333)
T ss_pred             eEEecCCCCCCCcEeecCCCCc--------ccccchHHHHHHHHHHHHhhccCccEEEEEEEEEeeCCeeeeCCCCCC-C
Confidence            9999999999999999997542        234699999999999999987778899999999999999999999854 3


Q ss_pred             ccceecCC
Q psy9445         236 TKLRLKKN  243 (243)
Q Consensus       236 ~~l~i~e~  243 (243)
                      ..++++||
T Consensus       155 ~~l~i~~~  162 (333)
T cd01371         155 KKLELKER  162 (333)
T ss_pred             CceeEEEc
Confidence            46667664


No 14 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=100.00  E-value=7.3e-35  Score=259.39  Aligned_cols=152  Identities=43%  Similarity=0.758  Sum_probs=130.1

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVF  158 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~  158 (243)
                      +..+|+||+...|...+...++.+.+++++.+..+.   ..+.|.||+||+++++|++||+.++.|+|+.+++|+|+|||
T Consensus         5 ~V~vRvRP~~~~e~~~~~~~~v~~~~~~~v~~~~~~---~~~~f~FD~vf~~~~~q~~vy~~~~~~~v~~~~~G~n~~i~   81 (325)
T cd01369           5 KVVCRFRPLNEKEELRGSKSIVKFPGEDTVSIAGSD---DGKTFSFDRVFPPNTTQEDVYNFVAKPIVDDVLNGYNGTIF   81 (325)
T ss_pred             EEEEEcCcCChhhhccCCceEEEEcCCCEEEecCCC---CceEEEcCeEECCCCCHHHHHHHHHHHHHHHHHcCccceEE
Confidence            356899999998876677778888888888887653   36799999999999999999999999999999999999999


Q ss_pred             EeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc-CCceEEEEEEEEEEECCeEEeCCCCCCCCcc
Q psy9445         159 AYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL-GDAEFTVRVSFLEIYNEELIDLLSPTDDITK  237 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~-~~~~~~v~~S~~eiyne~v~DLL~~~~~~~~  237 (243)
                      |||||||||||||+|+...        ....||+||++++||+.+... ....|.|.+||+|||||+++|||++..  ..
T Consensus        82 ayG~tgSGKT~Tm~G~~~~--------~~~~Giipr~~~~Lf~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~--~~  151 (325)
T cd01369          82 AYGQTGSGKTYTMEGPPGD--------PELKGIIPRIVHDIFEHISSMDENLEFHVKVSYLEIYMEKIRDLLDVSK--DN  151 (325)
T ss_pred             EeCCCCCCceEEecCCCCc--------cccCChHHHHHHHHHHHHhhccCCceEEEEEEEEEEECCChhhcccCcc--CC
Confidence            9999999999999998652        123599999999999999874 445799999999999999999999864  34


Q ss_pred             ceecCC
Q psy9445         238 LRLKKN  243 (243)
Q Consensus       238 l~i~e~  243 (243)
                      ++++||
T Consensus       152 l~i~~~  157 (325)
T cd01369         152 LQVHED  157 (325)
T ss_pred             ceEEEc
Confidence            556553


No 15 
>KOG0241|consensus
Probab=100.00  E-value=1.9e-35  Score=278.61  Aligned_cols=154  Identities=32%  Similarity=0.595  Sum_probs=134.9

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCC-----CCcceEEecceeecC-------CCcchhhhccccchhH
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVN-----DKISKTFGFDRVFSQ-------ESKQVDVYKYVVNPLI  146 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~-----~~~~~~f~fD~vF~~-------~a~q~ev~~~~~~~~v  146 (243)
                      +..||+||++.+|+.....+++.+....++.-.++.+     .+.+|+|.||++|.+       .+.|+.||+.+..-++
T Consensus         7 kVaVRVRP~nrREl~l~tk~vv~vd~~q~vl~~~pp~~~~~~~k~pktFAFDhcF~s~dpes~n~agQE~Vf~~lG~~il   86 (1714)
T KOG0241|consen    7 KVAVRVRPMNRRELELSTKCVVEVDKNQTVLHPPPPNHKIGESKGPKTFAFDHCFWSMDPESKNYAGQETVFKCLGEGIL   86 (1714)
T ss_pred             EEEEEecccchhhhcccccceEEeccCceeecCCCccccccccCCCceeecccccccCCccccccccchhHHHhcchHHH
Confidence            4568999999999988888999988877554333221     156899999999976       3679999999999999


Q ss_pred             HHHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHh--cCCceEEEEEEEEEEECCe
Q psy9445         147 DEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRL--LGDAEFTVRVSFLEIYNEE  224 (243)
Q Consensus       147 ~~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~--~~~~~~~v~~S~~eiyne~  224 (243)
                      +.+|+|||+||||||||||||||||+|..+.+           |||||.+..||++|+.  .....|+|.|||+|||||+
T Consensus        87 ~naf~GyNaCifaYGQtGsGKsYsmmGt~~Qp-----------GiIPrlc~~lFe~I~k~~n~~~tfkVeVSymEIynEk  155 (1714)
T KOG0241|consen   87 ENAFQGYNACIFAYGQTGSGKSYSMMGTAEQP-----------GIIPRLCESLFERIDKESNPSQTFKVEVSYMEIYNEK  155 (1714)
T ss_pred             HHHhhccceeeEEecccCCCceeEeeccCCCC-----------CchhHHHHHHHHHHHhccCCCceEEEEEEHHHHhhcc
Confidence            99999999999999999999999999997654           9999999999999987  4566899999999999999


Q ss_pred             EEeCCCCCCCCccceecCC
Q psy9445         225 LIDLLSPTDDITKLRLKKN  243 (243)
Q Consensus       225 v~DLL~~~~~~~~l~i~e~  243 (243)
                      +||||+|.....-|+++||
T Consensus       156 v~DLLdPk~ssqtlkVreh  174 (1714)
T KOG0241|consen  156 VRDLLDPKGSSQTLKVREH  174 (1714)
T ss_pred             hhhhhCCCCCcceeEEeec
Confidence            9999999999999999986


No 16 
>KOG0240|consensus
Probab=100.00  E-value=1.9e-35  Score=268.50  Aligned_cols=152  Identities=42%  Similarity=0.722  Sum_probs=127.5

Q ss_pred             CCCcccCCCcchhhcccceeeeecCC-ceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSS-SREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTV  157 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~-~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i  157 (243)
                      +...|+||.+..|...++..+..+.+ ..++.+....  . .++|.||+||.+.++|.+||+.++.|+|+++|.|||+||
T Consensus        10 kV~cR~rP~n~~E~~~~~~~i~~~~~~~~~v~~~~~~--~-~~~y~FDrVF~pnatQe~Vy~~~a~~Iv~dVL~GYNGTv   86 (607)
T KOG0240|consen   10 KVVCRFRPLNGLENNLGSKFIDCFENGENTVVLETTK--E-TKTYVFDRVFSPNATQEDVYEFAAKPIVDDVLLGYNGTV   86 (607)
T ss_pred             EEEEEeecCCchhhhcCCcCccCCCCCcceEEEeccc--c-cccceeeeecCCCccHHHHHHHHHHHHHHHHhcccceeE
Confidence            35578999999998777766665555 3455444322  2 389999999999999999999999999999999999999


Q ss_pred             EEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc-CCceEEEEEEEEEEECCeEEeCCCCCCCCc
Q psy9445         158 FAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL-GDAEFTVRVSFLEIYNEELIDLLSPTDDIT  236 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~-~~~~~~v~~S~~eiyne~v~DLL~~~~~~~  236 (243)
                      ||||||||||||||.|....+        ...|||||++++||..|... ....|.|.|||+|||+|+|+|||+|.  ..
T Consensus        87 faYGqT~sGKTytm~G~~~d~--------~~~GIipRi~~diF~~Iys~~~n~efhVkVsy~EIYmEKi~DLL~~~--k~  156 (607)
T KOG0240|consen   87 FAYGQTGSGKTYTMEGIGHDP--------EEMGIIPRILNDIFDHIYSMEENLEFHVKVSYFEIYMEKIRDLLDPE--KT  156 (607)
T ss_pred             EEecCCCCCcceeecccCCCh--------hhcCcHHHHHHHHHHHHhcCcccceEEEEEEeehhhhhHHHHHhCcc--cC
Confidence            999999999999999986522        23599999999999999874 34589999999999999999999984  57


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      +|.|+||
T Consensus       157 nlsvheD  163 (607)
T KOG0240|consen  157 NLSVHED  163 (607)
T ss_pred             Cceeecc
Confidence            7888886


No 17 
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=100.00  E-value=1.8e-34  Score=257.68  Aligned_cols=151  Identities=37%  Similarity=0.638  Sum_probs=122.5

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCC--------CCcceEEecceeecCCCcchhhhccccchhHHHHhc
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVN--------DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLS  151 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~--------~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~  151 (243)
                      ..+|+||+...+.   . .+.-..++..+.+..+..        ....++|.||+||++ ++|++||+.++.|+|+.+++
T Consensus         4 V~vRvRP~~~~~~---~-~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~f~FD~vf~~-~~q~~vy~~~~~p~v~~~~~   78 (334)
T cd01375           4 VFVRVRPTPTKQG---S-SIKLGPDGKSVSSNLPKDLVRGVVNNQQEDFSFKFDGVFHN-ASQEEVYETVAKPVVDSALD   78 (334)
T ss_pred             EEEECCCCCCCCC---c-cEEEcCCCCEEEEecccccccccccCCcCceEEEcCcccCC-CCHHHHHHHHHHHHHHHHhC
Confidence            5789999887432   1 122234444555444332        245678999999999 99999999999999999999


Q ss_pred             CCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCC
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSP  231 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~  231 (243)
                      |+|+||||||||||||||||+|+...        ...+|||||++++||++++...+..|.|++||+|||||+|+|||++
T Consensus        79 G~n~~i~ayG~tgSGKTyTm~G~~~~--------~~~~Glipr~~~~lf~~~~~~~~~~~~v~~S~~Eiy~e~v~DLL~~  150 (334)
T cd01375          79 GYNGTIFAYGQTGAGKTFTMTGGTES--------YKDRGLIPRALEQVFREVAMRATKTYTVHVSYLEIYNEQLYDLLGD  150 (334)
T ss_pred             CCccceeeecCCCCCCeEEccCCCCc--------ccCCchHHHHHHHHHHHHHhccCcceEEEEEEEEEECCEeecCCCC
Confidence            99999999999999999999997541        1236999999999999999888888999999999999999999999


Q ss_pred             CC----CCccceecCC
Q psy9445         232 TD----DITKLRLKKN  243 (243)
Q Consensus       232 ~~----~~~~l~i~e~  243 (243)
                      ..    ....++|+||
T Consensus       151 ~~~~~~~~~~l~i~e~  166 (334)
T cd01375         151 TPEALESLPAVTILED  166 (334)
T ss_pred             CccccccCCceEEEEc
Confidence            75    3356777765


No 18 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=100.00  E-value=3.8e-34  Score=256.34  Aligned_cols=153  Identities=39%  Similarity=0.691  Sum_probs=125.3

Q ss_pred             CCcccCCCcchhhcccceeeeecCCc-eEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSS-REITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVF  158 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~-~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~  158 (243)
                      ..+|+||+...|...+...++.+.+. ..+.+.+      .+.|.||+||+++++|+++|+..+.|+|+.+++|+|+|||
T Consensus         5 V~vRvRP~~~~e~~~~~~~~~~~~~~~~~v~~~~------~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~~~G~n~~i~   78 (341)
T cd01372           5 VAVRVRPLLPKELLEGCQVCVSVVPGEPQVTVGT------DKSFTFDYVFDPSTSQEEVYNTCVAPLVDGLFEGYNATVL   78 (341)
T ss_pred             EEEECCCCCchhcccCCCeEEEEeCCCCEEEecC------CcEEeccccCCCCCCHHHHHHHHHHHHHHHHhCCCcccee
Confidence            46799999988876655555544443 3444432      5699999999999999999999999999999999999999


Q ss_pred             EeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCC-ceEEEEEEEEEEECCeEEeCCCCCC-CCc
Q psy9445         159 AYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGD-AEFTVRVSFLEIYNEELIDLLSPTD-DIT  236 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~-~~~~v~~S~~eiyne~v~DLL~~~~-~~~  236 (243)
                      |||||||||||||+|+....     ......|||||++++||+.++...+ ..|.|.+||+|||||+|+|||++.. ...
T Consensus        79 ayG~tgSGKT~Tm~G~~~~~-----~~~~~~Giipr~~~~LF~~~~~~~~~~~~~v~vS~~EIy~e~v~DLL~~~~~~~~  153 (341)
T cd01372          79 AYGQTGSGKTYTMGTAFTAS-----EDEEEVGIIPRAIQHIFKKIDEKKDEPDFQLKVSFLELYNEEVRDLLSPSTSEKS  153 (341)
T ss_pred             eecCCCCCCcEEecCCCccc-----cccccCChHHHHHHHHHHHHHhccccceEEEEEEEEEeECCeeecCCCCcccCCC
Confidence            99999999999999975321     1234569999999999999987554 6899999999999999999999864 345


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      .++|+||
T Consensus       154 ~l~i~e~  160 (341)
T cd01372         154 PIQIRED  160 (341)
T ss_pred             CceEEEC
Confidence            6777765


No 19 
>PLN03188 kinesin-12 family protein; Provisional
Probab=100.00  E-value=2.6e-34  Score=280.14  Aligned_cols=152  Identities=36%  Similarity=0.638  Sum_probs=119.4

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVF  158 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~  158 (243)
                      +..||+||++..|.  +...++. .++..+.+.       .++|.||+||++.++|.+||+.++.|+|+.+++|||+|||
T Consensus       101 kV~VRVRPl~~~E~--g~~iV~~-~s~dsl~I~-------~qtFtFD~VFdp~aTQedVFe~vv~PLV~svLdGyNaTIF  170 (1320)
T PLN03188        101 KVIVRMKPLNKGEE--GEMIVQK-MSNDSLTIN-------GQTFTFDSIADPESTQEDIFQLVGAPLVENCLAGFNSSVF  170 (1320)
T ss_pred             EEEEEcCCCCCccC--CCeeEEE-cCCCeEEEe-------CcEEeCCeeeCCCCCHHHHHHHHHHHHHHHHhcCCcceee
Confidence            36789999988763  2333333 344555553       3589999999999999999999999999999999999999


Q ss_pred             EeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc------CCceEEEEEEEEEEECCeEEeCCCCC
Q psy9445         159 AYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL------GDAEFTVRVSFLEIYNEELIDLLSPT  232 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~------~~~~~~v~~S~~eiyne~v~DLL~~~  232 (243)
                      |||||||||||||+|+...... ........|||||++++||..+...      ....|.|+|||+|||||+|+|||+|.
T Consensus       171 AYGQTGSGKTYTM~G~~~~~~d-e~~s~~e~GIIPRaledLF~~I~e~q~k~~d~~~~y~V~vSyLEIYNEkI~DLLsp~  249 (1320)
T PLN03188        171 AYGQTGSGKTYTMWGPANGLLE-EHLSGDQQGLTPRVFERLFARINEEQIKHADRQLKYQCRCSFLEIYNEQITDLLDPS  249 (1320)
T ss_pred             cCCCCCCCCCEeeCCCCCcccc-cccccccCCchHHHHHHHHHHHHhhhhhccccccceEEEEEEEeeecCcceeccccc
Confidence            9999999999999997431100 0112345799999999999998742      34579999999999999999999985


Q ss_pred             CCCccceecCC
Q psy9445         233 DDITKLRLKKN  243 (243)
Q Consensus       233 ~~~~~l~i~e~  243 (243)
                      .  ..|+|+||
T Consensus       250 ~--k~L~IRED  258 (1320)
T PLN03188        250 Q--KNLQIRED  258 (1320)
T ss_pred             c--CCceEEEc
Confidence            4  45777765


No 20 
>KOG0239|consensus
Probab=100.00  E-value=2.8e-34  Score=273.32  Aligned_cols=163  Identities=35%  Similarity=0.597  Sum_probs=130.7

Q ss_pred             ccchhcccccCCCcc----cCCCcchhhcccceeeeecCCceEEEEecCCCC--CcceEEecceeecCCCcchhhhcccc
Q psy9445          69 GRCITALVEKTPHIP----YRPLNSVERAAKSCSIVDCSSSREITIKERVND--KISKTFGFDRVFSQESKQVDVYKYVV  142 (243)
Q Consensus        69 ~~~i~~l~~~~~~~~----~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~--~~~~~f~fD~vF~~~a~q~ev~~~~~  142 (243)
                      .++.|.+.+.+++||    +||+...+.......++..++...+.+..+...  ...+.|.||+||+|.++|++||.. +
T Consensus       303 ~kL~N~i~eLkGnIRV~CRvRP~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~fdkVf~p~~sQ~~VF~e-~  381 (670)
T KOG0239|consen  303 RKLHNEILELKGNIRVFCRVRPLLPSEKQRLQSKVIDTEEQGEVQVDSPDKGDKLEPQSFKFDKVFGPLASQDDVFEE-V  381 (670)
T ss_pred             HHHHHHHHHhhcCceEEEEecCCCccccccccccccccCCcceeEeecCCCCCCCccccceeeeecCCcccHHHHHHH-H
Confidence            466677777777765    899999887654444555554444555444332  223469999999999999999998 6


Q ss_pred             chhHHHHhcCCceEEEEeccCCCCcceEeecC-CCCCCCCCCCCCCCCCchhHHHHHHHHHHHh-cCCceEEEEEEEEEE
Q psy9445         143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGE-KSNDPSISWQDDPLSGIVPRAMNHLFDELRL-LGDAEFTVRVSFLEI  220 (243)
Q Consensus       143 ~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~-~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~-~~~~~~~v~~S~~ei  220 (243)
                      .|+|+++++|||+||||||||||||||||.|+ +.           .+|||||+++.||..+.. ..+|.|.+.+||+||
T Consensus       382 ~~lv~S~lDGYnVCIFAYGQTGSGKTyTM~G~~~~-----------~~Giipral~~lF~~~~~~~~g~~y~~~~s~~EI  450 (670)
T KOG0239|consen  382 SPLVQSALDGYNVCIFAYGQTGSGKTYTMSGPTPE-----------DPGIIPRALEKLFRTITSLKSGWKYDKTVSMLEI  450 (670)
T ss_pred             HHHHHHHhcCcceeEEEecccCCCccccccCCCcc-----------cCCccHHHHHHHHHHHHhhccCceEEeeeehhHH
Confidence            99999999999999999999999999999995 32           249999999999999987 347999999999999


Q ss_pred             ECCeEEeCCCCCCCCccceecCC
Q psy9445         221 YNEELIDLLSPTDDITKLRLKKN  243 (243)
Q Consensus       221 yne~v~DLL~~~~~~~~l~i~e~  243 (243)
                      |||.|+|||++.....++.|+.|
T Consensus       451 YNe~i~DlL~~~~~~~k~~I~~~  473 (670)
T KOG0239|consen  451 YNEAIRDLLSDESYVGKLEIVDD  473 (670)
T ss_pred             HHHHHHHhccccccccceeEEEc
Confidence            99999999988754566776653


No 21 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=100.00  E-value=7.7e-34  Score=253.65  Aligned_cols=152  Identities=44%  Similarity=0.769  Sum_probs=121.7

Q ss_pred             ccCCCcchhhcccceeeeecCC---ceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEE
Q psy9445          83 PYRPLNSVERAAKSCSIVDCSS---SREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFA  159 (243)
Q Consensus        83 ~~~~~~~~E~~~~s~~iv~~~~---~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~a  159 (243)
                      |+||+...|...+...++....   ...............+.|.||+||+++++|.+||+.++.|+|+.+++|+|+||||
T Consensus         1 RvRP~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~~~v~~~l~G~n~~i~a   80 (335)
T PF00225_consen    1 RVRPLNESEKESSAESIVSVDNQDSNQNKQSVNSNNSQKEKSFRFDRVFDEDATQEDVYEEVVSPLVDSVLDGYNATIFA   80 (335)
T ss_dssp             EEES-CHHHHHTTTEBCEEEETTETEEEEEETTEEETTEEEEEEESEEEETTSTHHHHHHHHTHHHHHHHHTT-EEEEEE
T ss_pred             CcCCCCHHHHhCCCcEEEEecCCccccccccccccCCCCceEEEcCeEECCCCCHHHHHHHHHHHHHHHhhcCCceEEEe
Confidence            6899999998776665554432   1122222223335678999999999999999999999999999999999999999


Q ss_pred             eccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCC---ceEEEEEEEEEEECCeEEeCCCCCC--C
Q psy9445         160 YGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGD---AEFTVRVSFLEIYNEELIDLLSPTD--D  234 (243)
Q Consensus       160 yG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~---~~~~v~~S~~eiyne~v~DLL~~~~--~  234 (243)
                      ||+|||||||||+|...         ...+|||||++++||+.++....   ..|.|++||+|||||+|+|||++..  .
T Consensus        81 yG~tgSGKT~Tm~G~~~---------~~~~Gli~~~~~~lf~~~~~~~~~~~~~~~v~vS~~EIy~e~v~DLL~~~~~~~  151 (335)
T PF00225_consen   81 YGQTGSGKTYTMFGSND---------PSEPGLIPRALRDLFSQIEERKEKSGYEFSVSVSYLEIYNEKVYDLLSPNNSKS  151 (335)
T ss_dssp             EESTTSSHHHHHTBSTS---------TTTBSHHHHHHHHHHHHHHHHTTTSTEEEEEEEEEEEEETTEEEETTSTTSSST
T ss_pred             ecccccccccccccccc---------ccccchhhhHHHHHhhhhccccccccccccccccchhhhhhhhhhhcCcccccc
Confidence            99999999999999811         12359999999999999998554   5899999999999999999999984  3


Q ss_pred             CccceecCC
Q psy9445         235 ITKLRLKKN  243 (243)
Q Consensus       235 ~~~l~i~e~  243 (243)
                      ...++|+||
T Consensus       152 ~~~l~i~~~  160 (335)
T PF00225_consen  152 RKPLKIRED  160 (335)
T ss_dssp             TSEBEEEEE
T ss_pred             ccccceeec
Confidence            456888764


No 22 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=100.00  E-value=7.4e-33  Score=246.65  Aligned_cols=152  Identities=41%  Similarity=0.707  Sum_probs=130.4

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCC--CCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVN--DKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTV  157 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~--~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i  157 (243)
                      ..+|+||+...| ..+...++.+.+++++.+.++..  ...++.|.||+||+++++|+++|+.++.|+|+.+++|+|+||
T Consensus         4 V~vRvrP~~~~~-~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~f~fd~vf~~~~~q~~v~~~~~~~~v~~~~~G~~~~i   82 (328)
T cd00106           4 VVVRIRPLNGRE-SKSEESCITVDDNKTVTLTPPKDGRKAGPKSFTFDHVFDPNSTQEDVYETTAKPLVESVLEGYNGTI   82 (328)
T ss_pred             EEEEcCCCCccc-ccCCCcEEEECCCCEEEEecCccccCcCceEEECCeEEcCCCCHHHHHHHHHHHHHHHHhCCCceeE
Confidence            468999998877 33445677777778888876542  245789999999999999999999999999999999999999


Q ss_pred             EEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcC--CceEEEEEEEEEEECCeEEeCCCCCCCC
Q psy9445         158 FAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLG--DAEFTVRVSFLEIYNEELIDLLSPTDDI  235 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~--~~~~~v~~S~~eiyne~v~DLL~~~~~~  235 (243)
                      ||||++||||||||+|+...           +|||||++++||+.+....  ...+.|.+||+|||+|+|+|||++....
T Consensus        83 ~~yG~tgSGKT~tl~G~~~~-----------~Gli~~~~~~Lf~~~~~~~~~~~~~~v~~S~~Ei~~e~v~DLL~~~~~~  151 (328)
T cd00106          83 FAYGQTGSGKTYTMFGSPKD-----------PGIIPRALEDLFNLIDERKEKNKSFSVSVSYLEIYNEKVYDLLSPEPPS  151 (328)
T ss_pred             EEecCCCCCCeEEecCCCCC-----------CchHHHHHHHHHHHHhhccccCceEEEEEEEEEEECCEeEECCCCCCCC
Confidence            99999999999999998643           4999999999999998755  5789999999999999999999997445


Q ss_pred             ccceecCC
Q psy9445         236 TKLRLKKN  243 (243)
Q Consensus       236 ~~l~i~e~  243 (243)
                      ..++|+||
T Consensus       152 ~~l~i~~~  159 (328)
T cd00106         152 KPLSLRED  159 (328)
T ss_pred             CCcEEEEc
Confidence            67777765


No 23 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=100.00  E-value=9.7e-33  Score=246.14  Aligned_cols=150  Identities=40%  Similarity=0.688  Sum_probs=124.3

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCc--eEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSS--REITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCT  156 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~--~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~  156 (243)
                      +..+|+||+...|. .....++.+.+.  .++.+...  ....+.|.||+||+++++|++||+. +.|+|+.+++|+|+|
T Consensus         5 ~V~vRirP~~~~e~-~~~~~~~~~~~~~~~~i~~~~~--~~~~~~f~fD~vf~~~~~q~~v~~~-v~p~v~~~~~G~~~~   80 (329)
T cd01366           5 RVFCRVRPLLPSES-TEYSSVISFPDEDGGTIELSKG--TGKKKSFSFDRVFDPDASQEDVFEE-VSPLVQSALDGYNVC   80 (329)
T ss_pred             EEEEEcCcCCcccc-CCCccEEEEcCCCceEEEEeCC--CCCceEEecCEEECCCCCHHHHHHH-HHHHHHHHhCCCceE
Confidence            35689999988875 333344555555  67777654  2347799999999999999999998 599999999999999


Q ss_pred             EEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcC--CceEEEEEEEEEEECCeEEeCCCCCC-
Q psy9445         157 VFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLG--DAEFTVRVSFLEIYNEELIDLLSPTD-  233 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~--~~~~~v~~S~~eiyne~v~DLL~~~~-  233 (243)
                      |||||++||||||||+|....           +||+||++++||+.++...  +..|.|.+||+|||||+++|||++.. 
T Consensus        81 i~ayG~tgSGKT~tl~G~~~~-----------~Gli~r~~~~lf~~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~  149 (329)
T cd01366          81 IFAYGQTGSGKTYTMEGPPEN-----------PGIIPRALEQLFNTAEELKEKGWSYTITASMLEIYNETIRDLLATKPA  149 (329)
T ss_pred             EEEeCCCCCCCcEEecCCCCC-----------CCcHHHHHHHHHHHHHhhhccCceEEEEEEEEEEECCEeEECCCCCcC
Confidence            999999999999999998643           4999999999999998754  57899999999999999999999864 


Q ss_pred             CCccceecCC
Q psy9445         234 DITKLRLKKN  243 (243)
Q Consensus       234 ~~~~l~i~e~  243 (243)
                      ...+++|++|
T Consensus       150 ~~~~l~i~~~  159 (329)
T cd01366         150 PKKKLEIKHD  159 (329)
T ss_pred             CCCceEEEEC
Confidence            3456777764


No 24 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=100.00  E-value=1.9e-32  Score=244.82  Aligned_cols=151  Identities=44%  Similarity=0.774  Sum_probs=129.9

Q ss_pred             CCcccCCCcchhhcccceeeeecCCc--eEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSS--REITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTV  157 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~--~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i  157 (243)
                      ..+|+||+...|...+...++.+.+.  .++.+.........+.|.||+||+++++|.++|+.++.|+|+.+++|+|+||
T Consensus         4 v~vRvrP~~~~e~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~f~fD~vf~~~~~q~~v~~~~~~p~v~~~~~G~~~~i   83 (335)
T smart00129        4 VVVRVRPLNKREKSRKSPSVVPFDDKDGKTLNVNSPKNRKEEKKFTFDKVFGATASQEDVFEETAAPLVDSVLEGYNATI   83 (335)
T ss_pred             EEEEcCcCCccchhcCCceEEEEcCCCCCEEEEeCCCCCCCCeEEecCEEECCCCChHHHHHHHHHHHHHHHhcCCceeE
Confidence            46899999998876666666666554  4777777666667889999999999999999999999999999999999999


Q ss_pred             EEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcC-CceEEEEEEEEEEECCeEEeCCCCCCCCc
Q psy9445         158 FAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLG-DAEFTVRVSFLEIYNEELIDLLSPTDDIT  236 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~-~~~~~v~~S~~eiyne~v~DLL~~~~~~~  236 (243)
                      ||||++||||||||+|+...           +||+||++++||+.+.... +..|.|++||+|||+|+++|||++.  ..
T Consensus        84 ~~yG~tgSGKT~tl~G~~~~-----------~Gli~~~~~~Lf~~~~~~~~~~~~~v~~S~~ei~~e~v~DLL~~~--~~  150 (335)
T smart00129       84 FAYGQTGSGKTYTMSGTPDS-----------PGIIPRALKDLFEKIDKLEEGWQFQVKVSYLEIYNEKIRDLLNPS--PK  150 (335)
T ss_pred             EEeCCCCCCCceEecCCCCC-----------CCHHHHHHHHHHHHhhhcccCceEEEEEEEEEEECCEEEECcCCC--CC
Confidence            99999999999999997542           4999999999999998643 5689999999999999999999986  35


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      .++|+||
T Consensus       151 ~l~i~~~  157 (335)
T smart00129      151 KLEIRED  157 (335)
T ss_pred             CcEEEEC
Confidence            6777664


No 25 
>KOG0246|consensus
Probab=99.96  E-value=1.2e-29  Score=230.50  Aligned_cols=156  Identities=33%  Similarity=0.535  Sum_probs=134.4

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCCC------CcceEEecceeecCCCcchhhhccccchhHHHHhcCC
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVND------KISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGY  153 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~------~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~  153 (243)
                      .-||-||++..|...+...+|++++...+.++++...      -...+|.||++|++.+++++||..++.|+|+.+|+|-
T Consensus       212 VCVRKRPLnkkE~~~keiDvisvps~~~l~vHEpk~kVDLtkYlEn~~F~FDyaFDe~~sNe~VYrfTa~PlV~~IF~~G  291 (676)
T KOG0246|consen  212 VCVRKRPLNKKELTKKEIDVISVPSKNVLVVHEPKLKVDLTKYLENQKFRFDYAFDESASNELVYRFTAKPLVKTIFEGG  291 (676)
T ss_pred             EEeecCCCCchhccccccceEeccccceEEeeccccccchHHHHhhceEEEeeecccccchHHHHHHhhhHHHHHHHhCC
Confidence            3478899999999888889999999998888886543      3567899999999999999999999999999999999


Q ss_pred             ceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHh--cCCceEEEEEEEEEEECCeEEeCCCC
Q psy9445         154 NCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRL--LGDAEFTVRVSFLEIYNEELIDLLSP  231 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~--~~~~~~~v~~S~~eiyne~v~DLL~~  231 (243)
                      -+|+||||||||||||||.|.-.+.     ..+...||.-++.+++|..+..  .....+.|++||+|||+-+|||||++
T Consensus       292 ~ATCFAYGQTGSGKT~TMggdfsgk-----~q~~s~giya~aa~Dvf~~L~~p~Y~~~~l~v~~tFFEIYgGKvfDLL~~  366 (676)
T KOG0246|consen  292 MATCFAYGQTGSGKTYTMGGDFSGK-----AQDCSKGIYALAARDVFRLLRQPTYRKLDLKVYVTFFEIYGGKVYDLLND  366 (676)
T ss_pred             ceeeeeeccCCCCceeecccccCcc-----cccccccchhhhhhHHHHHhcccchhhcceEEEEEEEEEeCcchhhhhcc
Confidence            9999999999999999998864422     1334579999999999999886  34567899999999999999999988


Q ss_pred             CCCCccceecCC
Q psy9445         232 TDDITKLRLKKN  243 (243)
Q Consensus       232 ~~~~~~l~i~e~  243 (243)
                         +.+|++.||
T Consensus       367 ---k~KLrvLED  375 (676)
T KOG0246|consen  367 ---KKKLRVLED  375 (676)
T ss_pred             ---ccceEEeec
Confidence               366777765


No 26 
>KOG0243|consensus
Probab=99.94  E-value=7.6e-28  Score=232.68  Aligned_cols=95  Identities=66%  Similarity=0.961  Sum_probs=91.1

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      ||++|||||+||+|+||.+..+..|..+++-|||+||||||||.+.++|+.+.|.+||+.|||||++|||||+||++..+
T Consensus       259 ~N~~SSRSHsIFsItvhike~t~~geelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s~  338 (1041)
T KOG0243|consen  259 MNDQSSRSHSIFSITVHIKENTPEGEELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHSG  338 (1041)
T ss_pred             hhhhccccceEEEEEEEEecCCCcchhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccCC
Confidence            89999999999999999999888899999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCcchhhccc
Q psy9445          81 HIPYRPLNSVERAAK   95 (243)
Q Consensus        81 ~~~~~~~~~~E~~~~   95 (243)
                      |||||.++++.+++.
T Consensus       339 HIPYRESKLTRLLQD  353 (1041)
T KOG0243|consen  339 HIPYRESKLTRLLQD  353 (1041)
T ss_pred             CCCchHHHHHHHHHH
Confidence            999999999887553


No 27 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=99.93  E-value=1.4e-26  Score=218.98  Aligned_cols=106  Identities=51%  Similarity=0.946  Sum_probs=97.7

Q ss_pred             ceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHH
Q psy9445         119 SKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNH  198 (243)
Q Consensus       119 ~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~  198 (243)
                      ..+|.||+||++.++|++||+..+.|+++.++.||||||||||||||||||||.|....           .||||+++++
T Consensus        55 ~~~~~fdkvf~~~~~q~~v~e~~~~~l~~~~l~g~N~TvfayGqTgsgKtyt~~G~~~~-----------~Gii~~~l~~  123 (568)
T COG5059          55 EGTYAFDKVFGPSATQEDVYEETIKPLIDSLLLGYNCTVFAYGQTGSGKTYTMSGTEEE-----------PGIIPLSLKE  123 (568)
T ss_pred             ceEEEEeeccCCCCcHHHHHHHhhhhHHHHHHhcccceEEEEcccCCCceeEeecCccc-----------cchHHHHHHH
Confidence            56899999999999999999999999999999999999999999999999999998643           4999999999


Q ss_pred             HHHHHHhc-CCceEEEEEEEEEEECCeEEeCCCCCCCC
Q psy9445         199 LFDELRLL-GDAEFTVRVSFLEIYNEELIDLLSPTDDI  235 (243)
Q Consensus       199 lf~~~~~~-~~~~~~v~~S~~eiyne~v~DLL~~~~~~  235 (243)
                      ||+.++.. .+..+.|.+||+|||||+++|||.|..+.
T Consensus       124 lf~~l~~~~~~~~~~v~is~lEiYnEk~~DLl~~~~~~  161 (568)
T COG5059         124 LFSKLEDLSMTKDFAVSISYLEIYNEKIYDLLSPNEES  161 (568)
T ss_pred             HHHHHHhcccCcceeeEeehhHHHhhHHHhhccCcccc
Confidence            99999873 35679999999999999999999987653


No 28 
>KOG0247|consensus
Probab=99.92  E-value=7.4e-26  Score=210.92  Aligned_cols=141  Identities=33%  Similarity=0.608  Sum_probs=113.0

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecC---------CCCCcceEEecceeecCCCcchhhhccccchhHHHH
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKER---------VNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEV  149 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~---------~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~  149 (243)
                      ....++||+...   .+...++.+-+..+|.+..+         ..+...+.|.|.+||++.++|.+||+.++.|+|..+
T Consensus        34 ~v~~rvrP~~~~---~~~~g~l~v~n~~tivL~~P~d~~~~~~~n~~q~e~~fsFt~VF~p~~tQ~dvF~~~~~plV~dl  110 (809)
T KOG0247|consen   34 LVVCRVRPLSDA---SEDEGCLRVINEETIVLETPEDSFARRSVNGGQMEKKFSFTKVFGPSVTQADVFDTTVAPLVKDL  110 (809)
T ss_pred             heeEeecCCCCC---ccccceEEEeccceeEeeCcHHHHhhhccCccceeeEeeeeeecCCCccHHHHHHHHhHHHHHHH
Confidence            466788998752   22233344445566665532         122466789999999999999999999999999999


Q ss_pred             hcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc-----------------------
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL-----------------------  206 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~-----------------------  206 (243)
                      +.|.|..+|+||.|||||||||.|++..+           ||+||+++.||..|...                       
T Consensus       111 Lkgqn~LlFTyGVTgSGKTYTm~G~~~~~-----------GIlPR~Ld~iF~siq~~~~~k~~~kp~~s~~~e~~~~~~a  179 (809)
T KOG0247|consen  111 LKGQNSLLFTYGVTGSGKTYTMTGTPDRP-----------GILPRALDVIFNSIQGRQAKKPVFKPLRSNLFEIKAEEDA  179 (809)
T ss_pred             HcccceeEEEeeccCCCceEEeecCCCCC-----------CchHHHHHHHHHHhhceeccCceeccccchHHHHHHHHHH
Confidence            99999999999999999999999986643           99999999999766410                       


Q ss_pred             ------------------------------------------CCceEEEEEEEEEEECCeEEeCCCCCC
Q psy9445         207 ------------------------------------------GDAEFTVRVSFLEIYNEELIDLLSPTD  233 (243)
Q Consensus       207 ------------------------------------------~~~~~~v~~S~~eiyne~v~DLL~~~~  233 (243)
                                                                .+..|.|+|||+|||||-|||||.+..
T Consensus       180 lL~lkr~~~~nd~~~ts~~~~~~~~e~~e~~~~~e~~~~~l~~d~~ysV~VSf~EIYN~~iYDLLe~~s  248 (809)
T KOG0247|consen  180 LLQLKREAMLNDRKSTSKAHRQSTPEYAEHIHVIEQPALELDEDIVYSVFVSFVEIYNNYIYDLLEDAS  248 (809)
T ss_pred             HHhhhhhhccccccCcchhhccccHHHHhhcchhcccccccCcCcEEEEEeeHHHHHHHHHHHhhcccc
Confidence                                                      234699999999999999999998764


No 29 
>KOG0244|consensus
Probab=99.92  E-value=1.6e-25  Score=213.68  Aligned_cols=146  Identities=36%  Similarity=0.662  Sum_probs=123.4

Q ss_pred             cCCCcchhhcccceeeeecCCc-eEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEecc
Q psy9445          84 YRPLNSVERAAKSCSIVDCSSS-REITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQ  162 (243)
Q Consensus        84 ~~~~~~~E~~~~s~~iv~~~~~-~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~  162 (243)
                      +||+...|...++..++.+.++ .+|.+..      ..+|+||++|.....|.++|+.++.|+++.+|+|||+|++||||
T Consensus         1 vRpl~~~e~~~g~~~c~~~~~~~pqv~ig~------~~s~t~d~v~~~~~~Q~~~~e~~V~~l~~~lf~gynatvlaygQ   74 (913)
T KOG0244|consen    1 VRPLKQMEEEQGCRRCTEVSPRTPQVAIGK------DASFTYDKVFLDLESQKEVYESCVRPLREKLFAGYNATVLAYGQ   74 (913)
T ss_pred             CCCccchHHHhcchhhcccCCCCCceeecC------CcceeeeeeccCchHHHHHHHHHHHHHHHHHhhhhcceeeeecc
Confidence            5999999988887777764443 3554432      45899999999999999999999999999999999999999999


Q ss_pred             CCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCCccceecC
Q psy9445         163 TGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLKK  242 (243)
Q Consensus       163 tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~~~l~i~e  242 (243)
                      |||||||||.+......       ...|+|||++..+|..+.......|.|.|||+|||+|.|+|||.|+.....++++|
T Consensus        75 tgsgkTytmgt~~~~~~-------~~~Gvipr~v~~~f~~i~~~~~~~f~i~vs~vely~e~v~dl~~~~~~~~~i~~~e  147 (913)
T KOG0244|consen   75 TGSGKTYTMGTNDAPAQ-------DTVGVIPRAVSTLFTRIGKTESFVFRITVSFVELYNEEVLDLLKPSRLKANIKLRE  147 (913)
T ss_pred             cCCCceeeccccccccc-------ccCCcCcchHHHHHHHHHhhhccceeeeeeeeeccchhhhhhcChhhhhhceeccc
Confidence            99999999977633221       11599999999999999986667899999999999999999999887777777765


No 30 
>KOG4280|consensus
Probab=99.91  E-value=2.8e-25  Score=206.20  Aligned_cols=94  Identities=50%  Similarity=0.654  Sum_probs=85.1

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      ||..|||||+||||+|++......+....++|||+|||||||||..++++.|++++||.+||+||++||+||++|++.+.
T Consensus       204 mn~~SsRSH~ift~~i~~~~~~~~~~~~~~~~rlnlvDLagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aLvd~~~  283 (574)
T KOG4280|consen  204 MNEESSRSHAIFTIHIESSEKSDGGLMSGRSSKLNLVDLAGSERQSKTGAEGERLKEATNINLSLSALGNVISALVDGSK  283 (574)
T ss_pred             CCcccccceEEEEEEEEeecccCCCccccccceeeeeeccchhhhcccCccchhhhhhcccchhHHHHHHHHHHHhcccc
Confidence            89999999999999998844444566677899999999999999999999999999999999999999999999999876


Q ss_pred             -CcccCCCcchhhcc
Q psy9445          81 -HIPYRPLNSVERAA   94 (243)
Q Consensus        81 -~~~~~~~~~~E~~~   94 (243)
                       |||||++..+.+++
T Consensus       284 ~HIPYRdSkLT~LLq  298 (574)
T KOG4280|consen  284 THIPYRDSKLTRLLQ  298 (574)
T ss_pred             CCCCcchhHHHHHHH
Confidence             99999998876644


No 31 
>KOG0240|consensus
Probab=99.89  E-value=1.7e-23  Score=190.75  Aligned_cols=91  Identities=46%  Similarity=0.625  Sum_probs=82.2

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhccccc-C
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEK-T   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~-~   79 (243)
                      ||++|||||+||+|+|.+......   ....|||.||||||||++.++|+.|.-+.||.+||+||++||.||++|.++ +
T Consensus       202 mn~~sSRSHsIF~i~VkQ~n~e~~---~~~~gkLyLVDLaGSEkvsKtga~g~vleEaK~INkSLsaLgnvI~aLa~g~~  278 (607)
T KOG0240|consen  202 MNEHSSRSHSIFLIHVKQENVEDK---RKLSGKLYLVDLAGSEKVSKTGAEGAVLEEAKNINKSLSALGNVINALAEGPK  278 (607)
T ss_pred             ccccccccceEEEEEEEeccccch---hhccccEEEEEcccccccCCCCccchhHHHHhhhhhhHHHHHHHHHHHhcCCC
Confidence            899999999999999987654321   245899999999999999999999999999999999999999999999998 7


Q ss_pred             CCcccCCCcchhhcc
Q psy9445          80 PHIPYRPLNSVERAA   94 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~   94 (243)
                      .|||||+++.+++++
T Consensus       279 shipYRDSKLTRILq  293 (607)
T KOG0240|consen  279 SHIPYRDSKLTRILQ  293 (607)
T ss_pred             CCCcchhhHHHHHHH
Confidence            899999999988754


No 32 
>KOG0245|consensus
Probab=99.86  E-value=6.1e-23  Score=196.61  Aligned_cols=92  Identities=46%  Similarity=0.628  Sum_probs=80.6

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCC-ccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLD-GEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKT   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~-~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~   79 (243)
                      ||+.|||||+||||.+.++..... +....++||++|||||||||...+|+.|+|++|+.+|||||.+||+||.||.+..
T Consensus       209 MNdtSSRSHaVFtIvftQk~~~~~~~l~sek~SKIsLVDLAGSERasstGa~G~RLKEGa~INKSLtTLGkVISALAe~~  288 (1221)
T KOG0245|consen  209 MNDTSSRSHAVFTIVFTQKKHDQDTGLDSEKVSKISLVDLAGSERASSTGANGDRLKEGANINKSLTTLGKVISALAESQ  288 (1221)
T ss_pred             cccccccceeEEEEEEEeeeccccCCCcceeeeeeeEEeccCcccccccCCCccchhcccccchHHHHHHHHHHHHHHHh
Confidence            999999999999999988864433 3445678999999999999999999999999999999999999999999998532


Q ss_pred             -------CCcccCCCcchhh
Q psy9445          80 -------PHIPYRPLNSVER   92 (243)
Q Consensus        80 -------~~~~~~~~~~~E~   92 (243)
                             ..||||++-++.+
T Consensus       289 ~~k~~ks~fIPYRDSVLTWL  308 (1221)
T KOG0245|consen  289 KGKKKKSDFIPYRDSVLTWL  308 (1221)
T ss_pred             ccCCCCCccccchHHHHHHH
Confidence                   4899999977655


No 33 
>KOG0247|consensus
Probab=99.85  E-value=7.1e-22  Score=184.51  Aligned_cols=91  Identities=45%  Similarity=0.656  Sum_probs=80.0

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhccccc--
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEK--   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~--   78 (243)
                      +|+.|||||+||+|.|.+..... +......+.|.|||||||||..++++.|.|++||++||+||++||+||.+|.++  
T Consensus       301 lN~~SSRSHsVFtIkl~q~~~~~-~s~~i~vSqlsLvDLAGSERt~rtq~sG~RLrEagNINtSLmTLg~Cie~LR~nqk  379 (809)
T KOG0247|consen  301 LNANSSRSHSVFTIKLVQAPRSQ-DSNQITVSQLSLVDLAGSERTNRTQNSGERLREAGNINTSLMTLRRCIDVLRENQK  379 (809)
T ss_pred             ccccccccceeEEEEeeeccccc-ccCceeEEeeeeeecccchhcccccchhHHHHhhccccHHHHHHHHHHHHHHHHhh
Confidence            59999999999999998765442 334556899999999999999999999999999999999999999999999854  


Q ss_pred             ---CCCcccCCCcchhh
Q psy9445          79 ---TPHIPYRPLNSVER   92 (243)
Q Consensus        79 ---~~~~~~~~~~~~E~   92 (243)
                         ..+||||+++.+..
T Consensus       380 ~ks~~~VPyRdSKLThl  396 (809)
T KOG0247|consen  380 SKSQKIVPYRDSKLTHL  396 (809)
T ss_pred             hhccccCcchHHHHHHH
Confidence               37899999988765


No 34 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=99.84  E-value=1.9e-21  Score=160.20  Aligned_cols=96  Identities=48%  Similarity=0.661  Sum_probs=84.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      ||..|||||+||+|++........+......++|+||||||||+..++++.+++++|+..||+||++|++||++|.++..
T Consensus        76 ~N~~SSRsH~i~~i~v~~~~~~~~~~~~~~~s~l~lVDLAGsE~~~~~~~~~~~~~e~~~in~sl~~L~~~i~~l~~~~~  155 (186)
T cd01363          76 MNEHSSRSHSVFRIHFGGKNALASATEQPKVGKINLVDLAGSERIDFSGAEGSRLTETANINKSLSTLGNVISALAERDS  155 (186)
T ss_pred             CCCccCcccEEEEEEEEEeecCCCCccceeeeeEEEEEccccccccccCCchhhHHHHHHHhhHHHHHHHHHHHHhcCCC
Confidence            69999999999999998776544333445679999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCcchhhcccc
Q psy9445          81 HIPYRPLNSVERAAKS   96 (243)
Q Consensus        81 ~~~~~~~~~~E~~~~s   96 (243)
                      |||||+++.+.++..+
T Consensus       156 ~vpyr~SkLT~lL~~~  171 (186)
T cd01363         156 HVPYRESKLTRLLQDS  171 (186)
T ss_pred             CCCCcccHHHHHHHHh
Confidence            9999999998876543


No 35 
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=99.84  E-value=4.3e-21  Score=171.72  Aligned_cols=95  Identities=48%  Similarity=0.629  Sum_probs=81.4

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccc---
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVE---   77 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~---   77 (243)
                      ||.+|||||+||+|+|........ ......|+|+|||||||||..++++.+.+++|+.+||+||++|++||++|.+   
T Consensus       203 ~n~~SSRSH~i~~i~v~~~~~~~~-~~~~~~s~l~~VDLAGSEr~~~~~~~g~~~~E~~~IN~SL~~L~~vi~aL~~~~~  281 (337)
T cd01373         203 MNSESSRSHAVFTCTIESWEKKAS-STNIRTSRLNLVDLAGSERQKDDGAEGVRLKEAKNINKSLSTLGHVIMALVDVAH  281 (337)
T ss_pred             CCCCCCCccEEEEEEEEEeecCCC-CCcEEEEEEEEEECCCCCcccccCCccHhhhhhccccHHHHHHHHHHHHHHhhcc
Confidence            799999999999999986543322 1234579999999999999999999999999999999999999999999974   


Q ss_pred             -cCCCcccCCCcchhhcccc
Q psy9445          78 -KTPHIPYRPLNSVERAAKS   96 (243)
Q Consensus        78 -~~~~~~~~~~~~~E~~~~s   96 (243)
                       +..|||||+++++.++..+
T Consensus       282 ~~~~~ipyR~SkLT~lL~ds  301 (337)
T cd01373         282 GKQRHVPYRDSKLTFLLRDS  301 (337)
T ss_pred             CCCCccCCcccHHHHHHHHh
Confidence             3689999999998876543


No 36 
>KOG0239|consensus
Probab=99.83  E-value=2.2e-21  Score=185.30  Aligned_cols=93  Identities=47%  Similarity=0.668  Sum_probs=82.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      ||++|||||+||+|+|...+. ..+  ....|+|+|||||||||+.+++++|+|++|+.+||+||++||+||.+|..+..
T Consensus       512 ~Ne~SSRSH~v~~v~v~g~~~-~t~--~~~~g~l~LVDLAGSER~~~s~~tG~RlkE~Q~INkSLS~LgdVi~AL~~k~~  588 (670)
T KOG0239|consen  512 SNERSSRSHLVFRVRIRGINE-LTG--IRVTGVLNLVDLAGSERVSKSGVTGERLKEAQNINKSLSALGDVISALASKRS  588 (670)
T ss_pred             cchhhhccceEEEEEEecccc-Ccc--cccccceeEeecccCcccCcCCCchhhhHHHHHhchhhhhhHHHHHHHhhcCC
Confidence            799999999999999975532 222  23479999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCcchhhcccc
Q psy9445          81 HIPYRPLNSVERAAKS   96 (243)
Q Consensus        81 ~~~~~~~~~~E~~~~s   96 (243)
                      |||||+++.+.+++.+
T Consensus       589 HiPyRNSKLT~lLq~s  604 (670)
T KOG0239|consen  589 HIPYRNSKLTQLLQDS  604 (670)
T ss_pred             CCcccccchHHHhHhh
Confidence            9999999999987654


No 37 
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=99.83  E-value=6.2e-21  Score=170.74  Aligned_cols=96  Identities=45%  Similarity=0.677  Sum_probs=84.2

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccC-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKT-   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~-   79 (243)
                      ||.+|||||+||+|+|...............|+|+|||||||||..++++.+.+++|+.+||+||++|++||++|.+.. 
T Consensus       204 ~n~~SSRSH~i~~i~i~~~~~~~~~~~~~~~s~l~~VDLAGsEr~~~~~~~g~~~~E~~~IN~SL~~L~~vi~~L~~~~~  283 (338)
T cd01370         204 ANATSSRSHAVLQITVRQKDRTASINQQVRIGKLSLIDLAGSERASATNNRGQRLKEGANINRSLLALGNCINALVDGKK  283 (338)
T ss_pred             ccCccCcceEEEEEEEEEEecCCCCCCcEEEEEEEEEECCCCccccccCCCCccccccchhhHHHHHHHHHHHHHHhccC
Confidence            7999999999999999877644222334567999999999999999999999999999999999999999999999887 


Q ss_pred             --CCcccCCCcchhhcccc
Q psy9445          80 --PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        80 --~~~~~~~~~~~E~~~~s   96 (243)
                        .|||||+++.+.++..+
T Consensus       284 ~~~~ipyR~SkLT~lL~d~  302 (338)
T cd01370         284 KNKHIPYRDSKLTRLLKDS  302 (338)
T ss_pred             CCCcCCCcCCHHHHHHHHh
Confidence              89999999998876543


No 38 
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=99.82  E-value=1.3e-20  Score=169.12  Aligned_cols=96  Identities=42%  Similarity=0.651  Sum_probs=81.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCc-----cceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcc
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDG-----EELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITAL   75 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~-----~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l   75 (243)
                      ||.+|||||+||+|+|........+     ......++|+|||||||||..++++.+.+++|+..||+||++|++||++|
T Consensus       205 ~N~~SSRSH~i~~i~v~~~~~~~~~~~~~~~~~~~~s~l~~VDLAGsEr~~~~~~~g~~~~E~~~IN~SL~aL~~vi~aL  284 (345)
T cd01368         205 LNRESSRSHSVFTIKLVQAPGDSDGDVDQDKDQITVSQLSLVDLAGSERTSRTQNTGERLKEAGNINTSLMTLGKCIEVL  284 (345)
T ss_pred             CcCCCCCceEEEEEEEEEeccCcccccccCCCceEEEEEEEEecccccccccccccchhhhhhhhhhHHHHHHHHHHHHH
Confidence            6999999999999999866433211     12345799999999999999999999999999999999999999999999


Q ss_pred             cc------cCCCcccCCCcchhhcccc
Q psy9445          76 VE------KTPHIPYRPLNSVERAAKS   96 (243)
Q Consensus        76 ~~------~~~~~~~~~~~~~E~~~~s   96 (243)
                      .+      ...|||||+++++.++..+
T Consensus       285 ~~~~~~~~~~~~iPyR~SkLT~lL~~~  311 (345)
T cd01368         285 RENQLSGSTNKMVPYRDSKLTHLFQNY  311 (345)
T ss_pred             HhhhcccCCCCcCCCcCCHHHHHHHHh
Confidence            86      4689999999998876543


No 39 
>PLN03188 kinesin-12 family protein; Provisional
Probab=99.82  E-value=1.1e-20  Score=185.29  Aligned_cols=94  Identities=47%  Similarity=0.638  Sum_probs=80.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCC-CCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccc--
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNS-LDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVE--   77 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~-~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~--   77 (243)
                      ||..|||||+||+|+|...... ..+....+.|+|+|||||||||..++++.|.+++|+.+||+||++|++||++|.+  
T Consensus       297 mN~~SSRSHaIFtI~Ves~~k~~~dg~ss~r~SkLnLVDLAGSER~kkTga~G~RLkEA~~INKSLsaLGnVI~ALae~S  376 (1320)
T PLN03188        297 INAESSRSHSVFTCVVESRCKSVADGLSSFKTSRINLVDLAGSERQKLTGAAGDRLKEAGNINRSLSQLGNLINILAEIS  376 (1320)
T ss_pred             CCCccCCCceeEEEEEEEeecccCCCCcceEEEEEEEEECCCchhccccCcccHHHHHHHHHhHHHHHHHHHHHHHHHhh
Confidence            7999999999999999765332 2233345679999999999999999999999999999999999999999999975  


Q ss_pred             ---cCCCcccCCCcchhhcc
Q psy9445          78 ---KTPHIPYRPLNSVERAA   94 (243)
Q Consensus        78 ---~~~~~~~~~~~~~E~~~   94 (243)
                         +..|||||+++++.++.
T Consensus       377 q~gk~~HIPYRDSKLTrLLQ  396 (1320)
T PLN03188        377 QTGKQRHIPYRDSRLTFLLQ  396 (1320)
T ss_pred             ccCCCCcCCCCcchHHHHHH
Confidence               34799999999988754


No 40 
>KOG0242|consensus
Probab=99.82  E-value=3.4e-21  Score=184.55  Aligned_cols=91  Identities=43%  Similarity=0.646  Sum_probs=81.5

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhccccc--
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEK--   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~--   78 (243)
                      ||..|||||+||+|.|..+.....  .  ..++|+|||||||||..+|++.|.|++|+.+||+||++||.||++|.++  
T Consensus       202 ~N~~SSRSHaIl~i~i~s~~~~~~--~--~~s~L~lIDLAGSERas~T~~~G~RlkEG~~INrSLlaLgtVI~~Ls~~~~  277 (675)
T KOG0242|consen  202 LNEQSSRSHAILRITVESRGREAS--S--RVSKLNLIDLAGSERASRTGNEGVRLKEGAHINRSLLALGTVINKLSEGKR  277 (675)
T ss_pred             cccccchhhheeeEEEEecccccc--c--hhheehhhhhhhhhhhhhhhccceeccccchhhHHHHHHHHHHHHHccccc
Confidence            799999999999999987764433  1  5789999999999999999999999999999999999999999999987  


Q ss_pred             CCCcccCCCcchhhccc
Q psy9445          79 TPHIPYRPLNSVERAAK   95 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~   95 (243)
                      ..|||||+++++.+++.
T Consensus       278 ~~hipYRDSKLTRiLq~  294 (675)
T KOG0242|consen  278 PRHIPYRDSKLTRLLQD  294 (675)
T ss_pred             cCCCCccccHHHHhchh
Confidence            56899999999887553


No 41 
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=99.80  E-value=9.1e-20  Score=164.12  Aligned_cols=96  Identities=72%  Similarity=1.048  Sum_probs=85.6

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      +|..|||||+||+|+|.+......+......|+|+||||||||+..++++.+.+.+|+..||+||.+|++||++|.++..
T Consensus       212 ~n~~sSRSH~i~~i~i~~~~~~~~~~~~~~~s~l~~VDLAGsE~~~~~~~~~~~~~e~~~iN~SL~~L~~vi~al~~~~~  291 (352)
T cd01364         212 MNDQSSRSHSIFSITIHIKETTISGEELVKIGKLNLVDLAGSENIGRSGAENKRAREAGNINQSLLTLGRVINALVEKSP  291 (352)
T ss_pred             CCCCCCCCceEEEEEEEEeccCCCCCccEEEEEEEEEECCCccccccccCcchhhHHHhhhhHHHHHHHHHHHHHHcCCC
Confidence            68999999999999998876554445555679999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCcchhhcccc
Q psy9445          81 HIPYRPLNSVERAAKS   96 (243)
Q Consensus        81 ~~~~~~~~~~E~~~~s   96 (243)
                      |||||.++.+.++...
T Consensus       292 ~vpyR~S~LT~lL~~~  307 (352)
T cd01364         292 HIPYRESKLTRLLQDS  307 (352)
T ss_pred             CCCCcccHHHHHHHHh
Confidence            9999999998875543


No 42 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=99.79  E-value=1.9e-19  Score=160.90  Aligned_cols=95  Identities=52%  Similarity=0.732  Sum_probs=83.4

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      +|.+|||||+||+|+|........+......|+|+|||||||||..+++..+.+++|+..||+||.+|++||++|.+.+.
T Consensus       201 ~n~~ssRSH~i~~i~v~~~~~~~~~~~~~~~s~L~~VDLAGsEr~~~~~~~~~~~~E~~~iN~sL~~L~~vi~al~~~~~  280 (333)
T cd01371         201 MNEDSSRSHSIFTITIECSEKGEDGENHIRVGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKS  280 (333)
T ss_pred             ccCCCCCCcEEEEEEEEEEeccCCCCCcEEEEEEEEEECCCCCcccccCCchhhhHhHhhhhhHHHHHHHHHHHHHhCCC
Confidence            58999999999999998765443334455689999999999999999999999999999999999999999999998775


Q ss_pred             -CcccCCCcchhhccc
Q psy9445          81 -HIPYRPLNSVERAAK   95 (243)
Q Consensus        81 -~~~~~~~~~~E~~~~   95 (243)
                       |||||+++.+.++..
T Consensus       281 ~~ipyR~SkLT~lL~~  296 (333)
T cd01371         281 THIPYRDSKLTRLLQD  296 (333)
T ss_pred             CcCCCccCHHHHHHHH
Confidence             999999999887653


No 43 
>KOG0246|consensus
Probab=99.78  E-value=1.3e-19  Score=165.53  Aligned_cols=90  Identities=34%  Similarity=0.533  Sum_probs=75.2

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCc-hhHHHHhhcchhHHhhhcccchhcccccC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGA-QDKRAREAGNINQSLLTLGRCITALVEKT   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~-~~~~~~E~~~iN~SL~~l~~~i~~l~~~~   79 (243)
                      .|++||||||||+|.+....    ++.  -+||++||||||+||...+.. +.+...|+..|||||++|+.||++|...+
T Consensus       414 ANs~SSRSHAvfQIilr~~~----~~k--~hGKfSlIDLAGnERGaDts~adRqtRlEGAEINKSLLALKECIRaLg~nk  487 (676)
T KOG0246|consen  414 ANSNSSRSHAVFQIILRKHG----EFK--LHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNK  487 (676)
T ss_pred             CcccccccceeEeeeeecCC----cce--eEeEEEEEEccCCccCCcccccchhhhhhhhhhhHHHHHHHHHHHHhcCCC
Confidence            49999999999999775321    112  379999999999999987765 44566699999999999999999999999


Q ss_pred             CCcccCCCcchhhcccc
Q psy9445          80 PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s   96 (243)
                      .|+|||-+++++.+..+
T Consensus       488 ~H~PFR~SKLTqVLRDS  504 (676)
T KOG0246|consen  488 SHLPFRGSKLTQVLRDS  504 (676)
T ss_pred             CCCCchhhhHHHHHHHh
Confidence            99999999998875543


No 44 
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=99.78  E-value=4.9e-19  Score=158.32  Aligned_cols=95  Identities=44%  Similarity=0.616  Sum_probs=83.3

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccC-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKT-   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~-   79 (243)
                      +|..|||||+||+|+|......... .....++|+|||||||||..++++.+..++|+..||+||++|++||++|.++. 
T Consensus       205 ~n~~sSRSH~i~~l~v~~~~~~~~~-~~~~~s~l~~VDLAGsEr~~~~~~~~~~~~e~~~iN~SL~~L~~vi~~l~~~~~  283 (334)
T cd01375         205 MNQASSRSHCIFTIHLESRSREAGS-EVVRLSKLNLVDLAGSERVSKTGVSGQVLKEAKYINKSLSFLEQVINALSEKAR  283 (334)
T ss_pred             CcCCcCcCeEEEEEEEEEEecCCCC-CceEEEEEEEEECCCCCccccccCchhhhhhhhhhhhhHHHHHHHHHHHHhCCC
Confidence            6899999999999999877443332 23457999999999999999999999999999999999999999999999988 


Q ss_pred             CCcccCCCcchhhcccc
Q psy9445          80 PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s   96 (243)
                      .|||||++..+.++..+
T Consensus       284 ~~ipyRdSkLT~lL~d~  300 (334)
T cd01375         284 THVPYRNSKLTHVLRDS  300 (334)
T ss_pred             CCCCCcccHHHHHHHHh
Confidence            99999999998876543


No 45 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=99.77  E-value=5.3e-19  Score=157.15  Aligned_cols=91  Identities=38%  Similarity=0.595  Sum_probs=81.2

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      +|..|||||+||+|+|.+....     ....|+|+||||||||+..+++.++.+.+|+..||+||++|++||++|..+..
T Consensus       195 ~n~~SSRSH~i~~i~v~~~~~~-----~~~~s~l~~VDLAGsE~~~~~~~~g~~~~e~~~iN~Sl~~L~~vi~aL~~~~~  269 (319)
T cd01376         195 LNDNSSRSHAVLRIKVTQPASN-----IQLEGKLNLIDLAGSEDNRRTGNEGIRLKESAAINSSLFVLSKVVDALNKGLP  269 (319)
T ss_pred             CCCccCCCeEEEEEEEEEECCC-----ceEEEEEEEEECCCCCcccccCCccchhhhhhhhhhhHHHHHHHHHHHhcCCC
Confidence            6899999999999999776432     13579999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCcchhhcccc
Q psy9445          81 HIPYRPLNSVERAAKS   96 (243)
Q Consensus        81 ~~~~~~~~~~E~~~~s   96 (243)
                      |||||++..+.++..+
T Consensus       270 ~ipyr~S~LT~lL~~~  285 (319)
T cd01376         270 RIPYRESKLTRLLQDS  285 (319)
T ss_pred             cCCCccCHHHHHHHHh
Confidence            9999999988775543


No 46 
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=99.77  E-value=6.6e-19  Score=156.71  Aligned_cols=90  Identities=37%  Similarity=0.529  Sum_probs=79.0

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCC-chhHHHHhhcchhHHhhhcccchhcccccC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSG-AQDKRAREAGNINQSLLTLGRCITALVEKT   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~-~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~   79 (243)
                      ||..|||||+||+|+|.....      ....|+|+|||||||||..+++ ..+++.+|+.+||+||++|++||++|.+..
T Consensus       198 ~n~~SSRSH~i~~i~v~~~~~------~~~~s~l~~vDLAGsE~~~~~~~~~~~~~~e~~~IN~SL~~L~~vi~al~~~~  271 (322)
T cd01367         198 ANDQSSRSHAILQIILKNKKL------NKLLGKLSFIDLAGSERGADTSEHDRQTRKEGAEINKSLLALKECIRALASNK  271 (322)
T ss_pred             CCCCcccceEEEEEEEEEecC------CeeEEEEEEeecCCccccccccccchhhHHhHhHHhHHHHHHHHHHHHHhcCC
Confidence            799999999999999976543      2347999999999999998765 467899999999999999999999999999


Q ss_pred             CCcccCCCcchhhcccc
Q psy9445          80 PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s   96 (243)
                      .|||||+++.+.++..+
T Consensus       272 ~~iPyRdSkLT~lL~~~  288 (322)
T cd01367         272 AHVPFRGSKLTQVLRDS  288 (322)
T ss_pred             CcCCCccCHHHHHHHHh
Confidence            99999999998875543


No 47 
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=99.76  E-value=1.2e-18  Score=156.96  Aligned_cols=96  Identities=41%  Similarity=0.569  Sum_probs=81.4

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCC-ccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhccccc-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLD-GEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEK-   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~-~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~-   78 (243)
                      ||..|||||+||+|+|........ .......++|+|||||||||..+++..+.+++|+..||+||++|++||.+|.+. 
T Consensus       209 ~n~~SSRSH~i~~l~v~~~~~~~~~~~~~~~~s~l~~VDLAGsEr~~~~~~~~~~~~E~~~IN~SL~aL~~vi~~l~~~~  288 (356)
T cd01365         209 MNDTSSRSHAVFTIVLTQKKLDKETDLTTEKVSKISLVDLAGSERASSTGAEGDRLKEGSNINKSLTTLGKVISALADNS  288 (356)
T ss_pred             CCCCcCCceEEEEEEEEEEecccCCCCCceEEEEEEeeecccccccccccccchhhHHHHHHhHHHHHHHHHHHHHHhcc
Confidence            699999999999999987643321 123345799999999999999999999999999999999999999999999753 


Q ss_pred             -------CCCcccCCCcchhhcccc
Q psy9445          79 -------TPHIPYRPLNSVERAAKS   96 (243)
Q Consensus        79 -------~~~~~~~~~~~~E~~~~s   96 (243)
                             ..|||||+++.+.++..+
T Consensus       289 ~~~~~~~~~~ipyR~SkLT~lL~~~  313 (356)
T cd01365         289 SAKSKKKSSFIPYRDSVLTWLLKEN  313 (356)
T ss_pred             cccccCCCCcCCCcCcHHHHHHHHh
Confidence                   489999999998875543


No 48 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=99.76  E-value=1.1e-18  Score=155.27  Aligned_cols=95  Identities=43%  Similarity=0.613  Sum_probs=81.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccC-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKT-   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~-   79 (243)
                      +|.+|||||+||+|+|...............++|+|||||||||..+.+ .+.+++|+..||+||++|++||++|.+.. 
T Consensus       189 ~n~~ssRSH~i~~i~v~~~~~~~~~~~~~~~s~l~~vDLAGsE~~~~~~-~~~~~~e~~~iN~Sl~~L~~vi~al~~~~~  267 (321)
T cd01374         189 FNERSSRSHTIFQLTIESRERGDSESGTVRVSTLNLIDLAGSERASQTG-AGERRKEGSFINKSLLTLGTVISKLSEGKN  267 (321)
T ss_pred             CCCccccccEEEEEEEEEEecCCCCCCcEEEEEEEEEECCCCCccccCC-CCccccccchhhhHHHHHHHHHHHHHhcCC
Confidence            6899999999999999876543322234457999999999999999988 88999999999999999999999999885 


Q ss_pred             -CCcccCCCcchhhcccc
Q psy9445          80 -PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        80 -~~~~~~~~~~~E~~~~s   96 (243)
                       .|||||+++.+.++..+
T Consensus       268 ~~~vpyR~SkLT~lL~~~  285 (321)
T cd01374         268 SGHIPYRDSKLTRILQPS  285 (321)
T ss_pred             CCcCCCcCCHHHHHHHHh
Confidence             99999999998876543


No 49 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=99.75  E-value=1.7e-18  Score=154.33  Aligned_cols=93  Identities=44%  Similarity=0.622  Sum_probs=81.6

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccC-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKT-   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~-   79 (243)
                      +|.+|||||+||+|+|.+......   ....|+|+||||||||+..++++++.+.+|+..||+||++|++||++|.++. 
T Consensus       196 ~n~~ssRSH~i~~i~v~~~~~~~~---~~~~s~l~~VDLAGsE~~~~~~~~~~~~~e~~~in~sl~~L~~vi~aL~~~~~  272 (325)
T cd01369         196 MNEESSRSHSIFLITLKQENVETG---SKKRGKLFLVDLAGSEKVSKTGAEGQTLEEAKKINKSLSALGNVINALTDGKS  272 (325)
T ss_pred             CCCccccccEEEEEEEEEEecCCC---CEEEEEEEEEECCCCCcccccCCcchhHHHHHHHhHHHHHHHHHHHHHHcCCC
Confidence            689999999999999987653221   2357999999999999999999999999999999999999999999999887 


Q ss_pred             CCcccCCCcchhhcccc
Q psy9445          80 PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s   96 (243)
                      .|||||+++.+.++..+
T Consensus       273 ~~vpyR~S~LT~lL~~~  289 (325)
T cd01369         273 THIPYRDSKLTRILQDS  289 (325)
T ss_pred             CcCCCccCHHHHHHHHh
Confidence            99999999998876543


No 50 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=99.75  E-value=2.6e-18  Score=153.99  Aligned_cols=96  Identities=42%  Similarity=0.610  Sum_probs=82.1

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCC-------CccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchh
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSL-------DGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCIT   73 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~-------~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~   73 (243)
                      +|.+|||||+||+|+|.+.....       +.......|+|+||||||||+..++++++.+++|+..||+||.+|++||+
T Consensus       199 ~n~~sSRsH~i~~i~v~~~~~~~~~~~~~~~~~~~~~~s~l~~VDLAGsE~~~~~~~~~~~~~e~~~in~sl~aL~~vi~  278 (341)
T cd01372         199 MNSQSSRSHAIFTITLEQTRKNGPIAPMSGDDKNSTLTSKFHFVDLAGSERLKKTGATGDRLKEGISINSGLLALGNVIS  278 (341)
T ss_pred             CCCccCcCcEEEEEEEEEEecCCccccccccCCCceeeEEEEEEECCCCcccccccCchhHhHHHHHHhHHHHHHHHHHH
Confidence            68999999999999998765421       11223457999999999999999999999999999999999999999999


Q ss_pred             cccccC---CCcccCCCcchhhcccc
Q psy9445          74 ALVEKT---PHIPYRPLNSVERAAKS   96 (243)
Q Consensus        74 ~l~~~~---~~~~~~~~~~~E~~~~s   96 (243)
                      +|....   .|||||.++.+.++..+
T Consensus       279 al~~~~~~~~~ipyR~S~LT~lL~~~  304 (341)
T cd01372         279 ALGDESKKGSHVPYRDSKLTRLLQDS  304 (341)
T ss_pred             HHHhcCCCCCCCCCcccHHHHHHHHh
Confidence            999775   79999999998876543


No 51 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=99.73  E-value=7.6e-19  Score=166.46  Aligned_cols=184  Identities=35%  Similarity=0.464  Sum_probs=131.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccc--c
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVE--K   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~--~   78 (243)
                      ||+.|||||+||++++.......   .....++++||||||||+..+++..+.+++|+..||+||.+||+||++|.+  +
T Consensus       206 ~n~~ssRshsi~~i~~~~~~~~~---~~~~~~~l~lvDLagSE~~~~~~~~~~r~~E~~~iN~sLl~Lg~vI~~L~~~~~  282 (568)
T COG5059         206 INDESSRSHSIFQIELASKNKVS---GTSETSKLSLVDLAGSERAARTGNRGTRLKEGASINKSLLTLGNVINALGDKKK  282 (568)
T ss_pred             hccccccceEEEEEEEEEeccCc---cceecceEEEEeeccccccchhhcccchhhhhhhhHhhHHHHHHHHHHHhcccc
Confidence            68899999999999997765332   223347999999999999999999999999999999999999999999997  7


Q ss_pred             CCCcccCCCcchhhcc----cc---eeeeecCCce-----------------EEEEecCCC-----CCcceEEecceeec
Q psy9445          79 TPHIPYRPLNSVERAA----KS---CSIVDCSSSR-----------------EITIKERVN-----DKISKTFGFDRVFS  129 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~----~s---~~iv~~~~~~-----------------ti~v~~~~~-----~~~~~~f~fD~vF~  129 (243)
                      ..|||||.+..+.++.    +.   +.++.+.+..                 .|......+     ......|.||..|.
T Consensus       283 ~~~ipyReskLTRlLq~sLgG~~~~~~i~~Isp~~~~~~et~~tL~~a~rak~I~~~~~~~~~~~~~~~~~~~~~d~~~~  362 (568)
T COG5059         283 SGHIPYRESKLTRLLQDSLGGNCNTRVICTISPSSNSFEETINTLKFASRAKSIKNKIQVNSSSDSSREIEEIKFDLSED  362 (568)
T ss_pred             CCccchhhhHHHHHHHHhcCCCccEEEEEEEcCCCCchHHHHHHHHHHHHHhhcCCcccccCcCcchHHHHHHHhhhhhh
Confidence            8999999999887643    21   1122222210                 000000001     11223578888888


Q ss_pred             CCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHh
Q psy9445         130 QESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       130 ~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~  205 (243)
                      ....+..++.. ....++..++|    +++|++++++++++|.-..             .+++.-.+...|.....
T Consensus       363 ~~~~~~~~~~~-~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~~~~  420 (568)
T COG5059         363 RSEIEILVFRE-QSQLSQSSLSG----IFAYMQSLKKETETLKSRI-------------DLIMKSIISGTFERKKL  420 (568)
T ss_pred             hhhhhhHHHHH-HHhhhhhhhhh----HHHHHhhhhhhhhcccchh-------------hhhhhhhhhhhhhhhhh
Confidence            88877777765 35567777777    8999999999999995431             25555555666655543


No 52 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=99.73  E-value=8e-18  Score=150.16  Aligned_cols=93  Identities=46%  Similarity=0.624  Sum_probs=82.1

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      +|.+|||||+||+|+|......   ......|+|+||||||||+..++++.+.+++|+..||+||.+|++||++|..+..
T Consensus       198 ~n~~sSRsH~i~~i~v~~~~~~---~~~~~~s~l~~VDLaGsE~~~~~~~~~~~~~e~~~in~Sl~~L~~vl~~l~~~~~  274 (329)
T cd01366         198 MNEHSSRSHAVFQLKIRGTNLQ---TGEQTRGKLNLVDLAGSERLKKSGATGDRLKEAQAINKSLSALGDVISALRSKDS  274 (329)
T ss_pred             ccCCCCCccEEEEEEEEEEcCC---CCcEEEEEEEEEECCCCcccccccccchhhHhHhhhhhHHHHHHHHHHHHhcCCC
Confidence            5899999999999999876432   1223579999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCcchhhcccc
Q psy9445          81 HIPYRPLNSVERAAKS   96 (243)
Q Consensus        81 ~~~~~~~~~~E~~~~s   96 (243)
                      |||||.+..+.++...
T Consensus       275 ~ipyr~S~LT~lL~~~  290 (329)
T cd01366         275 HVPYRNSKLTYLLQDS  290 (329)
T ss_pred             cCCCcccHhHHHHHHh
Confidence            9999999998876543


No 53 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=99.70  E-value=2.6e-17  Score=147.11  Aligned_cols=96  Identities=45%  Similarity=0.671  Sum_probs=82.8

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccc-eeeeceEEEEecccCccccCCCch-hHHHHhhcchhHHhhhcccchhccccc
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEE-LLRTGKLNLVDLAGSENIGRSGAQ-DKRAREAGNINQSLLTLGRCITALVEK   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~-~~~~~~l~lvDLaGse~~~~~~~~-~~~~~E~~~iN~SL~~l~~~i~~l~~~   78 (243)
                      +|..|||||+||+|+|+.......... ....|+|+||||||||+..++++. +.+.+|+..||+||.+|++||.+|...
T Consensus       200 ~n~~sSRSH~i~~i~v~~~~~~~~~~~~~~~~s~l~~vDLaGsE~~~~~~~~~~~~~~e~~~in~Sl~~L~~vi~~L~~~  279 (335)
T PF00225_consen  200 MNARSSRSHAIFTIHVEQKDRDPSDDEESVKHSRLTFVDLAGSERLKKSGASDGQRLKESSNINKSLSALGNVIRALAQG  279 (335)
T ss_dssp             CTHHGGGSEEEEEEEEEEEETTTTTEEEEEEEEEEEEEEEEESTGGCGCSSSSHHHHHHHHHHHHHHHHHHHHHHHHHCT
T ss_pred             ccccccccccccccccccccccccccccceeecceeeeecccccccccccccccccccccceecchhhhhhhhHhhhhcc
Confidence            588999999999999998875543321 245799999999999999988874 788999999999999999999999998


Q ss_pred             --CCCcccCCCcchhhcccc
Q psy9445          79 --TPHIPYRPLNSVERAAKS   96 (243)
Q Consensus        79 --~~~~~~~~~~~~E~~~~s   96 (243)
                        ..|||||.++.+.++..+
T Consensus       280 ~~~~~vpyr~SkLT~lL~d~  299 (335)
T PF00225_consen  280 SKQSHVPYRDSKLTRLLKDS  299 (335)
T ss_dssp             TSTSSSCGGGSHHHHHTGGG
T ss_pred             ccchhhhhhcccccceeccc
Confidence              899999999998876543


No 54 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=99.66  E-value=1.7e-16  Score=141.51  Aligned_cols=94  Identities=47%  Similarity=0.690  Sum_probs=81.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccC-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKT-   79 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~-   79 (243)
                      +|..|||||+||+|+|.......... ....++|+||||||||+..+++..+.+.+|+..||+||.+|++|+.++.... 
T Consensus       198 ~n~~ssRSH~i~~i~v~~~~~~~~~~-~~~~s~l~~VDLaGse~~~~~~~~~~~~~e~~~in~sl~~L~~vl~~l~~~~~  276 (328)
T cd00106         198 MNERSSRSHAIFTIHVEQRNTTNDGR-SIKSSKLNLVDLAGSERAKKTGAEGDRLKEAKNINKSLSALGNVISALSSGQK  276 (328)
T ss_pred             CCCCcCcCcEEEEEEEEEEecCCCCc-cEEEEEEEEEECCCCCcccccCCchhhhHhHHhhhhhHHHHHHHHHHHHhcCC
Confidence            58899999999999998776433211 2357999999999999999999999999999999999999999999999888 


Q ss_pred             -CCcccCCCcchhhccc
Q psy9445          80 -PHIPYRPLNSVERAAK   95 (243)
Q Consensus        80 -~~~~~~~~~~~E~~~~   95 (243)
                       .|||||.++.+.++..
T Consensus       277 ~~~ip~r~SkLT~lL~~  293 (328)
T cd00106         277 KKHIPYRDSKLTRLLQD  293 (328)
T ss_pred             CCcCCCcCcHHHHHHHH
Confidence             9999999999887653


No 55 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=99.66  E-value=2.1e-16  Score=141.37  Aligned_cols=95  Identities=48%  Similarity=0.670  Sum_probs=81.9

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccc--c
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVE--K   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~--~   78 (243)
                      +|..|||||+||+|+|....... .......++|+||||||||+..+.++.+.+++|+..||+||.+|++|++++.+  .
T Consensus       196 ~n~~ssRsH~i~~l~v~~~~~~~-~~~~~~~s~l~~VDLaGse~~~~~~~~~~~~~e~~~in~sl~~L~~~l~~l~~~~~  274 (335)
T smart00129      196 MNEESSRSHAVFTITVESKIKNS-SSGSGKASKLNLVDLAGSERASKTGAEGDRLKEAGNINKSLSALGNVINALADGQK  274 (335)
T ss_pred             CCCCCCcceEEEEEEEEEEecCC-CCCCEEEEEEEEEECCCCCccccccChhHHHHhhchhhhHHHHHHHHHHHHHhcCC
Confidence            68999999999999998663322 22334579999999999999999999999999999999999999999999998  5


Q ss_pred             CCCcccCCCcchhhcccc
Q psy9445          79 TPHIPYRPLNSVERAAKS   96 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s   96 (243)
                      ..|+|||.+..+.++...
T Consensus       275 ~~~ip~r~S~LT~lL~~~  292 (335)
T smart00129      275 SRHIPYRDSKLTRLLQDS  292 (335)
T ss_pred             CCCCCCcCcHhHHHHHHH
Confidence            679999999998876544


No 56 
>KOG0241|consensus
Probab=99.65  E-value=8.5e-17  Score=153.40  Aligned_cols=93  Identities=40%  Similarity=0.551  Sum_probs=78.4

Q ss_pred             CCCCCCcceEEEEEEEEEEeCC-CCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhccccc-
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNS-LDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEK-   78 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~-~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~-   78 (243)
                      ||+.|||||++|.|.|.+.--+ ..+....+.+||.|||||||||..++++.+.+++|+++||+||.+||.||.+|.+. 
T Consensus       213 mn~EssrsHaVFslvvtQ~l~D~ktg~SgeKvsklslVDLAgserasktga~g~rlkegsNinkSLttLglVIsaLadq~  292 (1714)
T KOG0241|consen  213 MNEESSRSHAVFSLVVTQTLYDLKTGHSGEKVSKLSLVDLAGSERASKTGAAGSRLKEGSNINKSLTTLGLVISALADQK  292 (1714)
T ss_pred             ccccccccceeEEEEEeeEEeccccCcchhheeeeeEEEeccccccccccchhhhhhhcCCcchhhHHHHHHHHHHHHhh
Confidence            8999999999999988765222 22333445799999999999999999999999999999999999999999999863 


Q ss_pred             -----CCCcccCCCcchhhc
Q psy9445          79 -----TPHIPYRPLNSVERA   93 (243)
Q Consensus        79 -----~~~~~~~~~~~~E~~   93 (243)
                           .+.||||++-.+.++
T Consensus       293 n~kgkdKfvPYrDSVLTwLL  312 (1714)
T KOG0241|consen  293 NGKGKDKFVPYRDSVLTWLL  312 (1714)
T ss_pred             cCCCccccccchhHHHHHHH
Confidence                 358999998776653


No 57 
>KOG0244|consensus
Probab=99.65  E-value=1.6e-18  Score=166.10  Aligned_cols=90  Identities=44%  Similarity=0.592  Sum_probs=77.0

Q ss_pred             CCCCCCcceEEEEEEEEEEeCCCCccceeeeceEEEEecccCccccCCCchhHHHHhhcchhHHhhhcccchhcccccCC
Q psy9445           1 MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTP   80 (243)
Q Consensus         1 ~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~~~~l~lvDLaGse~~~~~~~~~~~~~E~~~iN~SL~~l~~~i~~l~~~~~   80 (243)
                      ||+.|||||+||||.+.+.....  ......+||+|||||||||.++|++.|.+++|+.+||..|++||+||.+|.+.+.
T Consensus       186 MN~qssRshAifti~lkq~kk~~--~~s~~~sKlhlVDLAGSER~kkT~a~gdrlKEgInIN~gLL~LgnVIsaLg~~kk  263 (913)
T KOG0244|consen  186 MNAQSSRSHAIFTITLKQRKKLS--KRSSFCSKLHLVDLAGSERVKKTKAEGDRLKEGININGGLLALGNVISALGEAKK  263 (913)
T ss_pred             cchhhhhhhHHHHHHHHHHHHhh--ccchhhhhhheeeccccccccccccchhhhhhccCcchHHHHHHHHHHHHHhhhc
Confidence            89999999999999886532211  1112358999999999999999999999999999999999999999999987654


Q ss_pred             --CcccCCCcchhh
Q psy9445          81 --HIPYRPLNSVER   92 (243)
Q Consensus        81 --~~~~~~~~~~E~   92 (243)
                        |||||++..+.+
T Consensus       264 ~~~vpyRdSkltrl  277 (913)
T KOG0244|consen  264 GGEVPYRDSKLTRL  277 (913)
T ss_pred             CCcccchHHHHHHH
Confidence              999999887655


No 58 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=99.55  E-value=4.8e-15  Score=122.03  Aligned_cols=57  Identities=47%  Similarity=0.939  Sum_probs=51.4

Q ss_pred             hhccccchhHHHHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHh
Q psy9445         137 VYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       137 v~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~  205 (243)
                      +|+.+. |+|+.+++|+|+||||||||||||||||+|....           +||+||+++++++.++.
T Consensus         8 vf~~~~-~~v~~~~~G~n~~i~~yG~tGsGKT~Tm~G~~~~-----------~Giip~~~~~~~~ll~~   64 (186)
T cd01363           8 VFRDVG-PLLQSALDGYNVCIFAYGQTGSGKTYTMEGKREG-----------AGIIPRTVTDVIDLMDK   64 (186)
T ss_pred             HHHHHH-HHHHHHhCCcceeEEEECCCCCcceEecCCCCCC-----------CCcchHHHHHHHHHHhh
Confidence            899988 9999999999999999999999999999998542           49999999988777664


No 59 
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=95.54  E-value=0.024  Score=53.40  Aligned_cols=93  Identities=23%  Similarity=0.387  Sum_probs=59.3

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCch----hHHH
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIV----PRAM  196 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii----~r~~  196 (243)
                      .|..-.-|.|.-.|.+-    +..+++.+-.|..-- .-.|.|||||||||----..-.        .+-|+    .-.+
T Consensus         4 ~F~l~s~f~PaGDQP~A----I~~Lv~gi~~g~~~Q-tLLGvTGSGKTfT~AnVI~~~~--------rPtLV~AhNKTLA   70 (663)
T COG0556           4 PFKLHSPFKPAGDQPEA----IAELVEGIENGLKHQ-TLLGVTGSGKTFTMANVIAKVQ--------RPTLVLAHNKTLA   70 (663)
T ss_pred             ceEeccCCCCCCCcHHH----HHHHHHHHhcCceee-EEeeeccCCchhHHHHHHHHhC--------CCeEEEecchhHH
Confidence            45555667787777653    455777776665433 3469999999999954211000        00111    1245


Q ss_pred             HHHHHHHHh-cCCceEEEEEEEEEEECCeEE
Q psy9445         197 NHLFDELRL-LGDAEFTVRVSFLEIYNEELI  226 (243)
Q Consensus       197 ~~lf~~~~~-~~~~~~~v~~S~~eiyne~v~  226 (243)
                      .+||..+++ .++..+.-.|||+..|.-+-|
T Consensus        71 aQLy~Efk~fFP~NaVEYFVSYYDYYQPEAY  101 (663)
T COG0556          71 AQLYSEFKEFFPENAVEYFVSYYDYYQPEAY  101 (663)
T ss_pred             HHHHHHHHHhCcCcceEEEeeeccccCcccc
Confidence            678887777 566678899999999976543


No 60 
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=94.34  E-value=0.021  Score=50.30  Aligned_cols=31  Identities=26%  Similarity=0.512  Sum_probs=28.0

Q ss_pred             cchhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         142 VNPLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       142 ~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +.|++..+.+--++.|+.-|+||||||.||-
T Consensus       113 lP~i~~~~~~~~~GLILVTGpTGSGKSTTlA  143 (353)
T COG2805         113 LPPIVRELAESPRGLILVTGPTGSGKSTTLA  143 (353)
T ss_pred             CCHHHHHHHhCCCceEEEeCCCCCcHHHHHH
Confidence            5678888889999999999999999999983


No 61 
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=93.56  E-value=0.033  Score=46.89  Aligned_cols=50  Identities=24%  Similarity=0.472  Sum_probs=28.9

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .|+||..+.. ..+...+.. +..+.+.--..+| .++-||++|+||||-|.+
T Consensus         4 ~~tFdnfv~g-~~N~~a~~~-~~~ia~~~~~~~~-~l~l~G~~G~GKTHLL~A   53 (219)
T PF00308_consen    4 KYTFDNFVVG-ESNELAYAA-AKAIAENPGERYN-PLFLYGPSGLGKTHLLQA   53 (219)
T ss_dssp             T-SCCCS--T-TTTHHHHHH-HHHHHHSTTTSSS-EEEEEESTTSSHHHHHHH
T ss_pred             CCccccCCcC-CcHHHHHHH-HHHHHhcCCCCCC-ceEEECCCCCCHHHHHHH
Confidence            6888866543 345555543 2333333111234 478899999999997755


No 62 
>PRK06893 DNA replication initiation factor; Validated
Probab=92.39  E-value=0.074  Score=44.99  Aligned_cols=47  Identities=11%  Similarity=0.270  Sum_probs=30.1

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++||..+.... ...     +.-+....-..++..++-||++|+||||-+..
T Consensus        12 ~~~fd~f~~~~~-~~~-----~~~~~~~~~~~~~~~l~l~G~~G~GKThL~~a   58 (229)
T PRK06893         12 DETLDNFYADNN-LLL-----LDSLRKNFIDLQQPFFYIWGGKSSGKSHLLKA   58 (229)
T ss_pred             cccccccccCCh-HHH-----HHHHHHHhhccCCCeEEEECCCCCCHHHHHHH
Confidence            567777775432 111     11122333346777889999999999998865


No 63 
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=91.69  E-value=0.077  Score=49.77  Aligned_cols=29  Identities=28%  Similarity=0.352  Sum_probs=25.3

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+..++..-++-|+.-|+||||||.||+.
T Consensus       249 ~~~~~~~~p~GliLvTGPTGSGKTTTLY~  277 (500)
T COG2804         249 RLLRLLNRPQGLILVTGPTGSGKTTTLYA  277 (500)
T ss_pred             HHHHHHhCCCeEEEEeCCCCCCHHHHHHH
Confidence            45567788889999999999999999976


No 64 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=89.77  E-value=0.14  Score=45.94  Aligned_cols=28  Identities=39%  Similarity=0.640  Sum_probs=20.8

Q ss_pred             hHHHHhc-CCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLS-GYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~-G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+..++. +....++.||++|+|||+++.
T Consensus        30 ~l~~~~~~~~~~~i~I~G~~GtGKT~l~~   58 (365)
T TIGR02928        30 ALRPILRGSRPSNVFIYGKTGTGKTAVTK   58 (365)
T ss_pred             HHHHHHcCCCCCcEEEECCCCCCHHHHHH
Confidence            3444444 455679999999999999883


No 65 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=88.83  E-value=0.19  Score=45.67  Aligned_cols=28  Identities=36%  Similarity=0.534  Sum_probs=20.2

Q ss_pred             hHHHHhc-CCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLS-GYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~-G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+...+. +....++-||++|+|||+++.
T Consensus        45 ~l~~~~~~~~~~~~lI~G~~GtGKT~l~~   73 (394)
T PRK00411         45 ALRPALRGSRPLNVLIYGPPGTGKTTTVK   73 (394)
T ss_pred             HHHHHhCCCCCCeEEEECCCCCCHHHHHH
Confidence            3444444 445668899999999999874


No 66 
>PRK06526 transposase; Provisional
Probab=88.67  E-value=0.26  Score=42.50  Aligned_cols=18  Identities=44%  Similarity=0.582  Sum_probs=15.8

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .|+.+|++|+||||...+
T Consensus       100 nlll~Gp~GtGKThLa~a  117 (254)
T PRK06526        100 NVVFLGPPGTGKTHLAIG  117 (254)
T ss_pred             eEEEEeCCCCchHHHHHH
Confidence            378999999999999864


No 67 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=88.30  E-value=0.2  Score=37.51  Aligned_cols=25  Identities=28%  Similarity=0.315  Sum_probs=18.0

Q ss_pred             HHhcCCceEEEEeccCCCCcceEee
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+.......++.+|++|+|||+.+.
T Consensus        13 ~~~~~~~~~v~i~G~~G~GKT~l~~   37 (151)
T cd00009          13 ALELPPPKNLLLYGPPGTGKTTLAR   37 (151)
T ss_pred             HHhCCCCCeEEEECCCCCCHHHHHH
Confidence            3333345568889999999997663


No 68 
>PRK12377 putative replication protein; Provisional
Probab=88.21  E-value=0.3  Score=42.07  Aligned_cols=50  Identities=22%  Similarity=0.315  Sum_probs=31.4

Q ss_pred             EecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         122 FGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       122 f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+||-.......|..++.. +..+++.+..+. ..++-+|++|+||||.+..
T Consensus        71 ~tFdnf~~~~~~~~~a~~~-a~~~a~~~~~~~-~~l~l~G~~GtGKThLa~A  120 (248)
T PRK12377         71 CSFANYQVQNDGQRYALSQ-AKSIADELMTGC-TNFVFSGKPGTGKNHLAAA  120 (248)
T ss_pred             CCcCCcccCChhHHHHHHH-HHHHHHHHHhcC-CeEEEECCCCCCHHHHHHH
Confidence            3566433333444445543 355565555543 4688999999999999865


No 69 
>PRK09087 hypothetical protein; Validated
Probab=88.10  E-value=0.3  Score=41.33  Aligned_cols=48  Identities=23%  Similarity=0.241  Sum_probs=30.0

Q ss_pred             eEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         120 KTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       120 ~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|+||..+...++ ...|..     ++....-.+..++-||++||||||-+..
T Consensus        16 ~~~~~~~Fi~~~~N-~~a~~~-----l~~~~~~~~~~l~l~G~~GsGKThLl~~   63 (226)
T PRK09087         16 PAYGRDDLLVTESN-RAAVSL-----VDHWPNWPSPVVVLAGPVGSGKTHLASI   63 (226)
T ss_pred             CCCChhceeecCch-HHHHHH-----HHhcccCCCCeEEEECCCCCCHHHHHHH
Confidence            35678766654333 335553     2222222345589999999999998865


No 70 
>PRK14086 dnaA chromosomal replication initiation protein; Provisional
Probab=87.92  E-value=0.21  Score=48.39  Aligned_cols=51  Identities=24%  Similarity=0.378  Sum_probs=31.6

Q ss_pred             eEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         120 KTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       120 ~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|+||..+.... +...|.. +..+++..-..+|. ||-||.+|+||||-+..
T Consensus       283 ~~~TFDnFvvG~s-N~~A~aa-a~avae~~~~~~Np-L~LyG~sGsGKTHLL~A  333 (617)
T PRK14086        283 PKYTFDTFVIGAS-NRFAHAA-AVAVAEAPAKAYNP-LFIYGESGLGKTHLLHA  333 (617)
T ss_pred             CCCCHhhhcCCCc-cHHHHHH-HHHHHhCccccCCc-EEEECCCCCCHHHHHHH
Confidence            4578886554333 3334433 23334332335665 89999999999999865


No 71 
>PRK05642 DNA replication initiation factor; Validated
Probab=87.63  E-value=0.3  Score=41.47  Aligned_cols=19  Identities=16%  Similarity=0.684  Sum_probs=16.4

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..++-||.+|+||||-+..
T Consensus        46 ~~l~l~G~~G~GKTHLl~a   64 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQA   64 (234)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4678999999999998765


No 72 
>PRK08116 hypothetical protein; Validated
Probab=87.56  E-value=0.22  Score=43.31  Aligned_cols=51  Identities=20%  Similarity=0.354  Sum_probs=31.4

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhc--CCceEEEEeccCCCCcceEeec
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLS--GYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~--G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++||-.. ....+...+.. +...++.+..  ..+..++-||.+|+||||.+..
T Consensus        81 ~~tFdnf~-~~~~~~~a~~~-a~~y~~~~~~~~~~~~gl~l~G~~GtGKThLa~a  133 (268)
T PRK08116         81 NSTFENFL-FDKGSEKAYKI-ARKYVKKFEEMKKENVGLLLWGSVGTGKTYLAAC  133 (268)
T ss_pred             hcchhccc-CChHHHHHHHH-HHHHHHHHHhhccCCceEEEECCCCCCHHHHHHH
Confidence            34555332 33444445543 3555555443  3355699999999999999865


No 73 
>PF13245 AAA_19:  Part of AAA domain
Probab=87.54  E-value=0.25  Score=34.44  Aligned_cols=27  Identities=30%  Similarity=0.384  Sum_probs=17.5

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      |..++. -+..+..-|..|||||+|+..
T Consensus         3 v~~al~-~~~~~vv~g~pGtGKT~~~~~   29 (76)
T PF13245_consen    3 VRRALA-GSPLFVVQGPPGTGKTTTLAA   29 (76)
T ss_pred             HHHHHh-hCCeEEEECCCCCCHHHHHHH
Confidence            344444 233344589999999988753


No 74 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=87.06  E-value=0.2  Score=42.00  Aligned_cols=16  Identities=38%  Similarity=0.715  Sum_probs=13.5

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      -+..+|.||||||+|+
T Consensus        25 H~~I~G~TGsGKS~~~   40 (229)
T PF01935_consen   25 HIAIFGTTGSGKSNTV   40 (229)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3456899999999998


No 75 
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=86.94  E-value=0.22  Score=46.42  Aligned_cols=52  Identities=21%  Similarity=0.349  Sum_probs=29.4

Q ss_pred             ceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         119 SKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       119 ~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...|+||-.... ..+...|..+ ..+.+.--..+| .++-||++|+||||.+..
T Consensus       116 ~~~~tfd~fv~g-~~n~~a~~~~-~~~~~~~~~~~~-~l~l~G~~G~GKThL~~a  167 (450)
T PRK00149        116 NPKYTFDNFVVG-KSNRLAHAAA-LAVAENPGKAYN-PLFIYGGVGLGKTHLLHA  167 (450)
T ss_pred             CCCCcccccccC-CCcHHHHHHH-HHHHhCcCccCC-eEEEECCCCCCHHHHHHH
Confidence            346777754322 3344444432 223322112234 488899999999999854


No 76 
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=86.93  E-value=0.18  Score=47.04  Aligned_cols=50  Identities=22%  Similarity=0.398  Sum_probs=31.0

Q ss_pred             eEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         120 KTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       120 ~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|+||..... ..+...|..+ ..+.+. -..+|. ++-||++|+||||-+..
T Consensus       100 ~~~tFdnFv~g-~~n~~a~~~~-~~~~~~-~~~~n~-l~lyG~~G~GKTHLl~a  149 (440)
T PRK14088        100 PDYTFENFVVG-PGNSFAYHAA-LEVAKN-PGRYNP-LFIYGGVGLGKTHLLQS  149 (440)
T ss_pred             CCCcccccccC-CchHHHHHHH-HHHHhC-cCCCCe-EEEEcCCCCcHHHHHHH
Confidence            46788866543 3444455442 222222 112564 99999999999999864


No 77 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=86.75  E-value=0.27  Score=44.74  Aligned_cols=27  Identities=41%  Similarity=0.666  Sum_probs=19.5

Q ss_pred             HHHHhcCC-ceEEEEeccCCCCcceEee
Q psy9445         146 IDEVLSGY-NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       146 v~~~~~G~-n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +..++.|. ...++.||.+|||||.|+.
T Consensus        33 l~~~~~~~~p~n~~iyG~~GTGKT~~~~   60 (366)
T COG1474          33 LAPALRGERPSNIIIYGPTGTGKTATVK   60 (366)
T ss_pred             HHHHhcCCCCccEEEECCCCCCHhHHHH
Confidence            44445443 4449999999999998873


No 78 
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=86.66  E-value=0.45  Score=41.54  Aligned_cols=30  Identities=27%  Similarity=0.418  Sum_probs=24.5

Q ss_pred             cchhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         142 VNPLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       142 ~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +.++++.+.--..+.|+..|.|||||+.||
T Consensus       115 LPevlk~la~~kRGLviiVGaTGSGKSTtm  144 (375)
T COG5008         115 LPEVLKDLALAKRGLVIIVGATGSGKSTTM  144 (375)
T ss_pred             CcHHHHHhhcccCceEEEECCCCCCchhhH
Confidence            456677766667788999999999999987


No 79 
>PRK08084 DNA replication initiation factor; Provisional
Probab=86.58  E-value=0.46  Score=40.31  Aligned_cols=47  Identities=6%  Similarity=0.232  Sum_probs=28.2

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++||..+..  .+...+... ..+.   .......++-||++|+||||.+..
T Consensus        18 ~~~fd~f~~~--~n~~a~~~l-~~~~---~~~~~~~l~l~Gp~G~GKThLl~a   64 (235)
T PRK08084         18 DETFASFYPG--DNDSLLAAL-QNAL---RQEHSGYIYLWSREGAGRSHLLHA   64 (235)
T ss_pred             cCCccccccC--ccHHHHHHH-HHHH---hCCCCCeEEEECCCCCCHHHHHHH
Confidence            5667754433  444454432 2222   122234789999999999999864


No 80 
>PRK10436 hypothetical protein; Provisional
Probab=86.44  E-value=0.28  Score=46.03  Aligned_cols=27  Identities=30%  Similarity=0.437  Sum_probs=22.4

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +..++..-.+.|+.-|+||||||.||+
T Consensus       210 l~~~~~~~~GliLvtGpTGSGKTTtL~  236 (462)
T PRK10436        210 FRQALQQPQGLILVTGPTGSGKTVTLY  236 (462)
T ss_pred             HHHHHHhcCCeEEEECCCCCChHHHHH
Confidence            445566677889999999999999995


No 81 
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=86.43  E-value=0.24  Score=36.72  Aligned_cols=18  Identities=33%  Similarity=0.361  Sum_probs=15.3

Q ss_pred             EEEeccCCCCcceEeecC
Q psy9445         157 VFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~  174 (243)
                      ++.+|.+|+|||+++...
T Consensus         3 ~~i~~~~G~GKT~~~~~~   20 (144)
T cd00046           3 VLLAAPTGSGKTLAALLP   20 (144)
T ss_pred             EEEECCCCCchhHHHHHH
Confidence            567899999999998764


No 82 
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=86.17  E-value=0.26  Score=45.24  Aligned_cols=52  Identities=21%  Similarity=0.350  Sum_probs=29.2

Q ss_pred             ceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         119 SKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       119 ~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...|+||.... ...+...|.. +..+.+.--..+| .++-||++|+||||.+..
T Consensus       104 ~~~~tfd~fi~-g~~n~~a~~~-~~~~~~~~~~~~n-~l~l~G~~G~GKThL~~a  155 (405)
T TIGR00362       104 NPKYTFDNFVV-GKSNRLAHAA-ALAVAENPGKAYN-PLFIYGGVGLGKTHLLHA  155 (405)
T ss_pred             CCCCccccccc-CCcHHHHHHH-HHHHHhCcCccCC-eEEEECCCCCcHHHHHHH
Confidence            34678876432 2334444433 2223322111233 478899999999999854


No 83 
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=86.10  E-value=0.22  Score=37.51  Aligned_cols=18  Identities=28%  Similarity=0.427  Sum_probs=12.8

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+++.+|.+|+|||.++
T Consensus         4 ~~~~~i~G~~G~GKT~~~   21 (131)
T PF13401_consen    4 QRILVISGPPGSGKTTLI   21 (131)
T ss_dssp             ---EEEEE-TTSSHHHHH
T ss_pred             CcccEEEcCCCCCHHHHH
Confidence            356889999999999877


No 84 
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=86.07  E-value=0.28  Score=38.83  Aligned_cols=20  Identities=30%  Similarity=0.366  Sum_probs=16.9

Q ss_pred             ceEEEEeccCCCCcceEeec
Q psy9445         154 NCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...++..++||||||++|..
T Consensus        25 ~~~~ll~~~tGsGKT~~~~~   44 (184)
T PF04851_consen   25 ERRVLLNAPTGSGKTIIALA   44 (184)
T ss_dssp             CSEEEEEESTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCcChhhhh
Confidence            55667788999999999985


No 85 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=85.54  E-value=0.47  Score=45.67  Aligned_cols=29  Identities=31%  Similarity=0.400  Sum_probs=23.4

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+..++..-++.|+..|+||||||.||..
T Consensus       307 ~l~~~~~~~~Glilv~G~tGSGKTTtl~a  335 (564)
T TIGR02538       307 LFLEAIHKPQGMVLVTGPTGSGKTVSLYT  335 (564)
T ss_pred             HHHHHHHhcCCeEEEECCCCCCHHHHHHH
Confidence            34556666778899999999999999954


No 86 
>PRK08181 transposase; Validated
Probab=85.32  E-value=0.51  Score=41.12  Aligned_cols=18  Identities=22%  Similarity=0.495  Sum_probs=16.0

Q ss_pred             EEEeccCCCCcceEeecC
Q psy9445         157 VFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~  174 (243)
                      ++-||++|+||||-+.+-
T Consensus       109 lll~Gp~GtGKTHLa~Ai  126 (269)
T PRK08181        109 LLLFGPPGGGKSHLAAAI  126 (269)
T ss_pred             EEEEecCCCcHHHHHHHH
Confidence            889999999999988663


No 87 
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=85.22  E-value=0.41  Score=45.22  Aligned_cols=28  Identities=25%  Similarity=0.436  Sum_probs=22.5

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +..++..-.+.|+..|+||||||.||..
T Consensus       234 l~~~~~~~~GlilitGptGSGKTTtL~a  261 (486)
T TIGR02533       234 FERLIRRPHGIILVTGPTGSGKTTTLYA  261 (486)
T ss_pred             HHHHHhcCCCEEEEEcCCCCCHHHHHHH
Confidence            4455666677889999999999999963


No 88 
>PRK06620 hypothetical protein; Validated
Probab=85.07  E-value=0.41  Score=40.12  Aligned_cols=50  Identities=20%  Similarity=0.282  Sum_probs=31.2

Q ss_pred             eEEecceeecCCCcchhhhccccchhHHHHhcCCc---eEEEEeccCCCCcceEeec
Q psy9445         120 KTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYN---CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       120 ~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n---~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|+||..+...+ +...|..+ ..+.+.  -|+|   -.++-||++|+||||.+..
T Consensus        11 ~~~tfd~Fvvg~~-N~~a~~~~-~~~~~~--~~~~~~~~~l~l~Gp~G~GKThLl~a   63 (214)
T PRK06620         11 SKYHPDEFIVSSS-NDQAYNII-KNWQCG--FGVNPYKFTLLIKGPSSSGKTYLTKI   63 (214)
T ss_pred             CCCCchhhEeccc-HHHHHHHH-HHHHHc--cccCCCcceEEEECCCCCCHHHHHHH
Confidence            3677886665543 34455553 222221  1333   3589999999999999865


No 89 
>PRK07952 DNA replication protein DnaC; Validated
Probab=84.85  E-value=0.57  Score=40.23  Aligned_cols=50  Identities=16%  Similarity=0.251  Sum_probs=28.5

Q ss_pred             EecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         122 FGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       122 f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+||........|..++.. +...++....+. ..++.+|.+|+||||.+..
T Consensus        69 ~tFdnf~~~~~~q~~al~~-a~~~~~~~~~~~-~~~~l~G~~GtGKThLa~a  118 (244)
T PRK07952         69 CSFENYRVECEGQMNALSK-ARQYVEEFDGNI-ASFIFSGKPGTGKNHLAAA  118 (244)
T ss_pred             CccccccCCCchHHHHHHH-HHHHHHhhccCC-ceEEEECCCCCCHHHHHHH
Confidence            4555433222334444443 233344333332 3688999999999998865


No 90 
>KOG0989|consensus
Probab=84.80  E-value=0.46  Score=42.13  Aligned_cols=24  Identities=38%  Similarity=0.429  Sum_probs=17.8

Q ss_pred             HHhcCCceEEEEeccCCCCcceEe
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+---..+-||+.|+|||.|.
T Consensus        51 a~~~~~lp~~LFyGPpGTGKTSta   74 (346)
T KOG0989|consen   51 ALLRRILPHYLFYGPPGTGKTSTA   74 (346)
T ss_pred             HHhhcCCceEEeeCCCCCcHhHHH
Confidence            333434455788999999999986


No 91 
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=84.80  E-value=0.97  Score=44.37  Aligned_cols=88  Identities=23%  Similarity=0.345  Sum_probs=55.1

Q ss_pred             ceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCch----hHHHHHHH
Q psy9445         125 DRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIV----PRAMNHLF  200 (243)
Q Consensus       125 D~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii----~r~~~~lf  200 (243)
                      ..-|.|.-.|..-++.    +++.+-+|.... ..+|.||||||+||-.--....        .+-|+    ...+.+|+
T Consensus         5 ~~~~~~~~~Q~~ai~~----l~~~~~~~~~~~-~l~Gvtgs~kt~~~a~~~~~~~--------~p~Lvi~~n~~~A~ql~   71 (655)
T TIGR00631         5 HSPFQPAGDQPKAIAK----LVEGLTDGEKHQ-TLLGVTGSGKTFTMANVIAQVN--------RPTLVIAHNKTLAAQLY   71 (655)
T ss_pred             ccCCCCChHHHHHHHH----HHHhhhcCCCcE-EEECCCCcHHHHHHHHHHHHhC--------CCEEEEECCHHHHHHHH
Confidence            3457777778776654    455555564222 3689999999999865321100        01221    12456777


Q ss_pred             HHHHhc-CCceEEEEEEEEEEECCeE
Q psy9445         201 DELRLL-GDAEFTVRVSFLEIYNEEL  225 (243)
Q Consensus       201 ~~~~~~-~~~~~~v~~S~~eiyne~v  225 (243)
                      +.+... ++..+...|||+..|.-+.
T Consensus        72 ~el~~f~p~~~V~~f~sy~d~y~pe~   97 (655)
T TIGR00631        72 NEFKEFFPENAVEYFVSYYDYYQPEA   97 (655)
T ss_pred             HHHHHhCCCCeEEEEeeecccCCccc
Confidence            777663 4555888999999997764


No 92 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=84.77  E-value=0.32  Score=35.93  Aligned_cols=19  Identities=26%  Similarity=0.419  Sum_probs=15.9

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..++-+|++|+|||+++..
T Consensus         3 ~~~~l~G~~G~GKTtl~~~   21 (148)
T smart00382        3 EVILIVGPPGSGKTTLARA   21 (148)
T ss_pred             CEEEEECCCCCcHHHHHHH
Confidence            3577899999999998854


No 93 
>PF12846 AAA_10:  AAA-like domain
Probab=84.69  E-value=0.31  Score=41.90  Aligned_cols=19  Identities=37%  Similarity=0.581  Sum_probs=16.0

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      |..++..|.||||||++|.
T Consensus         1 n~h~~i~G~tGsGKT~~~~   19 (304)
T PF12846_consen    1 NPHTLILGKTGSGKTTLLK   19 (304)
T ss_pred             CCeEEEECCCCCcHHHHHH
Confidence            4567889999999998885


No 94 
>PRK08727 hypothetical protein; Validated
Probab=84.45  E-value=0.41  Score=40.57  Aligned_cols=19  Identities=32%  Similarity=0.371  Sum_probs=16.5

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      -.++-||++|+||||-+..
T Consensus        42 ~~l~l~G~~G~GKThL~~a   60 (233)
T PRK08727         42 DWLYLSGPAGTGKTHLALA   60 (233)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4599999999999998865


No 95 
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=84.41  E-value=0.46  Score=42.79  Aligned_cols=30  Identities=27%  Similarity=0.493  Sum_probs=22.4

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +.+..++.--.+.|+..|+||||||.||.-
T Consensus       112 ~~l~~~~~~~~g~ili~G~tGSGKTT~l~a  141 (343)
T TIGR01420       112 PVLRELAERPRGLILVTGPTGSGKSTTLAS  141 (343)
T ss_pred             HHHHHHHhhcCcEEEEECCCCCCHHHHHHH
Confidence            445555544457788999999999999953


No 96 
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=84.11  E-value=0.51  Score=42.86  Aligned_cols=25  Identities=28%  Similarity=0.465  Sum_probs=19.6

Q ss_pred             HhcCCceEEEEeccCCCCcceEeec
Q psy9445         149 VLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       149 ~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ++.--...|+..|+||||||.||..
T Consensus       129 ~~~~~~glilI~GpTGSGKTTtL~a  153 (358)
T TIGR02524       129 AIAPQEGIVFITGATGSGKSTLLAA  153 (358)
T ss_pred             HHhccCCEEEEECCCCCCHHHHHHH
Confidence            3343467899999999999999843


No 97 
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=83.79  E-value=0.38  Score=39.70  Aligned_cols=18  Identities=39%  Similarity=0.588  Sum_probs=15.6

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      +.|+..|+||||||.++.
T Consensus         2 GlilI~GptGSGKTTll~   19 (198)
T cd01131           2 GLVLVTGPTGSGKSTTLA   19 (198)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            467888999999999985


No 98 
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=83.29  E-value=0.61  Score=37.93  Aligned_cols=19  Identities=37%  Similarity=0.550  Sum_probs=15.8

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      -.++-+|++|+||||...+
T Consensus        48 ~~l~l~G~~G~GKThLa~a   66 (178)
T PF01695_consen   48 ENLILYGPPGTGKTHLAVA   66 (178)
T ss_dssp             -EEEEEESTTSSHHHHHHH
T ss_pred             eEEEEEhhHhHHHHHHHHH
Confidence            4588999999999998755


No 99 
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=83.28  E-value=0.41  Score=41.24  Aligned_cols=18  Identities=33%  Similarity=0.553  Sum_probs=16.0

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|+.-|.||||||.+|
T Consensus       127 ~~~ili~G~tGSGKTT~l  144 (270)
T PF00437_consen  127 RGNILISGPTGSGKTTLL  144 (270)
T ss_dssp             TEEEEEEESTTSSHHHHH
T ss_pred             ceEEEEECCCccccchHH
Confidence            577888999999999888


No 100
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=82.84  E-value=0.62  Score=40.39  Aligned_cols=27  Identities=30%  Similarity=0.437  Sum_probs=20.7

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +..++..-.+.|+..|.||||||.+|.
T Consensus        72 l~~~~~~~~GlilisG~tGSGKTT~l~   98 (264)
T cd01129          72 FRKLLEKPHGIILVTGPTGSGKTTTLY   98 (264)
T ss_pred             HHHHHhcCCCEEEEECCCCCcHHHHHH
Confidence            445555555678889999999999985


No 101
>PF13479 AAA_24:  AAA domain
Probab=82.61  E-value=0.52  Score=39.35  Aligned_cols=21  Identities=29%  Similarity=0.485  Sum_probs=16.9

Q ss_pred             ceEEEEeccCCCCcceEeecC
Q psy9445         154 NCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      +..++.||++|+|||++...-
T Consensus         3 ~~~~lIyG~~G~GKTt~a~~~   23 (213)
T PF13479_consen    3 PIKILIYGPPGSGKTTLAASL   23 (213)
T ss_pred             ceEEEEECCCCCCHHHHHHhC
Confidence            456889999999999877543


No 102
>PRK09183 transposase/IS protein; Provisional
Probab=82.29  E-value=0.76  Score=39.68  Aligned_cols=18  Identities=28%  Similarity=0.464  Sum_probs=14.9

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++-+|++|+||||.+..
T Consensus       104 ~v~l~Gp~GtGKThLa~a  121 (259)
T PRK09183        104 NIVLLGPSGVGKTHLAIA  121 (259)
T ss_pred             eEEEEeCCCCCHHHHHHH
Confidence            356799999999998755


No 103
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=82.23  E-value=0.69  Score=39.87  Aligned_cols=38  Identities=18%  Similarity=0.238  Sum_probs=23.6

Q ss_pred             cchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         133 KQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       133 ~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+...+... ..+++.+-.+  -.++-||++|+||||-..+
T Consensus        87 ~~~~~l~~~-~~~~~~~~~~--~nl~l~G~~G~GKThLa~A  124 (254)
T COG1484          87 IDKKALEDL-ASLVEFFERG--ENLVLLGPPGVGKTHLAIA  124 (254)
T ss_pred             hhHHHHHHH-HHHHHHhccC--CcEEEECCCCCcHHHHHHH
Confidence            344444442 3344443333  4467799999999998854


No 104
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=82.21  E-value=0.63  Score=42.49  Aligned_cols=27  Identities=26%  Similarity=0.386  Sum_probs=19.6

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +++.++. .++.++..|+||||||.||.
T Consensus       141 ~~~~l~~-~~GlilI~G~TGSGKTT~l~  167 (372)
T TIGR02525       141 LFNSLLP-AAGLGLICGETGSGKSTLAA  167 (372)
T ss_pred             HHHHHHh-cCCEEEEECCCCCCHHHHHH
Confidence            3444433 45568889999999999983


No 105
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=81.99  E-value=0.62  Score=38.41  Aligned_cols=28  Identities=25%  Similarity=0.379  Sum_probs=19.7

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+..++...+-.++..|..||||||+|.
T Consensus         9 a~~~~l~~~~~~~~l~G~aGtGKT~~l~   36 (196)
T PF13604_consen    9 AVRAILTSGDRVSVLQGPAGTGKTTLLK   36 (196)
T ss_dssp             HHHHHHHCTCSEEEEEESTTSTHHHHHH
T ss_pred             HHHHHHhcCCeEEEEEECCCCCHHHHHH
Confidence            3455555544445568999999999884


No 106
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=81.62  E-value=0.95  Score=35.37  Aligned_cols=27  Identities=37%  Similarity=0.533  Sum_probs=20.9

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +++.+.+|.+  ++..|+||+|||..+..
T Consensus         7 ~~~~i~~~~~--~li~aptGsGKT~~~~~   33 (169)
T PF00270_consen    7 AIEAIISGKN--VLISAPTGSGKTLAYIL   33 (169)
T ss_dssp             HHHHHHTTSE--EEEECSTTSSHHHHHHH
T ss_pred             HHHHHHcCCC--EEEECCCCCccHHHHHH
Confidence            4455566666  77899999999998865


No 107
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=81.50  E-value=0.84  Score=37.88  Aligned_cols=23  Identities=17%  Similarity=0.518  Sum_probs=18.9

Q ss_pred             cCCceEEEEeccCCCCcceEeec
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ......|+-||++|+|||+....
T Consensus        35 ~~~~~~lll~G~~G~GKT~la~~   57 (226)
T TIGR03420        35 GKGDRFLYLWGESGSGKSHLLQA   57 (226)
T ss_pred             cCCCCeEEEECCCCCCHHHHHHH
Confidence            45667899999999999987743


No 108
>PRK08939 primosomal protein DnaI; Reviewed
Probab=81.32  E-value=0.71  Score=40.95  Aligned_cols=41  Identities=17%  Similarity=0.370  Sum_probs=25.9

Q ss_pred             cchhhhccccchhHHHHhcC-CceEEEEeccCCCCcceEeecC
Q psy9445         133 KQVDVYKYVVNPLIDEVLSG-YNCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       133 ~q~ev~~~~~~~~v~~~~~G-~n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      .+..++.. +...++....| ..-.++-||++|+||||-+.+-
T Consensus       135 ~~~~~~~~-~~~fi~~~~~~~~~~gl~L~G~~G~GKThLa~Ai  176 (306)
T PRK08939        135 DRLDALMA-ALDFLEAYPPGEKVKGLYLYGDFGVGKSYLLAAI  176 (306)
T ss_pred             HHHHHHHH-HHHHHHHhhccCCCCeEEEECCCCCCHHHHHHHH
Confidence            44445443 24445444332 2346999999999999998653


No 109
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=81.24  E-value=0.52  Score=39.00  Aligned_cols=17  Identities=41%  Similarity=0.571  Sum_probs=14.2

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      .|+..|+||+|||.|+.
T Consensus         3 vi~lvGptGvGKTTt~a   19 (196)
T PF00448_consen    3 VIALVGPTGVGKTTTIA   19 (196)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCchHhHHH
Confidence            46678999999999983


No 110
>PRK06835 DNA replication protein DnaC; Validated
Probab=81.22  E-value=0.81  Score=41.07  Aligned_cols=29  Identities=34%  Similarity=0.519  Sum_probs=21.3

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..++.+-... -.++-||++|+||||.+.+
T Consensus       174 ~f~~~f~~~~-~~Lll~G~~GtGKThLa~a  202 (329)
T PRK06835        174 NFIENFDKNN-ENLLFYGNTGTGKTFLSNC  202 (329)
T ss_pred             HHHHHHhccC-CcEEEECCCCCcHHHHHHH
Confidence            3455544333 5699999999999998865


No 111
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=81.10  E-value=0.68  Score=34.55  Aligned_cols=50  Identities=20%  Similarity=0.241  Sum_probs=27.4

Q ss_pred             EEEeccCCCCcceEeecCCCC--CC--CCCC--CCCCCCCchhHHHHHHHHHHHhc
Q psy9445         157 VFAYGQTGTGKTFTMEGEKSN--DP--SISW--QDDPLSGIVPRAMNHLFDELRLL  206 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G~~~~--~~--~~~~--~~~~~~Gii~r~~~~lf~~~~~~  206 (243)
                      |+-||+.|+|||+...--...  .+  ..+.  -.....+-..+.+..+|++....
T Consensus         1 ill~G~~G~GKT~l~~~la~~l~~~~~~i~~~~~~~~~~~~~~~~i~~~~~~~~~~   56 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARALAQYLGFPFIEIDGSELISSYAGDSEQKIRDFFKKAKKS   56 (132)
T ss_dssp             EEEESSTTSSHHHHHHHHHHHTTSEEEEEETTHHHTSSTTHHHHHHHHHHHHHHHT
T ss_pred             CEEECcCCCCeeHHHHHHHhhccccccccccccccccccccccccccccccccccc
Confidence            577999999999875321000  00  0000  00112355677888888877653


No 112
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=80.01  E-value=0.88  Score=41.26  Aligned_cols=37  Identities=27%  Similarity=0.498  Sum_probs=26.6

Q ss_pred             CCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         131 ESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       131 ~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +..|..+|+.++.    .+.......+|.-|..|+||||.+
T Consensus         3 n~eQ~~~~~~v~~----~~~~~~~~~~fv~G~~GtGKs~l~   39 (364)
T PF05970_consen    3 NEEQRRVFDTVIE----AIENEEGLNFFVTGPAGTGKSFLI   39 (364)
T ss_pred             CHHHHHHHHHHHH----HHHccCCcEEEEEcCCCCChhHHH
Confidence            3567888877543    333344567788999999999986


No 113
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=79.71  E-value=0.88  Score=33.74  Aligned_cols=16  Identities=25%  Similarity=0.482  Sum_probs=13.4

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+-.|.+|||||+..
T Consensus         1 vI~I~G~~gsGKST~a   16 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLA   16 (121)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             CEEEECCCCCCHHHHH
Confidence            4778999999998765


No 114
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=79.28  E-value=0.97  Score=45.79  Aligned_cols=27  Identities=33%  Similarity=0.567  Sum_probs=20.0

Q ss_pred             hHHHHhc--CCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLS--GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~--G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..++.  |-+.+++.||++|+|||.|+
T Consensus       770 fL~paIkgsgpnnvLYIyG~PGTGKTATV  798 (1164)
T PTZ00112        770 FLESGIKQSGSNQILYISGMPGTGKTATV  798 (1164)
T ss_pred             HHHHHHhcCCCCceEEEECCCCCCHHHHH
Confidence            3444454  44556789999999999987


No 115
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=78.86  E-value=0.49  Score=37.66  Aligned_cols=23  Identities=30%  Similarity=0.475  Sum_probs=13.3

Q ss_pred             hcCCceEEEEeccCCCCcceEee
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+....++.+|..|+|||+.+.
T Consensus        20 ~~~~~~~~ll~G~~G~GKT~ll~   42 (185)
T PF13191_consen   20 QSGSPRNLLLTGESGSGKTSLLR   42 (185)
T ss_dssp             SS-----EEE-B-TTSSHHHHHH
T ss_pred             HcCCCcEEEEECCCCCCHHHHHH
Confidence            45667789999999999998764


No 116
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=78.65  E-value=0.57  Score=38.50  Aligned_cols=28  Identities=32%  Similarity=0.511  Sum_probs=20.0

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +.+.+-.|.+..++.||+.|+|||..|.
T Consensus        11 l~~~l~~~~~~~~~l~G~rg~GKTsLl~   38 (234)
T PF01637_consen   11 LKELLESGPSQHILLYGPRGSGKTSLLK   38 (234)
T ss_dssp             HHHCHHH--SSEEEEEESTTSSHHHHHH
T ss_pred             HHHHHHhhcCcEEEEEcCCcCCHHHHHH
Confidence            3333444667889999999999999874


No 117
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=78.65  E-value=0.89  Score=37.33  Aligned_cols=18  Identities=39%  Similarity=0.562  Sum_probs=12.7

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..+..|+.|||||+|+..
T Consensus        19 ~~~i~GpPGTGKT~~l~~   36 (236)
T PF13086_consen   19 ITLIQGPPGTGKTTTLAS   36 (236)
T ss_dssp             -EEEE-STTSSHHHHHHH
T ss_pred             CEEEECCCCCChHHHHHH
Confidence            345689999999988743


No 118
>PRK14087 dnaA chromosomal replication initiation protein; Provisional
Probab=78.59  E-value=0.69  Score=43.30  Aligned_cols=50  Identities=22%  Similarity=0.406  Sum_probs=29.8

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .|+||...... ++...|.. +..+.+.--..+| .+|-||.+|+||||.|..
T Consensus       111 ~~tFdnFv~g~-~n~~A~~a-a~~~a~~~~~~~n-pl~i~G~~G~GKTHLl~A  160 (450)
T PRK14087        111 ENTFENFVIGS-SNEQAFIA-VQTVSKNPGISYN-PLFIYGESGMGKTHLLKA  160 (450)
T ss_pred             ccchhcccCCC-cHHHHHHH-HHHHHhCcCcccC-ceEEECCCCCcHHHHHHH
Confidence            48888765443 34445543 2333221101234 488999999999999865


No 119
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=78.55  E-value=1.1  Score=38.14  Aligned_cols=23  Identities=30%  Similarity=0.431  Sum_probs=17.5

Q ss_pred             hcCCceEEEEeccCCCCcceEee
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +......++.+|++|+|||+.+.
T Consensus        39 ~~~~~~~~~l~G~~G~GKTtl~~   61 (269)
T TIGR03015        39 LSQREGFILITGEVGAGKTTLIR   61 (269)
T ss_pred             HhcCCCEEEEEcCCCCCHHHHHH
Confidence            33334567889999999998875


No 120
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=78.38  E-value=0.57  Score=34.59  Aligned_cols=16  Identities=31%  Similarity=0.719  Sum_probs=13.4

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      |+-||++|.|||+.+.
T Consensus         1 I~i~G~~G~GKS~l~~   16 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAK   16 (107)
T ss_pred             CEEECCCCCCHHHHHH
Confidence            5679999999988763


No 121
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=77.69  E-value=1.4  Score=36.92  Aligned_cols=21  Identities=43%  Similarity=0.510  Sum_probs=14.2

Q ss_pred             CceEEEEeccCCCCcceEeec
Q psy9445         153 YNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+-.+++.|+.|||||+.-..
T Consensus        18 ~~~~v~~~G~AGTGKT~LA~a   38 (205)
T PF02562_consen   18 NNDLVIVNGPAGTGKTFLALA   38 (205)
T ss_dssp             H-SEEEEE--TTSSTTHHHHH
T ss_pred             hCCeEEEECCCCCcHHHHHHH
Confidence            455789999999999986543


No 122
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=77.30  E-value=1.1  Score=39.89  Aligned_cols=28  Identities=25%  Similarity=0.385  Sum_probs=19.2

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .++..++.+ ...++..|.||||||++|.
T Consensus       139 ~~L~~~v~~-~~~ilI~G~tGSGKTTll~  166 (319)
T PRK13894        139 EAIIAAVRA-HRNILVIGGTGSGKTTLVN  166 (319)
T ss_pred             HHHHHHHHc-CCeEEEECCCCCCHHHHHH
Confidence            345555554 3456667999999997763


No 123
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=76.85  E-value=0.97  Score=39.95  Aligned_cols=28  Identities=25%  Similarity=0.415  Sum_probs=20.3

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+..++.+ ...|+..|.||||||.+|.
T Consensus       123 ~~L~~~v~~-~~~ilI~G~tGSGKTTll~  150 (299)
T TIGR02782       123 DVLREAVLA-RKNILVVGGTGSGKTTLAN  150 (299)
T ss_pred             HHHHHHHHc-CCeEEEECCCCCCHHHHHH
Confidence            345555553 4567889999999999874


No 124
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=76.57  E-value=1.1  Score=34.13  Aligned_cols=17  Identities=24%  Similarity=0.477  Sum_probs=13.9

Q ss_pred             EEEeccCCCCcceEeec
Q psy9445         157 VFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G  173 (243)
                      |+..|.+|||||+....
T Consensus         2 ii~~G~pgsGKSt~a~~   18 (143)
T PF13671_consen    2 IILCGPPGSGKSTLAKR   18 (143)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67899999999886543


No 125
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=76.53  E-value=0.97  Score=39.06  Aligned_cols=21  Identities=24%  Similarity=0.313  Sum_probs=16.1

Q ss_pred             CceEEEEeccCCCCcceEeec
Q psy9445         153 YNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+..++..|..|||||+||..
T Consensus        12 ~~~~~lV~a~AGSGKT~~l~~   32 (315)
T PF00580_consen   12 TEGPLLVNAGAGSGKTTTLLE   32 (315)
T ss_dssp             -SSEEEEEE-TTSSHHHHHHH
T ss_pred             CCCCEEEEeCCCCCchHHHHH
Confidence            566777889999999999964


No 126
>PHA00729 NTP-binding motif containing protein
Probab=76.43  E-value=1.7  Score=36.82  Aligned_cols=30  Identities=17%  Similarity=0.243  Sum_probs=21.2

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+++.+..+--..|+.+|.+|+|||+-...
T Consensus         7 ~~~~~l~~~~f~nIlItG~pGvGKT~LA~a   36 (226)
T PHA00729          7 KIVSAYNNNGFVSAVIFGKQGSGKTTYALK   36 (226)
T ss_pred             HHHHHHhcCCeEEEEEECCCCCCHHHHHHH
Confidence            345555553335799999999999987644


No 127
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=76.06  E-value=1.8  Score=36.14  Aligned_cols=22  Identities=14%  Similarity=0.483  Sum_probs=17.4

Q ss_pred             CCceEEEEeccCCCCcceEeec
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .....++-||++|+||||-+..
T Consensus        40 ~~~~~~~l~G~~G~GKT~La~a   61 (227)
T PRK08903         40 VADRFFYLWGEAGSGRSHLLQA   61 (227)
T ss_pred             CCCCeEEEECCCCCCHHHHHHH
Confidence            3455789999999999987643


No 128
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=76.03  E-value=0.82  Score=37.60  Aligned_cols=17  Identities=29%  Similarity=0.559  Sum_probs=12.9

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      .++.+|++|||||.++.
T Consensus        40 h~li~G~tgsGKS~~l~   56 (205)
T PF01580_consen   40 HLLIAGATGSGKSTLLR   56 (205)
T ss_dssp             SEEEE--TTSSHHHHHH
T ss_pred             eEEEEcCCCCCccHHHH
Confidence            57889999999998875


No 129
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=75.93  E-value=1.2  Score=39.38  Aligned_cols=21  Identities=29%  Similarity=0.347  Sum_probs=16.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+....++-||++|+|||+++
T Consensus        33 ~~~~~~lll~Gp~GtGKT~la   53 (337)
T PRK12402         33 SPNLPHLLVQGPPGSGKTAAV   53 (337)
T ss_pred             CCCCceEEEECCCCCCHHHHH
Confidence            344345888999999999876


No 130
>PRK06921 hypothetical protein; Provisional
Probab=75.61  E-value=1.3  Score=38.50  Aligned_cols=21  Identities=29%  Similarity=0.504  Sum_probs=17.6

Q ss_pred             ceEEEEeccCCCCcceEeecC
Q psy9445         154 NCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      .-.++.||++|+||||.+..-
T Consensus       117 ~~~l~l~G~~G~GKThLa~ai  137 (266)
T PRK06921        117 KNSIALLGQPGSGKTHLLTAA  137 (266)
T ss_pred             CCeEEEECCCCCcHHHHHHHH
Confidence            456889999999999998663


No 131
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=75.26  E-value=0.96  Score=41.72  Aligned_cols=52  Identities=23%  Similarity=0.381  Sum_probs=30.0

Q ss_pred             ceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         119 SKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       119 ~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...|+||-.... .++...|..  ..-+...-.+..--+|-||.+|+||||-|.-
T Consensus        81 ~~~ytFdnFv~g-~~N~~A~aa--~~~va~~~g~~~nplfi~G~~GlGKTHLl~A  132 (408)
T COG0593          81 NPKYTFDNFVVG-PSNRLAYAA--AKAVAENPGGAYNPLFIYGGVGLGKTHLLQA  132 (408)
T ss_pred             CCCCchhheeeC-CchHHHHHH--HHHHHhccCCcCCcEEEECCCCCCHHHHHHH
Confidence            346888865543 344443332  1112222222233588999999999999954


No 132
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=75.12  E-value=1.1  Score=39.01  Aligned_cols=51  Identities=24%  Similarity=0.375  Sum_probs=28.7

Q ss_pred             ceEEEEeccCCCCcceEeecCCCCCCCCCC---C----CCCCCCchhHHHHHHHHHHHh
Q psy9445         154 NCTVFAYGQTGTGKTFTMEGEKSNDPSISW---Q----DDPLSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~---~----~~~~~Gii~r~~~~lf~~~~~  205 (243)
                      .-.|+-||++|+|||.+----.. ....+.   .    -..+-|=-.|-+++||++..+
T Consensus       151 PknVLFyGppGTGKTm~Akalan-e~kvp~l~vkat~liGehVGdgar~Ihely~rA~~  208 (368)
T COG1223         151 PKNVLFYGPPGTGKTMMAKALAN-EAKVPLLLVKATELIGEHVGDGARRIHELYERARK  208 (368)
T ss_pred             cceeEEECCCCccHHHHHHHHhc-ccCCceEEechHHHHHHHhhhHHHHHHHHHHHHHh
Confidence            45689999999999876422111 000000   0    001224556778888877664


No 133
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=74.04  E-value=1.2  Score=39.06  Aligned_cols=54  Identities=24%  Similarity=0.334  Sum_probs=33.2

Q ss_pred             CCceEEEEeccCCCCcceEeecCC---CCC----C----CCCCCCCCCCCchhHHHHHHHHHHHh
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEGEK---SND----P----SISWQDDPLSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G~~---~~~----~----~~~~~~~~~~Gii~r~~~~lf~~~~~  205 (243)
                      .-+.+|.-+|+.|||||+.|---.   ...    .    -.+|.-....-+....+..|+..+..
T Consensus        18 ~~~~~IgL~G~WGsGKSs~l~~l~~~L~~~~~~~~~~i~fn~w~~~~~~~~~~~~~~~l~~~l~~   82 (325)
T PF07693_consen   18 DDPFVIGLYGEWGSGKSSFLNMLKEELKEDNKEKYIFIYFNAWEYDGEDDLWASFLEELFDQLEK   82 (325)
T ss_pred             CCCeEEEEECCCCCCHHHHHHHHHHHHhcccccceeeEEEccccCCCcchHHHHHHHHHHHHHHH
Confidence            456788899999999999883211   000    0    00133333345677778888887765


No 134
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=73.92  E-value=1.4  Score=33.57  Aligned_cols=15  Identities=47%  Similarity=0.596  Sum_probs=12.8

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |+-+|++|+|||..+
T Consensus         2 vlL~G~~G~GKt~l~   16 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLA   16 (139)
T ss_dssp             EEEEESSSSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            678999999998755


No 135
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=73.67  E-value=1.4  Score=35.54  Aligned_cols=17  Identities=29%  Similarity=0.397  Sum_probs=14.2

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      +.++-+|++|+|||++.
T Consensus         4 ~~~ll~GpsGvGKT~la   20 (171)
T PF07724_consen    4 SNFLLAGPSGVGKTELA   20 (171)
T ss_dssp             EEEEEESSTTSSHHHHH
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            46788999999999764


No 136
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=73.61  E-value=1.3  Score=34.18  Aligned_cols=17  Identities=47%  Similarity=0.757  Sum_probs=12.7

Q ss_pred             eEEEEe-ccCCCCcceEe
Q psy9445         155 CTVFAY-GQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ay-G~tgsGKt~Tm  171 (243)
                      ..|+.+ |.||+||||.-
T Consensus        53 pLVlSfHG~tGtGKn~v~   70 (127)
T PF06309_consen   53 PLVLSFHGWTGTGKNFVS   70 (127)
T ss_pred             CEEEEeecCCCCcHHHHH
Confidence            345555 99999999853


No 137
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=73.28  E-value=1.5  Score=32.42  Aligned_cols=15  Identities=33%  Similarity=0.377  Sum_probs=12.5

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |+-.|.+|||||+..
T Consensus         1 I~i~G~~GsGKtTia   15 (129)
T PF13238_consen    1 IGISGIPGSGKTTIA   15 (129)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             CEEECCCCCCHHHHH
Confidence            567899999998765


No 138
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=73.24  E-value=1.6  Score=38.35  Aligned_cols=23  Identities=26%  Similarity=0.314  Sum_probs=16.8

Q ss_pred             cCC-ceEEEEeccCCCCcceEeec
Q psy9445         151 SGY-NCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       151 ~G~-n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .|. ...++-||++|+|||+.+..
T Consensus        39 ~~~~~~~lll~G~~G~GKT~la~~   62 (316)
T PHA02544         39 KGRIPNMLLHSPSPGTGKTTVAKA   62 (316)
T ss_pred             cCCCCeEEEeeCcCCCCHHHHHHH
Confidence            453 34566699999999987743


No 139
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=73.10  E-value=2.4  Score=36.04  Aligned_cols=41  Identities=24%  Similarity=0.250  Sum_probs=26.9

Q ss_pred             ecCCCcchhhhccccchhHHHHhc-C-CceEEEEeccCCCCcce
Q psy9445         128 FSQESKQVDVYKYVVNPLIDEVLS-G-YNCTVFAYGQTGTGKTF  169 (243)
Q Consensus       128 F~~~a~q~ev~~~~~~~~v~~~~~-G-~n~~i~ayG~tgsGKt~  169 (243)
                      |++...|+.+-.. ...+++.+.. + .-..++-||+.|.|||.
T Consensus        23 L~efiGQ~~l~~~-l~i~i~aa~~r~~~l~h~lf~GPPG~GKTT   65 (233)
T PF05496_consen   23 LDEFIGQEHLKGN-LKILIRAAKKRGEALDHMLFYGPPGLGKTT   65 (233)
T ss_dssp             CCCS-S-HHHHHH-HHHHHHHHHCTTS---EEEEESSTTSSHHH
T ss_pred             HHHccCcHHHHhh-hHHHHHHHHhcCCCcceEEEECCCccchhH
Confidence            5666778888665 4666776654 2 33568999999999975


No 140
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=72.45  E-value=1.4  Score=37.88  Aligned_cols=18  Identities=33%  Similarity=0.373  Sum_probs=15.2

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...++-||++|+|||++.
T Consensus        42 ~~~vll~GppGtGKTtlA   59 (261)
T TIGR02881        42 VLHMIFKGNPGTGKTTVA   59 (261)
T ss_pred             cceEEEEcCCCCCHHHHH
Confidence            356788999999999876


No 141
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=72.33  E-value=1.7  Score=38.89  Aligned_cols=28  Identities=25%  Similarity=0.417  Sum_probs=19.3

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+..++.+ ...|+.-|.||||||.+|.
T Consensus       135 ~~L~~~v~~-~~nilI~G~tGSGKTTll~  162 (323)
T PRK13833        135 SVIRSAIDS-RLNIVISGGTGSGKTTLAN  162 (323)
T ss_pred             HHHHHHHHc-CCeEEEECCCCCCHHHHHH
Confidence            344444443 2357889999999999883


No 142
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=72.06  E-value=1.9  Score=35.04  Aligned_cols=28  Identities=21%  Similarity=0.321  Sum_probs=18.5

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +++..++.. ...+.-.|++|||||.++.
T Consensus        16 ~~l~~~v~~-g~~i~I~G~tGSGKTTll~   43 (186)
T cd01130          16 AYLWLAVEA-RKNILISGGTGSGKTTLLN   43 (186)
T ss_pred             HHHHHHHhC-CCEEEEECCCCCCHHHHHH
Confidence            344444442 3456678999999998764


No 143
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=71.46  E-value=1.5  Score=38.38  Aligned_cols=18  Identities=39%  Similarity=0.525  Sum_probs=14.4

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+...|++|+|||+|+..
T Consensus       196 vi~~vGptGvGKTTt~~k  213 (282)
T TIGR03499       196 VIALVGPTGVGKTTTLAK  213 (282)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            455569999999999854


No 144
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=71.35  E-value=1.4  Score=40.39  Aligned_cols=19  Identities=37%  Similarity=0.492  Sum_probs=16.3

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ...|+.+|+||+|||.|+.
T Consensus       174 ~~vi~lvGptGvGKTTT~a  192 (388)
T PRK12723        174 KRVFILVGPTGVGKTTTIA  192 (388)
T ss_pred             CeEEEEECCCCCCHHHHHH
Confidence            4578889999999999984


No 145
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=71.34  E-value=1.5  Score=35.95  Aligned_cols=20  Identities=25%  Similarity=0.356  Sum_probs=14.7

Q ss_pred             CceEEEEeccCCCCcceEee
Q psy9445         153 YNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ....++..|+.|||||+.+.
T Consensus        14 ~P~~~i~aG~~GsGKSt~~~   33 (199)
T PF06414_consen   14 KPTLIIIAGQPGSGKSTLAR   33 (199)
T ss_dssp             S-EEEEEES-TTSTTHHHHH
T ss_pred             CCEEEEEeCCCCCCHHHHHH
Confidence            34668889999999988763


No 146
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=71.13  E-value=2.2  Score=33.52  Aligned_cols=27  Identities=37%  Similarity=0.470  Sum_probs=18.2

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +..++++. ..++..|.+|+|||.++..
T Consensus        17 ~~~~~~~~-~~~~i~~~~GsGKT~~~~~   43 (201)
T smart00487       17 IEALLSGL-RDVILAAPTGSGKTLAALL   43 (201)
T ss_pred             HHHHHcCC-CcEEEECCCCCchhHHHHH
Confidence            33444442 3456789999999997755


No 147
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=70.98  E-value=1.7  Score=42.79  Aligned_cols=21  Identities=33%  Similarity=0.485  Sum_probs=19.2

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+..|.+|||||.+.
T Consensus        82 ~~~~Q~IiisGeSGsGKTe~~  102 (689)
T PF00063_consen   82 TRQNQSIIISGESGSGKTETS  102 (689)
T ss_dssp             HTSEEEEEEEESTTSSHHHHH
T ss_pred             cccccceeeccccccccccch
Confidence            489999999999999999884


No 148
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=70.65  E-value=1.5  Score=39.64  Aligned_cols=28  Identities=25%  Similarity=0.363  Sum_probs=19.1

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ++..+.. ....|+..|.||||||.+|..
T Consensus       154 ~l~~~v~-~~~nilI~G~tGSGKTTll~a  181 (344)
T PRK13851        154 FLHACVV-GRLTMLLCGPTGSGKTTMSKT  181 (344)
T ss_pred             HHHHHHH-cCCeEEEECCCCccHHHHHHH
Confidence            3444333 234577899999999998844


No 149
>PRK06547 hypothetical protein; Provisional
Probab=70.07  E-value=3.2  Score=33.54  Aligned_cols=26  Identities=31%  Similarity=0.378  Sum_probs=16.7

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +..+..+-.--|..+|.+|||||+.-
T Consensus         7 ~~~~~~~~~~~i~i~G~~GsGKTt~a   32 (172)
T PRK06547          7 AARLCGGGMITVLIDGRSGSGKTTLA   32 (172)
T ss_pred             HHHhhcCCCEEEEEECCCCCCHHHHH
Confidence            33433344444556699999998754


No 150
>PLN03025 replication factor C subunit; Provisional
Probab=69.19  E-value=2.3  Score=37.64  Aligned_cols=22  Identities=32%  Similarity=0.418  Sum_probs=16.4

Q ss_pred             CCceEEEEeccCCCCcceEeec
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      |.-..++-||+.|+|||++...
T Consensus        32 ~~~~~lll~Gp~G~GKTtla~~   53 (319)
T PLN03025         32 GNMPNLILSGPPGTGKTTSILA   53 (319)
T ss_pred             CCCceEEEECCCCCCHHHHHHH
Confidence            4334577799999999987743


No 151
>KOG2543|consensus
Probab=68.58  E-value=1.7  Score=39.69  Aligned_cols=19  Identities=42%  Similarity=0.794  Sum_probs=15.7

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|+-||.+||||||++.-
T Consensus        31 S~~~iyG~sgTGKT~~~r~   49 (438)
T KOG2543|consen   31 SIVHIYGHSGTGKTYLVRQ   49 (438)
T ss_pred             eeEEEeccCCCchhHHHHH
Confidence            4468999999999998743


No 152
>PRK13764 ATPase; Provisional
Probab=68.45  E-value=2.3  Score=41.30  Aligned_cols=20  Identities=20%  Similarity=0.331  Sum_probs=16.6

Q ss_pred             ceEEEEeccCCCCcceEeec
Q psy9445         154 NCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...|+..|+||||||+++..
T Consensus       257 ~~~ILIsG~TGSGKTTll~A  276 (602)
T PRK13764        257 AEGILIAGAPGAGKSTFAQA  276 (602)
T ss_pred             CCEEEEECCCCCCHHHHHHH
Confidence            44589999999999998844


No 153
>PRK10536 hypothetical protein; Provisional
Probab=68.36  E-value=2.3  Score=36.90  Aligned_cols=17  Identities=41%  Similarity=0.702  Sum_probs=14.9

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      .-++..|+.||||||..
T Consensus        75 ~lV~i~G~aGTGKT~La   91 (262)
T PRK10536         75 QLIFATGEAGCGKTWIS   91 (262)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            47899999999999865


No 154
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional
Probab=67.81  E-value=2.8  Score=38.44  Aligned_cols=84  Identities=17%  Similarity=0.177  Sum_probs=48.0

Q ss_pred             eEEecceeecCCCcchhhhccccchhHHHHhc----CCceEEEEeccCCCCcceEe------ecCCCCCCCCC--CCCCC
Q psy9445         120 KTFGFDRVFSQESKQVDVYKYVVNPLIDEVLS----GYNCTVFAYGQTGTGKTFTM------EGEKSNDPSIS--WQDDP  187 (243)
Q Consensus       120 ~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~----G~n~~i~ayG~tgsGKt~Tm------~G~~~~~~~~~--~~~~~  187 (243)
                      +++.|+.+.+..---..+.+.++..+....+.    ...--+.-||+.|+|||+..      +|-.-  ..+.  .-.+.
T Consensus       110 ~~~~f~~~~g~~~~~p~f~dk~~~hi~kn~l~~~~ik~PlgllL~GPPGcGKTllAraiA~elg~~~--i~vsa~eL~sk  187 (413)
T PLN00020        110 RTRSFDNLVGGYYIAPAFMDKVAVHIAKNFLALPNIKVPLILGIWGGKGQGKSFQCELVFKKMGIEP--IVMSAGELESE  187 (413)
T ss_pred             hhcchhhhcCccccCHHHHHHHHHHHHhhhhhccCCCCCeEEEeeCCCCCCHHHHHHHHHHHcCCCe--EEEEHHHhhcC
Confidence            35666766555444455555555555555553    23345778999999999762      12110  0000  00122


Q ss_pred             CCCchhHHHHHHHHHHHh
Q psy9445         188 LSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       188 ~~Gii~r~~~~lf~~~~~  205 (243)
                      ..|=--+.++++|.....
T Consensus       188 ~vGEsEk~IR~~F~~A~~  205 (413)
T PLN00020        188 NAGEPGKLIRQRYREAAD  205 (413)
T ss_pred             cCCcHHHHHHHHHHHHHH
Confidence            346677899999987654


No 155
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=67.76  E-value=3.5  Score=38.36  Aligned_cols=24  Identities=38%  Similarity=0.600  Sum_probs=19.0

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .+..+++|.|  +++.++||||||..
T Consensus        34 ai~~~l~g~d--vi~~a~TGsGKT~a   57 (460)
T PRK11776         34 SLPAILAGKD--VIAQAKTGSGKTAA   57 (460)
T ss_pred             HHHHHhcCCC--EEEECCCCCcHHHH
Confidence            4556778887  67788999999965


No 156
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=67.46  E-value=2.5  Score=40.33  Aligned_cols=29  Identities=31%  Similarity=0.536  Sum_probs=20.8

Q ss_pred             chhHHHHhcCCc--eEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLSGYN--CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~G~n--~~i~ayG~tgsGKt~Tm  171 (243)
                      ...++..+.|..  .-++.+|++|+|||.|+
T Consensus        32 ~~wl~~~~~~~~~~~iLlLtGP~G~GKtttv   62 (519)
T PF03215_consen   32 RSWLEEMFSGSSPKRILLLTGPSGCGKTTTV   62 (519)
T ss_pred             HHHHHHHhccCCCcceEEEECCCCCCHHHHH
Confidence            445555555543  45778999999999988


No 157
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=67.40  E-value=3.1  Score=33.74  Aligned_cols=25  Identities=44%  Similarity=0.611  Sum_probs=18.5

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .++.++.|.|  ++..++||+|||.+.
T Consensus        29 ~~~~~~~~~~--~li~~~TG~GKT~~~   53 (203)
T cd00268          29 AIPPLLSGRD--VIGQAQTGSGKTAAF   53 (203)
T ss_pred             HHHHHhcCCc--EEEECCCCCcHHHHH
Confidence            3455566776  577899999999773


No 158
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=67.11  E-value=2.1  Score=39.12  Aligned_cols=19  Identities=37%  Similarity=0.392  Sum_probs=15.6

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ...+...|++|+|||+|+.
T Consensus       137 g~ii~lvGptGvGKTTtia  155 (374)
T PRK14722        137 GGVFALMGPTGVGKTTTTA  155 (374)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3466678999999999984


No 159
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]
Probab=66.98  E-value=2.4  Score=38.15  Aligned_cols=24  Identities=29%  Similarity=0.549  Sum_probs=18.2

Q ss_pred             HHhcCCceEEEEeccCCCCcceEee
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+..+. |.|+.-|.||||||.++-
T Consensus       168 ~av~~r-~NILisGGTGSGKTTlLN  191 (355)
T COG4962         168 RAVGIR-CNILISGGTGSGKTTLLN  191 (355)
T ss_pred             HHHhhc-eeEEEeCCCCCCHHHHHH
Confidence            334443 788999999999998763


No 160
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=66.50  E-value=2.6  Score=36.92  Aligned_cols=21  Identities=33%  Similarity=0.706  Sum_probs=18.1

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|++-+|+..|++|+|||.-+
T Consensus         1 kg~~fnImVvG~sG~GKTTFI   21 (281)
T PF00735_consen    1 KGFNFNIMVVGESGLGKTTFI   21 (281)
T ss_dssp             HEEEEEEEEEECTTSSHHHHH
T ss_pred             CCceEEEEEECCCCCCHHHHH
Confidence            378889999999999998754


No 161
>PRK13342 recombination factor protein RarA; Reviewed
Probab=66.39  E-value=3.7  Score=37.86  Aligned_cols=25  Identities=28%  Similarity=0.433  Sum_probs=18.4

Q ss_pred             HHhcCCceEEEEeccCCCCcceEee
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+-.+....++-||+.|+|||+...
T Consensus        30 ~i~~~~~~~ilL~GppGtGKTtLA~   54 (413)
T PRK13342         30 MIEAGRLSSMILWGPPGTGKTTLAR   54 (413)
T ss_pred             HHHcCCCceEEEECCCCCCHHHHHH
Confidence            3334555577789999999997764


No 162
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=65.95  E-value=2.2  Score=38.56  Aligned_cols=19  Identities=42%  Similarity=0.637  Sum_probs=15.6

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ...++-||++|+|||+...
T Consensus       156 p~gvLL~GppGtGKT~lak  174 (364)
T TIGR01242       156 PKGVLLYGPPGTGKTLLAK  174 (364)
T ss_pred             CceEEEECCCCCCHHHHHH
Confidence            3458899999999998764


No 163
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=65.73  E-value=2  Score=38.53  Aligned_cols=27  Identities=22%  Similarity=0.341  Sum_probs=18.5

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ++..++.+ ...|+..|.||||||.+|-
T Consensus       152 ~L~~~v~~-~~nili~G~tgSGKTTll~  178 (332)
T PRK13900        152 FLEHAVIS-KKNIIISGGTSTGKTTFTN  178 (332)
T ss_pred             HHHHHHHc-CCcEEEECCCCCCHHHHHH
Confidence            34444433 2457788999999999884


No 164
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=64.79  E-value=3.3  Score=38.14  Aligned_cols=25  Identities=40%  Similarity=0.547  Sum_probs=19.0

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..++.|.|  |++-++||||||.+.
T Consensus        38 aip~il~g~d--vi~~ApTGsGKTla~   62 (423)
T PRK04837         38 ALPLTLAGRD--VAGQAQTGTGKTMAF   62 (423)
T ss_pred             HHHHHhCCCc--EEEECCCCchHHHHH
Confidence            4556788987  556779999999753


No 165
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=64.73  E-value=2.7  Score=36.64  Aligned_cols=18  Identities=33%  Similarity=0.504  Sum_probs=14.8

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..++-||+.|+|||+...
T Consensus        31 ~~~ll~Gp~G~GKT~la~   48 (305)
T TIGR00635        31 DHLLLYGPPGLGKTTLAH   48 (305)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            347789999999998763


No 166
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=64.59  E-value=2.5  Score=28.33  Aligned_cols=15  Identities=27%  Similarity=0.554  Sum_probs=11.9

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      .+-.|++|||||.-|
T Consensus        26 tli~G~nGsGKSTll   40 (62)
T PF13555_consen   26 TLITGPNGSGKSTLL   40 (62)
T ss_pred             EEEECCCCCCHHHHH
Confidence            456799999998655


No 167
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=64.51  E-value=2.9  Score=38.49  Aligned_cols=18  Identities=39%  Similarity=0.519  Sum_probs=14.4

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..-|.-.|+||.|||.|+
T Consensus       203 ~~vi~LVGPTGVGKTTTl  220 (407)
T COG1419         203 KRVIALVGPTGVGKTTTL  220 (407)
T ss_pred             CcEEEEECCCCCcHHHHH
Confidence            444555699999999998


No 168
>PF02456 Adeno_IVa2:  Adenovirus IVa2 protein;  InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter [].; GO: 0019083 viral transcription
Probab=64.50  E-value=3  Score=37.16  Aligned_cols=75  Identities=21%  Similarity=0.301  Sum_probs=40.7

Q ss_pred             EEEeccCCCCcceEeec---CCCC---CCCCCCCCCCCCCchhHHHHHHHH-HHHh-c----CCc-----eE-----EEE
Q psy9445         157 VFAYGQTGTGKTFTMEG---EKSN---DPSISWQDDPLSGIVPRAMNHLFD-ELRL-L----GDA-----EF-----TVR  214 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G---~~~~---~~~~~~~~~~~~Gii~r~~~~lf~-~~~~-~----~~~-----~~-----~v~  214 (243)
                      ...||+|||||++-+-.   ..--   +.++.. -.++.|.||..-...++ ++.+ .    .+.     ..     -|.
T Consensus        90 ~~VYGPTG~GKSqLlRNLis~~lI~P~PETVfF-ItP~~~mIpp~E~~aW~~Ql~EgNY~~~~~gTi~P~t~t~~P~Fv~  168 (369)
T PF02456_consen   90 GVVYGPTGSGKSQLLRNLISCQLIQPPPETVFF-ITPQKDMIPPQEITAWETQLCEGNYDCGPDGTIVPQTGTFRPKFVE  168 (369)
T ss_pred             EEEECCCCCCHHHHHHHhhhcCcccCCCCceEE-ECCCCCCCCHHHHHHHHHHHHhcCCCCCCCCeecccccccccccee
Confidence            45699999999987642   1111   111111 23456888887666664 3322 1    110     11     256


Q ss_pred             EEEEEEECCeEEeCCCCC
Q psy9445         215 VSFLEIYNEELIDLLSPT  232 (243)
Q Consensus       215 ~S~~eiyne~v~DLL~~~  232 (243)
                      ++|=|.-.|.=+|.=+|+
T Consensus       169 msy~e~t~~~NldI~~p~  186 (369)
T PF02456_consen  169 MSYDEATSPENLDITNPN  186 (369)
T ss_pred             ecHhhhCCccccCCCCch
Confidence            666666666666665554


No 169
>PRK04328 hypothetical protein; Provisional
Probab=64.46  E-value=5.3  Score=34.16  Aligned_cols=26  Identities=42%  Similarity=0.654  Sum_probs=20.5

Q ss_pred             hhHHHHhcC---CceEEEEeccCCCCcce
Q psy9445         144 PLIDEVLSG---YNCTVFAYGQTGTGKTF  169 (243)
Q Consensus       144 ~~v~~~~~G---~n~~i~ayG~tgsGKt~  169 (243)
                      +-++.++.|   ....++.+|.+|+|||.
T Consensus        10 ~~LD~lL~GGip~gs~ili~G~pGsGKT~   38 (249)
T PRK04328         10 PGMDEILYGGIPERNVVLLSGGPGTGKSI   38 (249)
T ss_pred             hhHHHHhcCCCcCCcEEEEEcCCCCCHHH
Confidence            456777775   46788899999999965


No 170
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=64.46  E-value=3.4  Score=36.00  Aligned_cols=28  Identities=39%  Similarity=0.576  Sum_probs=19.8

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +++.++.. +--++-.|++|+|||..+..
T Consensus        25 ll~~l~~~-~~pvLl~G~~GtGKT~li~~   52 (272)
T PF12775_consen   25 LLDLLLSN-GRPVLLVGPSGTGKTSLIQN   52 (272)
T ss_dssp             HHHHHHHC-TEEEEEESSTTSSHHHHHHH
T ss_pred             HHHHHHHc-CCcEEEECCCCCchhHHHHh
Confidence            44444443 55678899999999988753


No 171
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=64.37  E-value=1.7  Score=39.29  Aligned_cols=46  Identities=28%  Similarity=0.370  Sum_probs=28.3

Q ss_pred             eEEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         120 KTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       120 ~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|.|+.+-++    +++-..    ++..+.+-.-+.|+.+|.+|||||+.+-+
T Consensus        12 ~~~pf~~ivGq----~~~k~a----l~~~~~~p~~~~vli~G~~GtGKs~~ar~   57 (350)
T CHL00081         12 PVFPFTAIVGQ----EEMKLA----LILNVIDPKIGGVMIMGDRGTGKSTTIRA   57 (350)
T ss_pred             CCCCHHHHhCh----HHHHHH----HHHhccCCCCCeEEEEcCCCCCHHHHHHH
Confidence            36777777665    333222    33333332224578999999999998754


No 172
>PF05729 NACHT:  NACHT domain
Probab=64.27  E-value=2.7  Score=32.45  Aligned_cols=18  Identities=22%  Similarity=0.540  Sum_probs=14.6

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++-+|..|+|||..|..
T Consensus         2 ~l~I~G~~G~GKStll~~   19 (166)
T PF05729_consen    2 VLWISGEPGSGKSTLLRK   19 (166)
T ss_pred             EEEEECCCCCChHHHHHH
Confidence            367899999999987743


No 173
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=64.25  E-value=4.7  Score=37.14  Aligned_cols=41  Identities=27%  Similarity=0.302  Sum_probs=27.5

Q ss_pred             cCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         129 SQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       129 ~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      ++...|+-+... ..++-..+-.|.-.+.+-||+.|+|||.-
T Consensus        24 de~vGQ~HLlg~-~~~lrr~v~~~~l~SmIl~GPPG~GKTTl   64 (436)
T COG2256          24 DEVVGQEHLLGE-GKPLRRAVEAGHLHSMILWGPPGTGKTTL   64 (436)
T ss_pred             HHhcChHhhhCC-CchHHHHHhcCCCceeEEECCCCCCHHHH
Confidence            344456666544 34444444557778899999999999864


No 174
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=64.23  E-value=3.2  Score=37.69  Aligned_cols=36  Identities=33%  Similarity=0.561  Sum_probs=24.5

Q ss_pred             chhhhccccchhHHH-Hhc--CCc--eEEEEeccCCCCcce
Q psy9445         134 QVDVYKYVVNPLIDE-VLS--GYN--CTVFAYGQTGTGKTF  169 (243)
Q Consensus       134 q~ev~~~~~~~~v~~-~~~--G~n--~~i~ayG~tgsGKt~  169 (243)
                      -.++.+.+..|+.+. +|+  |..  --|+-||+.|+|||-
T Consensus       160 i~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTL  200 (406)
T COG1222         160 IQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTL  200 (406)
T ss_pred             HHHHHHHhcccccCHHHHHHcCCCCCCceEeeCCCCCcHHH
Confidence            445555566676654 454  543  458999999999974


No 175
>KOG3859|consensus
Probab=64.18  E-value=3.7  Score=36.11  Aligned_cols=29  Identities=31%  Similarity=0.647  Sum_probs=23.4

Q ss_pred             chhHHH-HhcCCceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDE-VLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~-~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .++|+. +-+||.-.|++.|.||.|||.-|
T Consensus        30 dQLV~ksv~~GF~FNilCvGETg~GKsTLm   59 (406)
T KOG3859|consen   30 DQLVNKSVSQGFCFNILCVGETGLGKSTLM   59 (406)
T ss_pred             HHHHHHHHhcCceEEEEEeccCCccHHHHH
Confidence            345654 55699999999999999998755


No 176
>PTZ00424 helicase 45; Provisional
Probab=63.77  E-value=4.5  Score=36.62  Aligned_cols=26  Identities=42%  Similarity=0.643  Sum_probs=19.9

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+..+++|.|.  +..++||||||.+.
T Consensus        57 ~ai~~i~~~~d~--ii~apTGsGKT~~~   82 (401)
T PTZ00424         57 RGIKPILDGYDT--IGQAQSGTGKTATF   82 (401)
T ss_pred             HHHHHHhCCCCE--EEECCCCChHHHHH
Confidence            356677888885  46789999999764


No 177
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=63.45  E-value=3.9  Score=40.34  Aligned_cols=21  Identities=29%  Similarity=0.419  Sum_probs=19.4

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+.-|.+|||||.+.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T smart00242       89 DKENQSIIISGESGAGKTENT  109 (677)
T ss_pred             cCCCceEEEecCCCCcchHHH
Confidence            588999999999999999876


No 178
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=62.98  E-value=3.3  Score=36.11  Aligned_cols=21  Identities=24%  Similarity=0.642  Sum_probs=18.4

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|+...|+..|++|+|||..+
T Consensus         1 ~g~~f~I~vvG~sg~GKSTli   21 (276)
T cd01850           1 KGFQFNIMVVGESGLGKSTFI   21 (276)
T ss_pred             CCcEEEEEEEcCCCCCHHHHH
Confidence            488899999999999998764


No 179
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=62.76  E-value=3.3  Score=34.94  Aligned_cols=21  Identities=38%  Similarity=0.490  Sum_probs=17.2

Q ss_pred             ceEEEEeccCCCCcceEeecC
Q psy9445         154 NCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      ...++-||.+|+|||+....-
T Consensus        12 ~~~~liyG~~G~GKtt~a~~~   32 (220)
T TIGR01618        12 PNMYLIYGKPGTGKTSTIKYL   32 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHhc
Confidence            345899999999999987554


No 180
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=62.66  E-value=3.3  Score=38.74  Aligned_cols=52  Identities=17%  Similarity=0.365  Sum_probs=30.7

Q ss_pred             ceEEecceeecCCCcchhhhccccchhHHHH--hcC--CceEEEEeccCCCCcceEeec
Q psy9445         119 SKTFGFDRVFSQESKQVDVYKYVVNPLIDEV--LSG--YNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       119 ~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~--~~G--~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...|+||..... .++...|.. +..+.+..  ..|  +| -++-||++|+||||.+..
T Consensus       105 ~~~~tFdnFv~g-~~N~~a~~~-a~~~a~~~~~~~~~~~n-pl~L~G~~G~GKTHLl~A  160 (445)
T PRK12422        105 DPLMTFANFLVT-PENDLPHRI-LQEFTKVSEQGKGFPFN-PIYLFGPEGSGKTHLMQA  160 (445)
T ss_pred             CccccccceeeC-CcHHHHHHH-HHHHHhccccccCCCCc-eEEEEcCCCCCHHHHHHH
Confidence            346888866643 344444433 23333221  123  34 477899999999998754


No 181
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=62.48  E-value=3.5  Score=36.98  Aligned_cols=15  Identities=40%  Similarity=0.780  Sum_probs=12.7

Q ss_pred             eEEEEeccCCCCcce
Q psy9445         155 CTVFAYGQTGTGKTF  169 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~  169 (243)
                      ..|+..|+||||||+
T Consensus        98 SNILLiGPTGsGKTl  112 (408)
T COG1219          98 SNILLIGPTGSGKTL  112 (408)
T ss_pred             ccEEEECCCCCcHHH
Confidence            457889999999985


No 182
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=62.27  E-value=3.5  Score=31.51  Aligned_cols=15  Identities=40%  Similarity=0.787  Sum_probs=12.6

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      ++-+|.+|+|||+.+
T Consensus         2 ~~i~G~~G~GKT~l~   16 (165)
T cd01120           2 ILVFGPTGSGKTTLA   16 (165)
T ss_pred             eeEeCCCCCCHHHHH
Confidence            456899999999866


No 183
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=61.75  E-value=4  Score=35.14  Aligned_cols=28  Identities=29%  Similarity=0.583  Sum_probs=21.8

Q ss_pred             HHHHhcCCceE-EEEeccCCCCcceEeec
Q psy9445         146 IDEVLSGYNCT-VFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       146 v~~~~~G~n~~-i~ayG~tgsGKt~Tm~G  173 (243)
                      ...+++|..+- ++.||..|+|||.++-.
T Consensus        43 t~~Fl~G~pannvLL~G~rGtGKSSlVka   71 (249)
T PF05673_consen   43 TEQFLQGLPANNVLLWGARGTGKSSLVKA   71 (249)
T ss_pred             HHHHHcCCCCcceEEecCCCCCHHHHHHH
Confidence            35688887543 77799999999988754


No 184
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=61.64  E-value=3.6  Score=35.90  Aligned_cols=21  Identities=29%  Similarity=0.271  Sum_probs=16.2

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|....++-||+.|+|||+++
T Consensus        35 ~~~~~~~ll~G~~G~GKt~~~   55 (319)
T PRK00440         35 EKNMPHLLFAGPPGTGKTTAA   55 (319)
T ss_pred             CCCCCeEEEECCCCCCHHHHH
Confidence            344445788999999998766


No 185
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=61.60  E-value=5.3  Score=36.81  Aligned_cols=24  Identities=42%  Similarity=0.552  Sum_probs=19.6

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .+..+++|.+  +++.++||+|||..
T Consensus        31 ai~~~~~g~d--~l~~apTGsGKT~~   54 (434)
T PRK11192         31 AIPPALDGRD--VLGSAPTGTGKTAA   54 (434)
T ss_pred             HHHHHhCCCC--EEEECCCCChHHHH
Confidence            4566778876  78889999999976


No 186
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=61.59  E-value=5  Score=39.62  Aligned_cols=21  Identities=33%  Similarity=0.479  Sum_probs=19.2

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+.-|.+|||||.+.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T cd01383          89 DEVNQSIIISGESGAGKTETA  109 (677)
T ss_pred             cCCCceEEEecCCCCCcchHH
Confidence            489999999999999999875


No 187
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=61.59  E-value=3.5  Score=36.59  Aligned_cols=24  Identities=25%  Similarity=0.338  Sum_probs=19.8

Q ss_pred             hcCCceEEEEeccCCCCcceEeec
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ....+.-++-||+.|||||.+|.-
T Consensus        19 ~~~~~~r~vL~G~~GsGKS~~L~q   42 (309)
T PF10236_consen   19 KSSKNNRYVLTGERGSGKSVLLAQ   42 (309)
T ss_pred             ccCCceEEEEECCCCCCHHHHHHH
Confidence            346677899999999999998854


No 188
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=61.54  E-value=3.7  Score=31.69  Aligned_cols=15  Identities=27%  Similarity=0.521  Sum_probs=12.4

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      ++..|..|||||+.-
T Consensus         2 i~l~G~~GsGKST~a   16 (150)
T cd02021           2 IVVMGVSGSGKSTVG   16 (150)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            567899999998763


No 189
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=61.54  E-value=3.8  Score=32.77  Aligned_cols=14  Identities=43%  Similarity=0.733  Sum_probs=12.4

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+.+|..|||||+.
T Consensus         2 i~i~G~pGsGKst~   15 (183)
T TIGR01359         2 VFVLGGPGSGKGTQ   15 (183)
T ss_pred             EEEECCCCCCHHHH
Confidence            67899999999875


No 190
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=61.18  E-value=4.8  Score=39.74  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=19.2

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|||||.+.
T Consensus        85 ~~~~QsIiisGESGaGKTe~~  105 (674)
T cd01384          85 EGKSQSILVSGESGAGKTETT  105 (674)
T ss_pred             cCCCceEEEECCCCCCchhHH
Confidence            488999999999999999875


No 191
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=61.11  E-value=6.4  Score=32.79  Aligned_cols=28  Identities=32%  Similarity=0.503  Sum_probs=20.9

Q ss_pred             hhHHHHhcC---CceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLSG---YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~G---~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +-++.++.|   ....+.-+|++|+|||..+
T Consensus         6 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l~   36 (235)
T cd01123           6 KALDELLGGGIETGSITEIFGEFGSGKTQLC   36 (235)
T ss_pred             hhhHhhccCCCCCCeEEEEECCCCCCHHHHH
Confidence            456677774   3466788999999998765


No 192
>PRK00131 aroK shikimate kinase; Reviewed
Probab=60.98  E-value=4.2  Score=31.86  Aligned_cols=17  Identities=24%  Similarity=0.282  Sum_probs=14.3

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.|+.+|.+|||||+.-
T Consensus         5 ~~i~l~G~~GsGKstla   21 (175)
T PRK00131          5 PNIVLIGFMGAGKSTIG   21 (175)
T ss_pred             CeEEEEcCCCCCHHHHH
Confidence            36889999999998763


No 193
>PF06048 DUF927:  Domain of unknown function (DUF927);  InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=60.97  E-value=3.7  Score=35.94  Aligned_cols=29  Identities=31%  Similarity=0.528  Sum_probs=21.1

Q ss_pred             cchhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         142 VNPLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       142 ~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|++ ..+.--+..+-.||++++|||.++
T Consensus       182 a~pLL-~~l~~~~~~~hl~G~Ss~GKTt~~  210 (286)
T PF06048_consen  182 AAPLL-SLLGVEGFGFHLYGQSSSGKTTAL  210 (286)
T ss_pred             HHHHH-HHhCCCceEEEEEeCCCCCHHHHH
Confidence            44555 444555667888999999999766


No 194
>PRK07261 topology modulation protein; Provisional
Probab=60.82  E-value=3.9  Score=32.78  Aligned_cols=15  Identities=27%  Similarity=0.465  Sum_probs=12.5

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |+..|.+|||||.-.
T Consensus         3 i~i~G~~GsGKSTla   17 (171)
T PRK07261          3 IAIIGYSGSGKSTLA   17 (171)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            567899999998755


No 195
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=60.72  E-value=5.9  Score=36.93  Aligned_cols=25  Identities=48%  Similarity=0.612  Sum_probs=19.9

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+++|.|  +++-.+||||||.+.
T Consensus        31 ai~~il~g~d--vlv~apTGsGKTla~   55 (456)
T PRK10590         31 AIPAVLEGRD--LMASAQTGTGKTAGF   55 (456)
T ss_pred             HHHHHhCCCC--EEEECCCCCcHHHHH
Confidence            4566788887  677889999999763


No 196
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=60.65  E-value=3.1  Score=36.22  Aligned_cols=13  Identities=46%  Similarity=0.818  Sum_probs=11.5

Q ss_pred             eccCCCCcceEee
Q psy9445         160 YGQTGTGKTFTME  172 (243)
Q Consensus       160 yG~tgsGKt~Tm~  172 (243)
                      .|++|||||.||-
T Consensus        33 iGpSGsGKTTtLk   45 (309)
T COG1125          33 IGPSGSGKTTTLK   45 (309)
T ss_pred             ECCCCCcHHHHHH
Confidence            5999999999983


No 197
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=60.62  E-value=4.6  Score=37.84  Aligned_cols=27  Identities=26%  Similarity=0.491  Sum_probs=18.2

Q ss_pred             chhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..++..+..|.|  |+-||.+|+|||+..
T Consensus       185 e~l~~~L~~~~~--iil~GppGtGKT~lA  211 (459)
T PRK11331        185 ETILKRLTIKKN--IILQGPPGVGKTFVA  211 (459)
T ss_pred             HHHHHHHhcCCC--EEEECCCCCCHHHHH
Confidence            334545555554  445999999999765


No 198
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=60.56  E-value=4.7  Score=39.80  Aligned_cols=21  Identities=29%  Similarity=0.434  Sum_probs=19.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTe~~  103 (679)
T cd00124          83 DRRNQSIIISGESGAGKTENT  103 (679)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            489999999999999999876


No 199
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion. These proteins aid the transfer of DNA from the plasmid into the host bacterial chromosome. They contain an ATP binding domain. VirD4 is involved in DNA transfer to plant cells and is required for virulence.
Probab=60.40  E-value=5.5  Score=36.18  Aligned_cols=16  Identities=25%  Similarity=0.445  Sum_probs=14.0

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      ++..|.||||||.++.
T Consensus         2 ~lv~g~tGsGKt~~~v   17 (384)
T cd01126           2 VLVFAPTRSGKGVGFV   17 (384)
T ss_pred             eeEecCCCCCCccEEE
Confidence            5788999999999875


No 200
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=60.16  E-value=4  Score=37.36  Aligned_cols=18  Identities=44%  Similarity=0.650  Sum_probs=15.0

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...|+-||++|+|||+..
T Consensus       165 p~gvLL~GppGtGKT~lA  182 (389)
T PRK03992        165 PKGVLLYGPPGTGKTLLA  182 (389)
T ss_pred             CCceEEECCCCCChHHHH
Confidence            456889999999999765


No 201
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=60.08  E-value=4.8  Score=39.86  Aligned_cols=21  Identities=29%  Similarity=0.436  Sum_probs=19.1

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+.-|.+|||||.+.
T Consensus        88 ~~~~QsIiiSGESGAGKTes~  108 (693)
T cd01377          88 DRENQSILITGESGAGKTENT  108 (693)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            489999999999999999875


No 202
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=60.06  E-value=5.4  Score=39.32  Aligned_cols=21  Identities=29%  Similarity=0.408  Sum_probs=19.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTes~  103 (671)
T cd01381          83 EKKNQCIIISGESGAGKTEST  103 (671)
T ss_pred             cCCCceEEEEcCCCCCeehHH
Confidence            489999999999999999876


No 203
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=59.73  E-value=5.1  Score=39.66  Aligned_cols=21  Identities=29%  Similarity=0.422  Sum_probs=19.2

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+.-|.+|||||.|.
T Consensus        91 ~~~~QsIiisGESGAGKTet~  111 (692)
T cd01385          91 KKVNQCIVISGESGSGKTEST  111 (692)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            488999999999999999875


No 204
>PRK08118 topology modulation protein; Reviewed
Probab=59.70  E-value=4.2  Score=32.51  Aligned_cols=14  Identities=29%  Similarity=0.567  Sum_probs=12.0

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+..|+.|||||+.
T Consensus         4 I~I~G~~GsGKSTl   17 (167)
T PRK08118          4 IILIGSGGSGKSTL   17 (167)
T ss_pred             EEEECCCCCCHHHH
Confidence            67889999999863


No 205
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=59.41  E-value=7.3  Score=32.41  Aligned_cols=28  Identities=39%  Similarity=0.606  Sum_probs=20.2

Q ss_pred             hhHHHHhc-C--CceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLS-G--YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~-G--~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +-++.++. |  .+..++..|.+|||||.-.
T Consensus         6 ~~LD~~l~GGip~gs~~li~G~~GsGKT~l~   36 (226)
T PF06745_consen    6 PGLDELLGGGIPKGSVVLISGPPGSGKTTLA   36 (226)
T ss_dssp             TTHHHHTTTSEETTSEEEEEESTTSSHHHHH
T ss_pred             hhHHHhhcCCCCCCcEEEEEeCCCCCcHHHH
Confidence            34566664 4  3678899999999997543


No 206
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=59.35  E-value=5.5  Score=39.29  Aligned_cols=21  Identities=33%  Similarity=0.411  Sum_probs=19.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTe~~  103 (674)
T cd01378          83 ENENQCVIISGESGAGKTEAA  103 (674)
T ss_pred             cCCCceEEEEcCCCCCcchHH
Confidence            489999999999999999876


No 207
>KOG1803|consensus
Probab=59.21  E-value=3.8  Score=39.48  Aligned_cols=17  Identities=41%  Similarity=0.522  Sum_probs=13.9

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      -..--|+.|+|||+|+.
T Consensus       203 l~~I~GPPGTGKT~Tlv  219 (649)
T KOG1803|consen  203 LLIIHGPPGTGKTRTLV  219 (649)
T ss_pred             ceEeeCCCCCCceeeHH
Confidence            34567999999999984


No 208
>CHL00181 cbbX CbbX; Provisional
Probab=59.09  E-value=4.2  Score=35.67  Aligned_cols=15  Identities=40%  Similarity=0.445  Sum_probs=12.9

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      ++-||++|+|||+..
T Consensus        62 ill~G~pGtGKT~lA   76 (287)
T CHL00181         62 MSFTGSPGTGKTTVA   76 (287)
T ss_pred             EEEECCCCCCHHHHH
Confidence            677999999998764


No 209
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=59.09  E-value=4  Score=36.26  Aligned_cols=17  Identities=41%  Similarity=0.557  Sum_probs=14.4

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..++-||++|+|||+..
T Consensus        52 ~~~ll~GppG~GKT~la   68 (328)
T PRK00080         52 DHVLLYGPPGLGKTTLA   68 (328)
T ss_pred             CcEEEECCCCccHHHHH
Confidence            46788999999999765


No 210
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=59.03  E-value=3.7  Score=32.81  Aligned_cols=17  Identities=29%  Similarity=0.548  Sum_probs=13.7

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ...+-||.+|+|||..|
T Consensus        20 g~~vi~G~Ng~GKStil   36 (202)
T PF13476_consen   20 GLNVIYGPNGSGKSTIL   36 (202)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            44567899999999776


No 211
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=59.00  E-value=5  Score=39.89  Aligned_cols=21  Identities=24%  Similarity=0.385  Sum_probs=19.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|||||.+.
T Consensus        88 ~~~~QsIiisGESGaGKTes~  108 (717)
T cd01382          88 LKMSQSIIVSGESGAGKTENT  108 (717)
T ss_pred             cCCCCeEEEecCCCCChhHHH
Confidence            589999999999999999876


No 212
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=58.95  E-value=4.4  Score=34.43  Aligned_cols=18  Identities=39%  Similarity=0.390  Sum_probs=14.3

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      +-..+|++|+|||.|+-.
T Consensus        34 ~~~~~GpagtGKtetik~   51 (231)
T PF12774_consen   34 GGALSGPAGTGKTETIKD   51 (231)
T ss_dssp             EEEEESSTTSSHHHHHHH
T ss_pred             CCCCcCCCCCCchhHHHH
Confidence            334699999999999843


No 213
>TIGR00376 DNA helicase, putative. The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Probab=58.85  E-value=4.8  Score=39.45  Aligned_cols=18  Identities=39%  Similarity=0.466  Sum_probs=15.2

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++..|++|||||+|+..
T Consensus       175 ~~lI~GpPGTGKT~t~~~  192 (637)
T TIGR00376       175 LFLIHGPPGTGKTRTLVE  192 (637)
T ss_pred             eEEEEcCCCCCHHHHHHH
Confidence            356899999999999864


No 214
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=58.18  E-value=3.8  Score=38.09  Aligned_cols=18  Identities=44%  Similarity=0.530  Sum_probs=14.4

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++..|++|+|||+|+..
T Consensus       223 ~i~~vGptGvGKTTt~~k  240 (424)
T PRK05703        223 VVALVGPTGVGKTTTLAK  240 (424)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            556669999999998743


No 215
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=58.16  E-value=5.6  Score=38.81  Aligned_cols=27  Identities=33%  Similarity=0.566  Sum_probs=21.1

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++..+..++...++-||++|+|||+..
T Consensus       166 l~~~ia~~~~~~vlL~Gp~GtGKTTLA  192 (615)
T TIGR02903       166 LLAKVASPFPQHIILYGPPGVGKTTAA  192 (615)
T ss_pred             HHHHHhcCCCCeEEEECCCCCCHHHHH
Confidence            445555677778899999999999865


No 216
>KOG0953|consensus
Probab=58.15  E-value=13  Score=35.77  Aligned_cols=45  Identities=18%  Similarity=0.317  Sum_probs=30.3

Q ss_pred             EEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHh
Q psy9445         156 TVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~  205 (243)
                      -||..|+|+|||||.-.-.-...     ......|=+-....++|++.+.
T Consensus       193 Ii~H~GPTNSGKTy~ALqrl~~a-----ksGvycGPLrLLA~EV~~r~na  237 (700)
T KOG0953|consen  193 IIMHVGPTNSGKTYRALQRLKSA-----KSGVYCGPLRLLAHEVYDRLNA  237 (700)
T ss_pred             EEEEeCCCCCchhHHHHHHHhhh-----ccceecchHHHHHHHHHHHhhh
Confidence            38899999999999875432111     1223346667778889988874


No 217
>PRK04195 replication factor C large subunit; Provisional
Probab=58.04  E-value=4.8  Score=37.95  Aligned_cols=28  Identities=32%  Similarity=0.493  Sum_probs=19.7

Q ss_pred             hhHHHHhcCC-ceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLSGY-NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~G~-n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+.....|. .-.++.||++|+|||+..
T Consensus        28 ~~l~~~~~g~~~~~lLL~GppG~GKTtla   56 (482)
T PRK04195         28 EWIESWLKGKPKKALLLYGPPGVGKTSLA   56 (482)
T ss_pred             HHHHHHhcCCCCCeEEEECCCCCCHHHHH
Confidence            3344444444 456889999999999776


No 218
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=58.01  E-value=5.5  Score=39.41  Aligned_cols=21  Identities=29%  Similarity=0.525  Sum_probs=19.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiiSGESGaGKTes~  103 (691)
T cd01380          83 DEKNQSIIVSGESGAGKTVSA  103 (691)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            589999999999999999875


No 219
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=57.73  E-value=7  Score=31.98  Aligned_cols=18  Identities=33%  Similarity=0.482  Sum_probs=14.8

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...+.-||.+|||||...
T Consensus        12 g~i~~i~G~~GsGKT~l~   29 (209)
T TIGR02237        12 GTITQIYGPPGSGKTNIC   29 (209)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            466788999999998764


No 220
>PHA02653 RNA helicase NPH-II; Provisional
Probab=57.70  E-value=7.6  Score=38.36  Aligned_cols=24  Identities=33%  Similarity=0.411  Sum_probs=18.4

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      ++..+++|.+  ++..|+||||||..
T Consensus       172 il~~i~~gkd--vIv~A~TGSGKTtq  195 (675)
T PHA02653        172 IFEAWISRKP--VVLTGGTGVGKTSQ  195 (675)
T ss_pred             HHHHHHhCCC--EEEECCCCCCchhH
Confidence            4556666764  57899999999975


No 221
>KOG0739|consensus
Probab=57.40  E-value=4.9  Score=35.88  Aligned_cols=83  Identities=19%  Similarity=0.330  Sum_probs=46.3

Q ss_pred             ceeecCCCcchhhhccccchh-HHHHhcCCc---eEEEEeccCCCCcceEeecCCCCCCCCCC-CCC-----CCCCchhH
Q psy9445         125 DRVFSQESKQVDVYKYVVNPL-IDEVLSGYN---CTVFAYGQTGTGKTFTMEGEKSNDPSISW-QDD-----PLSGIVPR  194 (243)
Q Consensus       125 D~vF~~~a~q~ev~~~~~~~~-v~~~~~G~n---~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~-~~~-----~~~Gii~r  194 (243)
                      +-|.+-+...+.+=+.++.|+ ...+|.|..   -.|+.||+.|+||+|.----..+..+..+ ..+     .-.|---+
T Consensus       133 sDVAGLE~AKeALKEAVILPIKFPqlFtGkR~PwrgiLLyGPPGTGKSYLAKAVATEAnSTFFSvSSSDLvSKWmGESEk  212 (439)
T KOG0739|consen  133 SDVAGLEGAKEALKEAVILPIKFPQLFTGKRKPWRGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEK  212 (439)
T ss_pred             hhhccchhHHHHHHhheeecccchhhhcCCCCcceeEEEeCCCCCcHHHHHHHHHhhcCCceEEeehHHHHHHHhccHHH
Confidence            334555444455555555553 346777654   56899999999999854221100000100 000     01355678


Q ss_pred             HHHHHHHHHHhcC
Q psy9445         195 AMNHLFDELRLLG  207 (243)
Q Consensus       195 ~~~~lf~~~~~~~  207 (243)
                      .+..||+...+..
T Consensus       213 LVknLFemARe~k  225 (439)
T KOG0739|consen  213 LVKNLFEMARENK  225 (439)
T ss_pred             HHHHHHHHHHhcC
Confidence            8999998877643


No 222
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=57.38  E-value=4.7  Score=31.03  Aligned_cols=16  Identities=31%  Similarity=0.430  Sum_probs=13.2

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      +|+.+|..|||||+.-
T Consensus         1 ~i~l~G~~GsGKstla   16 (154)
T cd00464           1 NIVLIGMMGAGKTTVG   16 (154)
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            4778999999998754


No 223
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=57.36  E-value=7  Score=38.27  Aligned_cols=25  Identities=40%  Similarity=0.635  Sum_probs=19.6

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..++.|.+  +++.++||||||.+.
T Consensus        36 ai~~ll~g~d--vl~~ApTGsGKT~af   60 (629)
T PRK11634         36 CIPHLLNGRD--VLGMAQTGSGKTAAF   60 (629)
T ss_pred             HHHHHHcCCC--EEEEcCCCCcHHHHH
Confidence            4556678876  778889999999764


No 224
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=57.13  E-value=6.5  Score=38.81  Aligned_cols=21  Identities=33%  Similarity=0.433  Sum_probs=19.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|||||.+.
T Consensus        84 ~~~~QsIiisGESGaGKTe~~  104 (677)
T cd01387          84 AKQNQCVIISGESGSGKTEAT  104 (677)
T ss_pred             cCCCceEEEEcCCCCCeehHH
Confidence            489999999999999999886


No 225
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=56.88  E-value=4  Score=38.62  Aligned_cols=18  Identities=39%  Similarity=0.407  Sum_probs=14.6

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+.-.|++|+|||.|+.
T Consensus       257 ~Vi~LvGpnGvGKTTTia  274 (484)
T PRK06995        257 GVFALMGPTGVGKTTTTA  274 (484)
T ss_pred             cEEEEECCCCccHHHHHH
Confidence            356667999999999984


No 226
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=56.85  E-value=4.8  Score=33.44  Aligned_cols=21  Identities=29%  Similarity=0.490  Sum_probs=16.1

Q ss_pred             eEEEEeccCCCCcceEe---ecCC
Q psy9445         155 CTVFAYGQTGTGKTFTM---EGEK  175 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm---~G~~  175 (243)
                      ..|+..|.||||||.+.   .|..
T Consensus         1 l~IlllG~tGsGKSs~~N~ilg~~   24 (212)
T PF04548_consen    1 LRILLLGKTGSGKSSLGNSILGKE   24 (212)
T ss_dssp             EEEEEECSTTSSHHHHHHHHHTSS
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            36889999999999753   5543


No 227
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=56.82  E-value=5  Score=32.21  Aligned_cols=15  Identities=27%  Similarity=0.541  Sum_probs=12.5

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |+.+|..|||||+..
T Consensus         2 I~i~G~pGsGKst~a   16 (194)
T cd01428           2 ILLLGPPGSGKGTQA   16 (194)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678999999998544


No 228
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=56.53  E-value=5.3  Score=36.82  Aligned_cols=18  Identities=44%  Similarity=0.654  Sum_probs=15.4

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...|+-||++|+|||+..
T Consensus       179 pkgvLL~GppGTGKT~LA  196 (398)
T PTZ00454        179 PRGVLLYGPPGTGKTMLA  196 (398)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            456889999999999875


No 229
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=56.25  E-value=5  Score=35.09  Aligned_cols=16  Identities=38%  Similarity=0.422  Sum_probs=13.7

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      -++-+|++|||||+..
T Consensus        60 ~vll~G~pGTGKT~lA   75 (284)
T TIGR02880        60 HMSFTGNPGTGKTTVA   75 (284)
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            4788999999999864


No 230
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=55.96  E-value=7.3  Score=33.50  Aligned_cols=26  Identities=38%  Similarity=0.483  Sum_probs=17.1

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .++..+..|.+  |+-+|.+|+|||...
T Consensus        13 ~~l~~l~~g~~--vLL~G~~GtGKT~lA   38 (262)
T TIGR02640        13 RALRYLKSGYP--VHLRGPAGTGKTTLA   38 (262)
T ss_pred             HHHHHHhcCCe--EEEEcCCCCCHHHHH
Confidence            34444445554  456899999998643


No 231
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=55.91  E-value=5.6  Score=31.68  Aligned_cols=15  Identities=40%  Similarity=0.465  Sum_probs=12.5

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      ++.+|.+|+|||...
T Consensus         2 ~li~G~~G~GKT~l~   16 (187)
T cd01124           2 TLLSGGPGTGKTTFA   16 (187)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            577999999998744


No 232
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=55.84  E-value=24  Score=32.19  Aligned_cols=17  Identities=24%  Similarity=0.434  Sum_probs=13.2

Q ss_pred             CceEEEEeccCCCCcce
Q psy9445         153 YNCTVFAYGQTGTGKTF  169 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~  169 (243)
                      .+.-+.-.|++|+|||.
T Consensus        77 ~r~il~L~GPPGsGKSt   93 (361)
T smart00763       77 RKQILYLLGPVGGGKSS   93 (361)
T ss_pred             CCcEEEEECCCCCCHHH
Confidence            34567778999999974


No 233
>PHA01747 putative ATP-dependent protease
Probab=55.65  E-value=5.3  Score=36.56  Aligned_cols=32  Identities=28%  Similarity=0.331  Sum_probs=25.9

Q ss_pred             cchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         142 VNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       142 ~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +-|+|+.-..+-|.-++=.|+.||||||+..-
T Consensus       178 LiPlVE~~~~~~NyNliELgPRGTGKS~~f~e  209 (425)
T PHA01747        178 LLPLFTSPVSKRPVHIIELSNRGTGKTTTFVI  209 (425)
T ss_pred             hhhheeccCCCCCeeEEEecCCCCChhhHHHH
Confidence            45777765677888899999999999998643


No 234
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=55.60  E-value=4.7  Score=30.06  Aligned_cols=16  Identities=38%  Similarity=0.480  Sum_probs=12.5

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .+.-.|++|||||..+
T Consensus        17 ~v~I~GpSGsGKSTLl   32 (107)
T cd00820          17 GVLITGDSGIGKTELA   32 (107)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            3456799999998855


No 235
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=55.59  E-value=7.7  Score=35.24  Aligned_cols=21  Identities=33%  Similarity=0.548  Sum_probs=18.7

Q ss_pred             hcCCceEEEEeccCCCCcceE
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      -.|+.-+|++.|++|+|||.-
T Consensus        19 k~Gi~f~im~~G~sG~GKttf   39 (373)
T COG5019          19 KKGIDFTIMVVGESGLGKTTF   39 (373)
T ss_pred             hcCCceEEEEecCCCCchhHH
Confidence            459999999999999999863


No 236
>PF13173 AAA_14:  AAA domain
Probab=55.53  E-value=4.4  Score=30.60  Aligned_cols=17  Identities=29%  Similarity=0.511  Sum_probs=14.6

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      .++-+|+.|+|||+.+.
T Consensus         4 ~~~l~G~R~vGKTtll~   20 (128)
T PF13173_consen    4 IIILTGPRGVGKTTLLK   20 (128)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            46789999999999883


No 237
>KOG0926|consensus
Probab=55.46  E-value=6.9  Score=39.24  Aligned_cols=19  Identities=42%  Similarity=0.557  Sum_probs=16.2

Q ss_pred             CceEEEEeccCCCCcceEe
Q psy9445         153 YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm  171 (243)
                      -|-.++..|+||||||.-+
T Consensus       270 ~n~vvIIcGeTGsGKTTQv  288 (1172)
T KOG0926|consen  270 ENPVVIICGETGSGKTTQV  288 (1172)
T ss_pred             cCCeEEEecCCCCCccccc
Confidence            4567888999999999887


No 238
>PRK06217 hypothetical protein; Validated
Probab=55.27  E-value=5.4  Score=32.15  Aligned_cols=14  Identities=29%  Similarity=0.525  Sum_probs=11.9

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+-.|.+|||||+.
T Consensus         4 I~i~G~~GsGKSTl   17 (183)
T PRK06217          4 IHITGASGSGTTTL   17 (183)
T ss_pred             EEEECCCCCCHHHH
Confidence            67889999999854


No 239
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=55.25  E-value=5.7  Score=30.41  Aligned_cols=21  Identities=29%  Similarity=0.488  Sum_probs=16.3

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...+..|+-+|..||||++..
T Consensus        18 a~~~~pvli~GE~GtGK~~~A   38 (138)
T PF14532_consen   18 AKSSSPVLITGEPGTGKSLLA   38 (138)
T ss_dssp             HCSSS-EEEECCTTSSHHHHH
T ss_pred             hCCCCcEEEEcCCCCCHHHHH
Confidence            366777889999999998753


No 240
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=55.19  E-value=4.2  Score=37.50  Aligned_cols=18  Identities=39%  Similarity=0.593  Sum_probs=14.8

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      +-.++.+|.||||||..|
T Consensus        42 ~~h~~i~g~tGsGKt~~i   59 (410)
T cd01127          42 EAHTMIIGTTGTGKTTQI   59 (410)
T ss_pred             hccEEEEcCCCCCHHHHH
Confidence            346788999999998766


No 241
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=55.18  E-value=4.5  Score=31.75  Aligned_cols=13  Identities=31%  Similarity=0.539  Sum_probs=10.7

Q ss_pred             EEeccCCCCcceE
Q psy9445         158 FAYGQTGTGKTFT  170 (243)
Q Consensus       158 ~ayG~tgsGKt~T  170 (243)
                      +..|.+|||||+.
T Consensus         2 ~l~G~~GsGKSTl   14 (163)
T TIGR01313         2 VLMGVAGSGKSTI   14 (163)
T ss_pred             EEECCCCCCHHHH
Confidence            4569999999865


No 242
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=54.84  E-value=4.2  Score=38.01  Aligned_cols=17  Identities=47%  Similarity=0.686  Sum_probs=14.1

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.++-||++|+|||.+.
T Consensus       218 ~gVLL~GPPGTGKT~LA  234 (438)
T PTZ00361        218 KGVILYGPPGTGKTLLA  234 (438)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            35778999999998775


No 243
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family. Members of this family are assumed to differ from each other in DNA site specificity.
Probab=54.61  E-value=6.4  Score=38.76  Aligned_cols=31  Identities=23%  Similarity=0.381  Sum_probs=20.4

Q ss_pred             cchhHHHHhc-----CCceEEEEeccCCCCcceEeec
Q psy9445         142 VNPLIDEVLS-----GYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       142 ~~~~v~~~~~-----G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +..+++++..     |.+..++ .-.||||||+||..
T Consensus       247 v~~~~~~~~~~~~~~~~~~gli-~~~TGsGKT~t~~~  282 (667)
T TIGR00348       247 VKKIVESITRKTWGKDERGGLI-WHTQGSGKTLTMLF  282 (667)
T ss_pred             HHHHHHHHHhcccCCCCceeEE-EEecCCCccHHHHH
Confidence            4556666655     3444443 44999999999964


No 244
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=54.55  E-value=5.5  Score=37.63  Aligned_cols=18  Identities=39%  Similarity=0.525  Sum_probs=15.1

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      -.++-||++|+|||+...
T Consensus        89 ~giLL~GppGtGKT~la~  106 (495)
T TIGR01241        89 KGVLLVGPPGTGKTLLAK  106 (495)
T ss_pred             CcEEEECCCCCCHHHHHH
Confidence            358899999999998863


No 245
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves.
Probab=54.52  E-value=4.2  Score=41.42  Aligned_cols=19  Identities=37%  Similarity=0.620  Sum_probs=16.9

Q ss_pred             CceEEEEeccCCCCcceEe
Q psy9445         153 YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.-.+.+|.||||||+++
T Consensus       474 ~n~n~~I~G~TGSGKS~l~  492 (893)
T TIGR03744       474 KNAHLLILGPTGAGKSATL  492 (893)
T ss_pred             CcccEEEECCCCCCHHHHH
Confidence            4777888999999999988


No 246
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=54.51  E-value=9.1  Score=35.88  Aligned_cols=26  Identities=35%  Similarity=0.548  Sum_probs=19.8

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+..+++|.+  +++..+||||||.+.
T Consensus        18 ~ai~~~l~g~d--vlv~apTGsGKTl~y   43 (470)
T TIGR00614        18 EVINAVLLGRD--CFVVMPTGGGKSLCY   43 (470)
T ss_pred             HHHHHHHcCCC--EEEEcCCCCcHhHHH
Confidence            35667788986  566689999999754


No 247
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=54.51  E-value=6.5  Score=28.65  Aligned_cols=16  Identities=31%  Similarity=0.625  Sum_probs=13.2

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      |+..|..|+|||..+.
T Consensus         2 I~V~G~~g~GKTsLi~   17 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLIR   17 (119)
T ss_dssp             EEEECSTTSSHHHHHH
T ss_pred             EEEECcCCCCHHHHHH
Confidence            5778999999987663


No 248
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=54.47  E-value=5.9  Score=30.06  Aligned_cols=15  Identities=27%  Similarity=0.461  Sum_probs=12.2

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |+..|++|||||..-
T Consensus         2 I~i~G~~GsGKst~a   16 (147)
T cd02020           2 IAIDGPAGSGKSTVA   16 (147)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999998754


No 249
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]
Probab=54.36  E-value=6.2  Score=37.66  Aligned_cols=19  Identities=37%  Similarity=0.649  Sum_probs=17.4

Q ss_pred             HhcCCceEEEEeccCCCCc
Q psy9445         149 VLSGYNCTVFAYGQTGTGK  167 (243)
Q Consensus       149 ~~~G~n~~i~ayG~tgsGK  167 (243)
                      -..+.+++|+-+|.||+||
T Consensus       263 r~A~tdstVLi~GESGTGK  281 (560)
T COG3829         263 RIAKTDSTVLILGESGTGK  281 (560)
T ss_pred             hhcCCCCcEEEecCCCccH
Confidence            4578999999999999999


No 250
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=54.33  E-value=4.5  Score=42.24  Aligned_cols=30  Identities=27%  Similarity=0.249  Sum_probs=20.4

Q ss_pred             chhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       143 ~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..+.+.+.+|....+ ...+||||||+||..
T Consensus       423 ~ai~~a~~~g~r~~L-l~maTGSGKT~tai~  452 (1123)
T PRK11448        423 QAVEKAIVEGQREIL-LAMATGTGKTRTAIA  452 (1123)
T ss_pred             HHHHHHHHhccCCeE-EEeCCCCCHHHHHHH
Confidence            334555556765444 448999999999865


No 251
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=54.31  E-value=4.3  Score=40.58  Aligned_cols=18  Identities=39%  Similarity=0.709  Sum_probs=15.7

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      |..++..|.||||||++|
T Consensus       430 n~n~~I~G~tGsGKS~~~  447 (797)
T TIGR02746       430 NYNIAVVGGSGAGKSFFM  447 (797)
T ss_pred             ccceEEEcCCCCCHHHHH
Confidence            456788999999999998


No 252
>KOG2373|consensus
Probab=54.04  E-value=11  Score=34.30  Aligned_cols=30  Identities=37%  Similarity=0.576  Sum_probs=22.2

Q ss_pred             chhHHHHhcCCc---eEEEEeccCCCCcceEeec
Q psy9445         143 NPLIDEVLSGYN---CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       143 ~~~v~~~~~G~n---~~i~ayG~tgsGKt~Tm~G  173 (243)
                      -|.++..+.|..   .||+ -|+||||||.-|.-
T Consensus       260 FpvLNk~LkGhR~GElTvl-TGpTGsGKTTFlsE  292 (514)
T KOG2373|consen  260 FPVLNKYLKGHRPGELTVL-TGPTGSGKTTFLSE  292 (514)
T ss_pred             hhHHHHHhccCCCCceEEE-ecCCCCCceeEehH
Confidence            367888888874   3444 49999999987753


No 253
>KOG0652|consensus
Probab=54.00  E-value=6.4  Score=34.48  Aligned_cols=15  Identities=53%  Similarity=0.855  Sum_probs=12.7

Q ss_pred             eEEEEeccCCCCcce
Q psy9445         155 CTVFAYGQTGTGKTF  169 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~  169 (243)
                      -.++.||+.|+|||.
T Consensus       206 KGvLmYGPPGTGKTl  220 (424)
T KOG0652|consen  206 KGVLMYGPPGTGKTL  220 (424)
T ss_pred             CceEeeCCCCCcHHH
Confidence            358999999999974


No 254
>PRK08233 hypothetical protein; Provisional
Probab=53.72  E-value=6  Score=31.35  Aligned_cols=15  Identities=27%  Similarity=0.271  Sum_probs=11.4

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |..-|.+|||||+..
T Consensus         6 I~I~G~~GsGKtTla   20 (182)
T PRK08233          6 ITIAAVSGGGKTTLT   20 (182)
T ss_pred             EEEECCCCCCHHHHH
Confidence            445699999998743


No 255
>PHA02244 ATPase-like protein
Probab=53.72  E-value=8.4  Score=35.28  Aligned_cols=20  Identities=30%  Similarity=0.454  Sum_probs=14.5

Q ss_pred             hcCCceEEEEeccCCCCcceEe
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      -.|.+  |+-+|++|+|||+..
T Consensus       117 ~~~~P--VLL~GppGtGKTtLA  136 (383)
T PHA02244        117 NANIP--VFLKGGAGSGKNHIA  136 (383)
T ss_pred             hcCCC--EEEECCCCCCHHHHH
Confidence            34555  555899999999654


No 256
>PRK14531 adenylate kinase; Provisional
Probab=53.69  E-value=6.1  Score=31.86  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=12.7

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      -|+.+|..|||||+.
T Consensus         4 ~i~i~G~pGsGKsT~   18 (183)
T PRK14531          4 RLLFLGPPGAGKGTQ   18 (183)
T ss_pred             EEEEECCCCCCHHHH
Confidence            378899999999765


No 257
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=53.13  E-value=7.9  Score=31.08  Aligned_cols=21  Identities=33%  Similarity=0.512  Sum_probs=16.5

Q ss_pred             hcCCceEEEEeccCCCCcceE
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      +..++..|+-+|.+||||+..
T Consensus        18 ~a~~~~pVlI~GE~GtGK~~l   38 (168)
T PF00158_consen   18 AASSDLPVLITGETGTGKELL   38 (168)
T ss_dssp             HTTSTS-EEEECSTTSSHHHH
T ss_pred             HhCCCCCEEEEcCCCCcHHHH
Confidence            347789999999999999643


No 258
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=53.11  E-value=7.7  Score=38.64  Aligned_cols=23  Identities=26%  Similarity=0.338  Sum_probs=17.9

Q ss_pred             cCCceEEEEeccCCCCcceEeec
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .+.-..++-||++|+|||+....
T Consensus        49 ~~~~~slLL~GPpGtGKTTLA~a   71 (725)
T PRK13341         49 ADRVGSLILYGPPGVGKTTLARI   71 (725)
T ss_pred             cCCCceEEEECCCCCCHHHHHHH
Confidence            34445788899999999987743


No 259
>KOG0340|consensus
Probab=53.05  E-value=12  Score=33.95  Aligned_cols=29  Identities=31%  Similarity=0.557  Sum_probs=22.8

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEeecC
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      .+|..+++|.+|-  -...||||||.-+-.+
T Consensus        36 ~cIpkILeGrdci--g~AkTGsGKT~AFaLP   64 (442)
T KOG0340|consen   36 ACIPKILEGRDCI--GCAKTGSGKTAAFALP   64 (442)
T ss_pred             hhhHHHhcccccc--cccccCCCcchhhhHH
Confidence            4677889999873  4568999999988664


No 260
>CHL00195 ycf46 Ycf46; Provisional
Probab=52.92  E-value=5.2  Score=37.95  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=14.8

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      .-.|+-||+.|+|||.+.
T Consensus       259 pkGILL~GPpGTGKTllA  276 (489)
T CHL00195        259 PRGLLLVGIQGTGKSLTA  276 (489)
T ss_pred             CceEEEECCCCCcHHHHH
Confidence            356999999999998654


No 261
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=52.63  E-value=8.5  Score=36.04  Aligned_cols=26  Identities=35%  Similarity=0.502  Sum_probs=19.6

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+..+++|.|+.  .-.+||||||...
T Consensus       116 ~ai~~~~~G~dvi--~~apTGSGKTlay  141 (475)
T PRK01297        116 QVLGYTLAGHDAI--GRAQTGTGKTAAF  141 (475)
T ss_pred             HHHHHHhCCCCEE--EECCCCChHHHHH
Confidence            3566788998865  4569999999654


No 262
>KOG0729|consensus
Probab=52.45  E-value=7.7  Score=34.09  Aligned_cols=20  Identities=45%  Similarity=0.748  Sum_probs=15.4

Q ss_pred             CCc--eEEEEeccCCCCcceEe
Q psy9445         152 GYN--CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n--~~i~ayG~tgsGKt~Tm  171 (243)
                      |..  --|+.||+.|+|||..-
T Consensus       207 gidppkgvllygppgtgktl~a  228 (435)
T KOG0729|consen  207 GIDPPKGVLLYGPPGTGKTLCA  228 (435)
T ss_pred             CCCCCCceEEeCCCCCchhHHH
Confidence            554  45899999999998643


No 263
>KOG1547|consensus
Probab=51.91  E-value=11  Score=32.65  Aligned_cols=22  Identities=27%  Similarity=0.640  Sum_probs=18.8

Q ss_pred             HhcCCceEEEEeccCCCCcceE
Q psy9445         149 VLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       149 ~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      +-.||.-.|+..||+|.|||.-
T Consensus        41 mk~GF~FNIMVVgqSglgkstl   62 (336)
T KOG1547|consen   41 MKTGFDFNIMVVGQSGLGKSTL   62 (336)
T ss_pred             HhccCceEEEEEecCCCCchhh
Confidence            3459999999999999999753


No 264
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=51.79  E-value=13  Score=30.86  Aligned_cols=30  Identities=33%  Similarity=0.585  Sum_probs=21.3

Q ss_pred             chhHHHHhc-CC--ceEEEEeccCCCCcceEee
Q psy9445         143 NPLIDEVLS-GY--NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       143 ~~~v~~~~~-G~--n~~i~ayG~tgsGKt~Tm~  172 (243)
                      -+-++.++. |+  ...+..+|.+|+|||....
T Consensus         9 i~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l~~   41 (225)
T PRK09361          9 CKMLDELLGGGFERGTITQIYGPPGSGKTNICL   41 (225)
T ss_pred             cHHHHHHhcCCCCCCeEEEEECCCCCCHHHHHH
Confidence            345677775 43  3567889999999987643


No 265
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=51.71  E-value=7  Score=31.14  Aligned_cols=16  Identities=31%  Similarity=0.563  Sum_probs=13.0

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+..|..|||||+..
T Consensus         5 ii~i~G~~GsGKsTl~   20 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQC   20 (188)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3566899999999865


No 266
>PF02534 T4SS-DNA_transf:  Type IV secretory system Conjugative DNA transfer;  InterPro: IPR003688 This entry represents TraG proteins and their homologues. These proteins contain a P-loop and walker-B site for nucleotide binding. TraG is essential for DNA transfer in bacterial conjugation. These proteins are thought to mediate interactions between the DNA-processing (Dtr) and the mating pair formation (Mpf) systems [, ].; GO: 0009291 unidirectional conjugation, 0016020 membrane
Probab=51.54  E-value=12  Score=34.83  Aligned_cols=18  Identities=39%  Similarity=0.599  Sum_probs=15.9

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      .-++..|.||||||.++.
T Consensus        45 ~h~lvig~tgSGKt~~~v   62 (469)
T PF02534_consen   45 THVLVIGPTGSGKTTSFV   62 (469)
T ss_pred             eEEEEEeCCCCCccceee
Confidence            678899999999998874


No 267
>PRK04040 adenylate kinase; Provisional
Probab=51.49  E-value=7  Score=31.98  Aligned_cols=17  Identities=35%  Similarity=0.536  Sum_probs=14.0

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      .|+.+|..|+|||+..-
T Consensus         4 ~i~v~G~pG~GKtt~~~   20 (188)
T PRK04040          4 VVVVTGVPGVGKTTVLN   20 (188)
T ss_pred             EEEEEeCCCCCHHHHHH
Confidence            47789999999998653


No 268
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=51.38  E-value=5.6  Score=31.71  Aligned_cols=16  Identities=25%  Similarity=0.627  Sum_probs=13.6

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .++..|++|||||..+
T Consensus         3 ~~~i~G~sGsGKttl~   18 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLL   18 (179)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4667899999999887


No 269
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=50.93  E-value=11  Score=38.06  Aligned_cols=25  Identities=44%  Similarity=0.543  Sum_probs=19.5

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+.+|.|+.|.|  +||||||-+-
T Consensus        30 a~~~i~~G~nvLiiA--PTGsGKTeAA   54 (814)
T COG1201          30 AIPEIHSGENVLIIA--PTGSGKTEAA   54 (814)
T ss_pred             HHHHHhCCCceEEEc--CCCCChHHHH
Confidence            355678999988765  9999998654


No 270
>KOG0335|consensus
Probab=50.74  E-value=7.6  Score=36.55  Aligned_cols=25  Identities=32%  Similarity=0.391  Sum_probs=18.9

Q ss_pred             HHhcCCceEEEEeccCCCCcceEeecC
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      .+.+|.+  ++|.+|||||||+-...+
T Consensus       107 ~i~~Grd--l~acAqTGsGKT~aFLiP  131 (482)
T KOG0335|consen  107 IISGGRD--LMACAQTGSGKTAAFLIP  131 (482)
T ss_pred             eeecCCc--eEEEccCCCcchHHHHHH
Confidence            3455655  489999999999987664


No 271
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=50.74  E-value=6.3  Score=27.10  Aligned_cols=16  Identities=31%  Similarity=0.482  Sum_probs=12.0

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      ++.+|..|+|||.+..
T Consensus         2 ~~~~g~~G~Gktt~~~   17 (99)
T cd01983           2 IVVTGKGGVGKTTLAA   17 (99)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            4567888999987753


No 272
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=50.56  E-value=12  Score=35.49  Aligned_cols=24  Identities=38%  Similarity=0.551  Sum_probs=19.1

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .+..+++|.|  +++-.+||||||..
T Consensus       151 aip~il~g~d--viv~ApTGSGKTla  174 (518)
T PLN00206        151 AIPAALSGRS--LLVSADTGSGKTAS  174 (518)
T ss_pred             HHHHHhcCCC--EEEEecCCCCccHH
Confidence            4666788876  67788999999965


No 273
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=50.53  E-value=5.7  Score=34.56  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=13.8

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      -++...|++|+|||.|..
T Consensus        73 ~vi~l~G~~G~GKTTt~a   90 (272)
T TIGR00064        73 NVILFVGVNGVGKTTTIA   90 (272)
T ss_pred             eEEEEECCCCCcHHHHHH
Confidence            345555999999999874


No 274
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=50.47  E-value=11  Score=36.51  Aligned_cols=25  Identities=40%  Similarity=0.526  Sum_probs=19.7

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+++|.|  |++..+||||||.+.
T Consensus        39 ~ip~~l~G~D--vi~~ApTGSGKTlaf   63 (572)
T PRK04537         39 TLPVALPGGD--VAGQAQTGTGKTLAF   63 (572)
T ss_pred             HHHHHhCCCC--EEEEcCCCCcHHHHH
Confidence            4566788988  566899999999763


No 275
>TIGR01817 nifA Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.
Probab=50.47  E-value=7  Score=37.29  Aligned_cols=45  Identities=22%  Similarity=0.263  Sum_probs=27.4

Q ss_pred             EEecceeecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         121 TFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       121 ~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|+.+.+....-.++.+.     +.. +...+..|+-+|.+||||++.-
T Consensus       192 ~~~~~~liG~s~~~~~~~~~-----~~~-~a~~~~pvli~Ge~GtGK~~lA  236 (534)
T TIGR01817       192 SGKEDGIIGKSPAMRQVVDQ-----ARV-VARSNSTVLLRGESGTGKELIA  236 (534)
T ss_pred             cCccCceEECCHHHHHHHHH-----HHH-HhCcCCCEEEECCCCccHHHHH
Confidence            35667666654332222222     222 2356778999999999997654


No 276
>TIGR02902 spore_lonB ATP-dependent protease LonB. Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.
Probab=50.46  E-value=9.1  Score=36.63  Aligned_cols=25  Identities=28%  Similarity=0.377  Sum_probs=18.7

Q ss_pred             HHHhcCCceEEEEeccCCCCcceEe
Q psy9445         147 DEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       147 ~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+.......|+-||++|+|||+.-
T Consensus        79 ~al~~~~~~~vLi~Ge~GtGKt~lA  103 (531)
T TIGR02902        79 AALCGPNPQHVIIYGPPGVGKTAAA  103 (531)
T ss_pred             HHHhCCCCceEEEECCCCCCHHHHH
Confidence            3445566677888999999997654


No 277
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=50.34  E-value=6.9  Score=37.30  Aligned_cols=17  Identities=41%  Similarity=0.661  Sum_probs=13.9

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.++-||++|+|||...
T Consensus       217 ~GILLyGPPGTGKT~LA  233 (512)
T TIGR03689       217 KGVLLYGPPGCGKTLIA  233 (512)
T ss_pred             cceEEECCCCCcHHHHH
Confidence            34888999999999654


No 278
>PRK14532 adenylate kinase; Provisional
Probab=50.32  E-value=8.2  Score=31.04  Aligned_cols=15  Identities=20%  Similarity=0.474  Sum_probs=12.5

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+..|..|||||+.
T Consensus         2 ~i~~~G~pGsGKsT~   16 (188)
T PRK14532          2 NLILFGPPAAGKGTQ   16 (188)
T ss_pred             EEEEECCCCCCHHHH
Confidence            378899999999754


No 279
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=50.23  E-value=14  Score=31.23  Aligned_cols=25  Identities=40%  Similarity=0.628  Sum_probs=18.7

Q ss_pred             hHHHHhc-CC--ceEEEEeccCCCCcce
Q psy9445         145 LIDEVLS-GY--NCTVFAYGQTGTGKTF  169 (243)
Q Consensus       145 ~v~~~~~-G~--n~~i~ayG~tgsGKt~  169 (243)
                      -++.++. |+  ..+++.+|.+|+|||.
T Consensus         9 ~LD~~l~GG~~~gs~~lI~G~pGsGKT~   36 (237)
T TIGR03877         9 GMDEILHGGIPERNVVLLSGGPGTGKSI   36 (237)
T ss_pred             hHHHHhcCCCcCCeEEEEEcCCCCCHHH
Confidence            3556555 54  4678889999999976


No 280
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.
Probab=50.02  E-value=7  Score=35.19  Aligned_cols=29  Identities=24%  Similarity=0.445  Sum_probs=21.3

Q ss_pred             chhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       143 ~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..++..++.+ ...++.-|.||||||.++.
T Consensus       168 ~~~L~~~v~~-~~~ili~G~tGsGKTTll~  196 (340)
T TIGR03819       168 ARLLRAIVAA-RLAFLISGGTGSGKTTLLS  196 (340)
T ss_pred             HHHHHHHHhC-CCeEEEECCCCCCHHHHHH
Confidence            3455555554 3688889999999998664


No 281
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=49.98  E-value=5.6  Score=36.04  Aligned_cols=14  Identities=36%  Similarity=0.591  Sum_probs=11.8

Q ss_pred             EeccCCCCcceEee
Q psy9445         159 AYGQTGTGKTFTME  172 (243)
Q Consensus       159 ayG~tgsGKt~Tm~  172 (243)
                      -.|++|||||.++.
T Consensus        36 lLGPSGcGKTTlLR   49 (352)
T COG3842          36 LLGPSGCGKTTLLR   49 (352)
T ss_pred             EECCCCCCHHHHHH
Confidence            35999999999873


No 282
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=49.95  E-value=7.5  Score=30.42  Aligned_cols=16  Identities=31%  Similarity=0.451  Sum_probs=13.1

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|..+|+.|||||+..
T Consensus         2 iI~i~G~~GSGKstia   17 (171)
T TIGR02173         2 IITISGPPGSGKTTVA   17 (171)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3677899999998765


No 283
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=49.92  E-value=12  Score=31.30  Aligned_cols=29  Identities=31%  Similarity=0.478  Sum_probs=20.3

Q ss_pred             chhHHHHhc-CC--ceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLS-GY--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~-G~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      -+-++.++. |+  ...++.+|.+|+|||+-.
T Consensus        11 i~~LD~~l~gG~~~g~~~~i~G~~GsGKt~l~   42 (234)
T PRK06067         11 NEELDRKLGGGIPFPSLILIEGDHGTGKSVLS   42 (234)
T ss_pred             CHHHHHhhCCCCcCCcEEEEECCCCCChHHHH
Confidence            344666665 53  567788899999996543


No 284
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=49.83  E-value=6  Score=33.59  Aligned_cols=14  Identities=29%  Similarity=0.600  Sum_probs=11.3

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      .-.|++|||||..+
T Consensus        32 ~iiGpSGSGKSTlL   45 (240)
T COG1126          32 VIIGPSGSGKSTLL   45 (240)
T ss_pred             EEECCCCCCHHHHH
Confidence            34699999999765


No 285
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=49.65  E-value=8.7  Score=38.51  Aligned_cols=21  Identities=24%  Similarity=0.466  Sum_probs=19.2

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .|.|.||+.-|.+|+|||.|.
T Consensus        83 ~~~~QsIiiSGESGAGKTe~t  103 (767)
T cd01386          83 TRRDQSIIFLGRSGAGKTTSC  103 (767)
T ss_pred             cCCCceEEEecCCCCCcHHHH
Confidence            489999999999999999875


No 286
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=49.49  E-value=6.1  Score=36.66  Aligned_cols=18  Identities=44%  Similarity=0.554  Sum_probs=15.2

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..|...|++|+|||.|+.
T Consensus       242 ~vI~LVGptGvGKTTTia  259 (436)
T PRK11889        242 QTIALIGPTGVGKTTTLA  259 (436)
T ss_pred             cEEEEECCCCCcHHHHHH
Confidence            467778999999999984


No 287
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=49.45  E-value=11  Score=36.63  Aligned_cols=25  Identities=44%  Similarity=0.723  Sum_probs=18.8

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+++|.++.  +..+||+|||.+.
T Consensus        33 ai~~il~g~dvl--v~apTGsGKTl~y   57 (607)
T PRK11057         33 IIDAVLSGRDCL--VVMPTGGGKSLCY   57 (607)
T ss_pred             HHHHHHcCCCEE--EEcCCCchHHHHH
Confidence            456678888765  4579999999753


No 288
>PF10412 TrwB_AAD_bind:  Type IV secretion-system coupling protein DNA-binding domain;  InterPro: IPR019476  The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein. It is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells []. This protein forms hexamers from six structurally very similar protomers []. This hexamer contains a central channel running from the cytosolic pole (formed by the all-alpha domains) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB all-alpha domain appears to be the DNA-binding domain of the structure. ; PDB: 1E9S_D 1E9R_F 1GKI_B 1GL7_G 1GL6_A.
Probab=49.16  E-value=5.4  Score=36.47  Aligned_cols=17  Identities=35%  Similarity=0.606  Sum_probs=12.4

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.++..|.+|||||..|
T Consensus        16 ~~~li~G~~GsGKT~~i   32 (386)
T PF10412_consen   16 RHILIIGATGSGKTQAI   32 (386)
T ss_dssp             G-EEEEE-TTSSHHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            34678999999999765


No 289
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type. subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. It contains helicase motifs and appears to represent the Cas3 protein of the Cyano subtype of CRISPR/Cas system.
Probab=48.98  E-value=13  Score=33.63  Aligned_cols=27  Identities=26%  Similarity=0.354  Sum_probs=21.2

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+.+.+|-+..++.-.+||||||...
T Consensus         5 ~~~~~~~~~~~~~~i~apTGsGKT~~~   31 (357)
T TIGR03158         5 TFEALQSKDADIIFNTAPTGAGKTLAW   31 (357)
T ss_pred             HHHHHHcCCCCEEEEECCCCCCHHHHH
Confidence            345667787777888899999999864


No 290
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=48.86  E-value=8.1  Score=34.13  Aligned_cols=28  Identities=21%  Similarity=0.370  Sum_probs=18.8

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +++..++.+- ..++--|.+|||||..|.
T Consensus       135 ~~l~~~v~~~-~~ili~G~tGsGKTTll~  162 (308)
T TIGR02788       135 EFLRLAIASR-KNIIISGGTGSGKTTFLK  162 (308)
T ss_pred             HHHHHHhhCC-CEEEEECCCCCCHHHHHH
Confidence            3444444432 456678999999998763


No 291
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=48.81  E-value=7  Score=33.54  Aligned_cols=20  Identities=35%  Similarity=0.717  Sum_probs=16.7

Q ss_pred             CCceEEEEeccCCCCcceEe
Q psy9445         152 GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .....|+..|.+|+|||.++
T Consensus        29 ~~~~~IllvG~tGvGKSSli   48 (249)
T cd01853          29 DFSLTILVLGKTGVGKSSTI   48 (249)
T ss_pred             cCCeEEEEECCCCCcHHHHH
Confidence            45678889999999998874


No 292
>KOG0742|consensus
Probab=48.81  E-value=8.9  Score=35.73  Aligned_cols=13  Identities=54%  Similarity=0.999  Sum_probs=11.7

Q ss_pred             EEEEeccCCCCcc
Q psy9445         156 TVFAYGQTGTGKT  168 (243)
Q Consensus       156 ~i~ayG~tgsGKt  168 (243)
                      .|+.||+.|+|||
T Consensus       386 NilfyGPPGTGKT  398 (630)
T KOG0742|consen  386 NILFYGPPGTGKT  398 (630)
T ss_pred             heeeeCCCCCCch
Confidence            4789999999997


No 293
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=48.62  E-value=7.8  Score=38.14  Aligned_cols=21  Identities=24%  Similarity=0.377  Sum_probs=19.1

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.+.||+.-|.+|||||.|.
T Consensus        83 ~~~~QsIiisGESGsGKTet~  103 (653)
T cd01379          83 YNQDQCIVISGESGSGKTESA  103 (653)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            488999999999999999886


No 294
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=48.58  E-value=6.7  Score=36.13  Aligned_cols=19  Identities=42%  Similarity=0.464  Sum_probs=15.1

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      -.+...|++|+|||+|+..
T Consensus       207 ~ii~lvGptGvGKTTt~ak  225 (407)
T PRK12726        207 RIISLIGQTGVGKTTTLVK  225 (407)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3466789999999998854


No 295
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=48.51  E-value=8.7  Score=35.90  Aligned_cols=21  Identities=33%  Similarity=0.373  Sum_probs=16.9

Q ss_pred             CceEEEEeccCCCCcceEeec
Q psy9445         153 YNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ....|+.+|.+|+|||.|..-
T Consensus        94 ~p~vI~lvG~~GsGKTTtaak  114 (437)
T PRK00771         94 KPQTIMLVGLQGSGKTTTAAK  114 (437)
T ss_pred             CCeEEEEECCCCCcHHHHHHH
Confidence            345778889999999998843


No 296
>PRK14974 cell division protein FtsY; Provisional
Probab=48.38  E-value=8  Score=34.81  Aligned_cols=19  Identities=37%  Similarity=0.504  Sum_probs=15.7

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ...|...|.+|+|||.|+.
T Consensus       140 ~~vi~~~G~~GvGKTTtia  158 (336)
T PRK14974        140 PVVIVFVGVNGTGKTTTIA  158 (336)
T ss_pred             CeEEEEEcCCCCCHHHHHH
Confidence            4577888999999999763


No 297
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=48.25  E-value=6.8  Score=39.17  Aligned_cols=18  Identities=39%  Similarity=0.422  Sum_probs=14.8

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+...|++|+|||.|+.
T Consensus       186 ~Vi~lVGpnGvGKTTTia  203 (767)
T PRK14723        186 GVLALVGPTGVGKTTTTA  203 (767)
T ss_pred             eEEEEECCCCCcHHHHHH
Confidence            456677999999999973


No 298
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=48.08  E-value=6.3  Score=35.53  Aligned_cols=14  Identities=29%  Similarity=0.560  Sum_probs=11.9

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      .-.|++|+|||.++
T Consensus        33 vllGPSGcGKSTlL   46 (338)
T COG3839          33 VLLGPSGCGKSTLL   46 (338)
T ss_pred             EEECCCCCCHHHHH
Confidence            34699999999987


No 299
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=47.76  E-value=8  Score=30.17  Aligned_cols=13  Identities=31%  Similarity=0.700  Sum_probs=11.3

Q ss_pred             EEEeccCCCCcce
Q psy9445         157 VFAYGQTGTGKTF  169 (243)
Q Consensus       157 i~ayG~tgsGKt~  169 (243)
                      |+..|.+|||||+
T Consensus         2 i~i~G~~GsGKST   14 (149)
T cd02027           2 IWLTGLSGSGKST   14 (149)
T ss_pred             EEEEcCCCCCHHH
Confidence            5677999999987


No 300
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=47.65  E-value=6.5  Score=34.55  Aligned_cols=12  Identities=42%  Similarity=0.714  Sum_probs=10.8

Q ss_pred             eccCCCCcceEe
Q psy9445         160 YGQTGTGKTFTM  171 (243)
Q Consensus       160 yG~tgsGKt~Tm  171 (243)
                      .|++|+|||.+|
T Consensus        37 lG~NGAGKTTll   48 (293)
T COG1131          37 LGPNGAGKTTLL   48 (293)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999987


No 301
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=47.55  E-value=4.6  Score=33.90  Aligned_cols=12  Identities=33%  Similarity=0.445  Sum_probs=10.6

Q ss_pred             eccCCCCcceEe
Q psy9445         160 YGQTGTGKTFTM  171 (243)
Q Consensus       160 yG~tgsGKt~Tm  171 (243)
                      -|.+|||||+++
T Consensus         5 ~G~sGSGKTTla   16 (220)
T cd02025           5 AGSVAVGKSTTA   16 (220)
T ss_pred             eCCCCCCHHHHH
Confidence            399999999886


No 302
>PRK03839 putative kinase; Provisional
Probab=47.51  E-value=8.5  Score=30.75  Aligned_cols=14  Identities=36%  Similarity=0.513  Sum_probs=11.7

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+-.|..|||||+.
T Consensus         3 I~l~G~pGsGKsT~   16 (180)
T PRK03839          3 IAITGTPGVGKTTV   16 (180)
T ss_pred             EEEECCCCCCHHHH
Confidence            67789999999853


No 303
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=47.50  E-value=6.5  Score=36.51  Aligned_cols=18  Identities=39%  Similarity=0.375  Sum_probs=14.9

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+...|.+|+|||.|+-
T Consensus       192 ~vi~lvGpnG~GKTTtla  209 (420)
T PRK14721        192 GVYALIGPTGVGKTTTTA  209 (420)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            456677999999999993


No 304
>KOG0727|consensus
Probab=47.33  E-value=9.4  Score=33.32  Aligned_cols=76  Identities=22%  Similarity=0.351  Sum_probs=40.0

Q ss_pred             cCCCcchhhhccccchhHHHHh-c--CCc--eEEEEeccCCCCcceEeecCCCCCCCCCC----C---CCCCCCchhHHH
Q psy9445         129 SQESKQVDVYKYVVNPLIDEVL-S--GYN--CTVFAYGQTGTGKTFTMEGEKSNDPSISW----Q---DDPLSGIVPRAM  196 (243)
Q Consensus       129 ~~~a~q~ev~~~~~~~~v~~~~-~--G~n--~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~----~---~~~~~Gii~r~~  196 (243)
                      +.+....++-+.+-.|+...-+ .  |.+  -.|+.||+.|+|||-..-.-.. .....+    .   -...-|-=||.+
T Consensus       159 gld~qkqeireavelplt~~~ly~qigidpprgvllygppg~gktml~kava~-~t~a~firvvgsefvqkylgegprmv  237 (408)
T KOG0727|consen  159 GLDVQKQEIREAVELPLTHADLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAN-HTTAAFIRVVGSEFVQKYLGEGPRMV  237 (408)
T ss_pred             cchhhHHHHHHHHhccchHHHHHHHhCCCCCcceEEeCCCCCcHHHHHHHHhh-ccchheeeeccHHHHHHHhccCcHHH
Confidence            4444455666666666666422 2  443  4589999999999643211100 000000    0   001225558888


Q ss_pred             HHHHHHHHh
Q psy9445         197 NHLFDELRL  205 (243)
Q Consensus       197 ~~lf~~~~~  205 (243)
                      +++|+...+
T Consensus       238 rdvfrlake  246 (408)
T KOG0727|consen  238 RDVFRLAKE  246 (408)
T ss_pred             HHHHHHHhc
Confidence            888876654


No 305
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=47.28  E-value=6.5  Score=29.31  Aligned_cols=17  Identities=18%  Similarity=0.411  Sum_probs=13.8

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      -|...|.+|+|||..+.
T Consensus         3 ki~~~G~~~~GKstl~~   19 (161)
T TIGR00231         3 KIVIVGDPNVGKSTLLN   19 (161)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            36678999999998764


No 306
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=47.23  E-value=12  Score=36.84  Aligned_cols=21  Identities=29%  Similarity=0.344  Sum_probs=16.4

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+....++..|+||||||...
T Consensus       279 ~~~~~~~Ll~~~TGSGKT~va  299 (681)
T PRK10917        279 SPKPMNRLLQGDVGSGKTVVA  299 (681)
T ss_pred             ccCCceEEEECCCCCcHHHHH
Confidence            344556889999999999754


No 307
>PHA02624 large T antigen; Provisional
Probab=47.22  E-value=11  Score=36.76  Aligned_cols=27  Identities=15%  Similarity=0.134  Sum_probs=21.3

Q ss_pred             HHHHhcCCce--EEEEeccCCCCcceEee
Q psy9445         146 IDEVLSGYNC--TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       146 v~~~~~G~n~--~i~ayG~tgsGKt~Tm~  172 (243)
                      +..++.|..-  |++-||+.|||||+-..
T Consensus       421 lk~~l~giPKk~~il~~GPpnTGKTtf~~  449 (647)
T PHA02624        421 LKLIVENVPKRRYWLFKGPVNSGKTTLAA  449 (647)
T ss_pred             HHHHHhcCCCCeEEEEECCCCCCHHHHHH
Confidence            5566777655  89999999999987653


No 308
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=47.13  E-value=7  Score=34.87  Aligned_cols=18  Identities=33%  Similarity=0.552  Sum_probs=14.3

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+...|++|+|||.|+.
T Consensus       115 ~vi~lvGpnGsGKTTt~~  132 (318)
T PRK10416        115 FVILVVGVNGVGKTTTIG  132 (318)
T ss_pred             eEEEEECCCCCcHHHHHH
Confidence            455666999999998874


No 309
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=46.99  E-value=9.1  Score=35.46  Aligned_cols=18  Identities=33%  Similarity=0.628  Sum_probs=14.6

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...|+.+|++|+|||+..
T Consensus       108 ~~~iLl~Gp~GtGKT~lA  125 (412)
T PRK05342        108 KSNILLIGPTGSGKTLLA  125 (412)
T ss_pred             CceEEEEcCCCCCHHHHH
Confidence            356889999999998644


No 310
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=46.92  E-value=7.4  Score=32.39  Aligned_cols=13  Identities=31%  Similarity=0.611  Sum_probs=11.5

Q ss_pred             EeccCCCCcceEe
Q psy9445         159 AYGQTGTGKTFTM  171 (243)
Q Consensus       159 ayG~tgsGKt~Tm  171 (243)
                      -.|++|+|||.+|
T Consensus        30 ivGpNGaGKSTll   42 (212)
T cd03274          30 IVGPNGSGKSNVI   42 (212)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999988


No 311
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I. This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.
Probab=46.92  E-value=7.1  Score=35.16  Aligned_cols=29  Identities=28%  Similarity=0.396  Sum_probs=21.6

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ++-.+++..-..++-.|.+|+|||..+.+
T Consensus        16 l~~~~~~~~~g~vli~G~~G~gKttl~r~   44 (337)
T TIGR02030        16 LLLNVIDPKIGGVMVMGDRGTGKSTAVRA   44 (337)
T ss_pred             HHHHhcCCCCCeEEEEcCCCCCHHHHHHH
Confidence            44556665556788999999999987644


No 312
>PRK06696 uridine kinase; Validated
Probab=46.91  E-value=13  Score=31.00  Aligned_cols=27  Identities=30%  Similarity=0.284  Sum_probs=17.5

Q ss_pred             chhHHHHh---cCCceEEEEeccCCCCcce
Q psy9445         143 NPLIDEVL---SGYNCTVFAYGQTGTGKTF  169 (243)
Q Consensus       143 ~~~v~~~~---~G~n~~i~ayG~tgsGKt~  169 (243)
                      ..+.+.++   .+...-|..-|.+|||||+
T Consensus         8 ~~la~~~~~~~~~~~~iI~I~G~sgsGKST   37 (223)
T PRK06696          8 KELAEHILTLNLTRPLRVAIDGITASGKTT   37 (223)
T ss_pred             HHHHHHHHHhCCCCceEEEEECCCCCCHHH
Confidence            34444444   3444556666999999988


No 313
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=46.88  E-value=9.4  Score=31.02  Aligned_cols=13  Identities=31%  Similarity=0.695  Sum_probs=10.9

Q ss_pred             EEEeccCCCCcce
Q psy9445         157 VFAYGQTGTGKTF  169 (243)
Q Consensus       157 i~ayG~tgsGKt~  169 (243)
                      |+-.|++|||||+
T Consensus         3 iiilG~pGaGK~T   15 (178)
T COG0563           3 ILILGPPGAGKST   15 (178)
T ss_pred             EEEECCCCCCHHH
Confidence            5678999999965


No 314
>PRK14530 adenylate kinase; Provisional
Probab=46.62  E-value=8.9  Score=31.73  Aligned_cols=15  Identities=27%  Similarity=0.532  Sum_probs=12.4

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+..|.+|||||..
T Consensus         5 ~I~i~G~pGsGKsT~   19 (215)
T PRK14530          5 RILLLGAPGAGKGTQ   19 (215)
T ss_pred             EEEEECCCCCCHHHH
Confidence            477799999999854


No 315
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model.
Probab=46.51  E-value=12  Score=33.53  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=14.5

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      +..|+-.|.+|+|||...
T Consensus        64 ~~~ilL~G~pGtGKTtla   81 (327)
T TIGR01650        64 DRRVMVQGYHGTGKSTHI   81 (327)
T ss_pred             CCcEEEEeCCCChHHHHH
Confidence            445888999999998654


No 316
>PRK06762 hypothetical protein; Provisional
Probab=46.40  E-value=10  Score=29.80  Aligned_cols=14  Identities=36%  Similarity=0.648  Sum_probs=11.5

Q ss_pred             EEEEeccCCCCcce
Q psy9445         156 TVFAYGQTGTGKTF  169 (243)
Q Consensus       156 ~i~ayG~tgsGKt~  169 (243)
                      .|...|..|||||+
T Consensus         4 li~i~G~~GsGKST   17 (166)
T PRK06762          4 LIIIRGNSGSGKTT   17 (166)
T ss_pred             EEEEECCCCCCHHH
Confidence            45667999999987


No 317
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=46.23  E-value=6.9  Score=33.21  Aligned_cols=14  Identities=29%  Similarity=0.534  Sum_probs=11.5

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      .-.|++|||||.-|
T Consensus        35 aI~GpSGSGKSTLL   48 (226)
T COG1136          35 AIVGPSGSGKSTLL   48 (226)
T ss_pred             EEECCCCCCHHHHH
Confidence            45799999999765


No 318
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=46.17  E-value=7.2  Score=38.84  Aligned_cols=18  Identities=33%  Similarity=0.549  Sum_probs=16.2

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      |...+..|.||+|||+++
T Consensus       434 ~~n~~I~G~tGsGKS~~~  451 (785)
T TIGR00929       434 LGHTLIFGPTGSGKTTLL  451 (785)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            677888999999999987


No 319
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=46.17  E-value=6.9  Score=31.80  Aligned_cols=14  Identities=36%  Similarity=0.392  Sum_probs=11.2

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      .--|.+|||||+.+
T Consensus         3 gi~G~~GsGKSTl~   16 (198)
T cd02023           3 GIAGGSGSGKTTVA   16 (198)
T ss_pred             EEECCCCCCHHHHH
Confidence            34699999998765


No 320
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=46.11  E-value=16  Score=30.40  Aligned_cols=27  Identities=37%  Similarity=0.502  Sum_probs=19.5

Q ss_pred             hHHHHhc-CC--ceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLS-GY--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~-G~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      -++.++. |+  ...+..+|++|+|||...
T Consensus         8 ~LD~~l~GGi~~G~~~~i~G~~G~GKT~l~   37 (229)
T TIGR03881         8 GLDKLLEGGIPRGFFVAVTGEPGTGKTIFC   37 (229)
T ss_pred             hHHHhhcCCCcCCeEEEEECCCCCChHHHH
Confidence            3556553 54  466788999999998765


No 321
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=46.06  E-value=14  Score=31.48  Aligned_cols=29  Identities=31%  Similarity=0.232  Sum_probs=21.2

Q ss_pred             chhHHHHhc--CCceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLS--GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~--G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+.+.+.+  .-...|.-+|..|.|||...
T Consensus         6 ~~l~~~L~~~~~~~~~v~I~G~~G~GKT~LA   36 (287)
T PF00931_consen    6 EKLKDWLLDNSNEVRVVAIVGMGGIGKTTLA   36 (287)
T ss_dssp             HHHHHHHHTTTTSSEEEEEEESTTSSHHHHH
T ss_pred             HHHHHHhhCCCCCeEEEEEEcCCcCCcceee
Confidence            445555555  55677888999999998665


No 322
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=45.97  E-value=18  Score=29.71  Aligned_cols=28  Identities=39%  Similarity=0.560  Sum_probs=20.2

Q ss_pred             hhHHHHhc-CCc--eEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLS-GYN--CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~-G~n--~~i~ayG~tgsGKt~Tm  171 (243)
                      +-++.++. |+.  ..+..+|.+|+|||...
T Consensus         6 ~~LD~~l~GGi~~g~i~~i~G~~GsGKT~l~   36 (218)
T cd01394           6 KGLDELLGGGVERGTVTQVYGPPGTGKTNIA   36 (218)
T ss_pred             hHHHHHhcCCccCCeEEEEECCCCCCHHHHH
Confidence            34666775 543  44778999999998764


No 323
>KOG0354|consensus
Probab=45.96  E-value=15  Score=36.44  Aligned_cols=24  Identities=42%  Similarity=0.610  Sum_probs=18.8

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .+++.+| |.|+-|  .-+||+|||+.
T Consensus        69 eivq~AL-gkNtii--~lPTG~GKTfI   92 (746)
T KOG0354|consen   69 ELVQPAL-GKNTII--ALPTGSGKTFI   92 (746)
T ss_pred             HHhHHhh-cCCeEE--EeecCCCccch
Confidence            3677888 999755  45999999975


No 324
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=45.85  E-value=9.6  Score=31.42  Aligned_cols=13  Identities=31%  Similarity=0.560  Sum_probs=11.4

Q ss_pred             EEEeccCCCCcce
Q psy9445         157 VFAYGQTGTGKTF  169 (243)
Q Consensus       157 i~ayG~tgsGKt~  169 (243)
                      |+.+|..|||||.
T Consensus         2 I~i~G~pGsGKsT   14 (210)
T TIGR01351         2 LVLLGPPGSGKGT   14 (210)
T ss_pred             EEEECCCCCCHHH
Confidence            6789999999976


No 325
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=45.74  E-value=6.9  Score=34.78  Aligned_cols=20  Identities=25%  Similarity=0.416  Sum_probs=16.4

Q ss_pred             ceEEEEeccCCCCcceEeec
Q psy9445         154 NCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .-+|+..|.||||||..|.-
T Consensus       143 ~~siii~G~t~sGKTt~lna  162 (312)
T COG0630         143 RKSIIICGGTASGKTTLLNA  162 (312)
T ss_pred             CCcEEEECCCCCCHHHHHHH
Confidence            34678899999999998843


No 326
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=45.72  E-value=15  Score=29.30  Aligned_cols=27  Identities=22%  Similarity=0.420  Sum_probs=20.5

Q ss_pred             hHHHHhc-CCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLS-GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~-G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++..++. .....|+..|..|||||.-+
T Consensus         4 ~~~~~~~~~~~~~ililGl~~sGKTtll   31 (175)
T PF00025_consen    4 VLSKLKSKKKEIKILILGLDGSGKTTLL   31 (175)
T ss_dssp             HHHHCTTTTSEEEEEEEESTTSSHHHHH
T ss_pred             HHHHhcccCcEEEEEEECCCccchHHHH
Confidence            4445554 66788999999999998655


No 327
>KOG0735|consensus
Probab=45.69  E-value=9.5  Score=37.88  Aligned_cols=18  Identities=33%  Similarity=0.654  Sum_probs=15.3

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..-|+-||+.|+||||-.
T Consensus       701 ~~giLLyGppGcGKT~la  718 (952)
T KOG0735|consen  701 RTGILLYGPPGCGKTLLA  718 (952)
T ss_pred             ccceEEECCCCCcHHHHH
Confidence            456899999999999864


No 328
>PF10923 DUF2791:  P-loop Domain of unknown function (DUF2791);  InterPro: IPR021228  This is a family of proteins found in archaea and bacteria. Some of the proteins in this family are annotated as being methyl-accepting chemotaxis proteins and ATP/GTP binding proteins. 
Probab=45.57  E-value=10  Score=35.18  Aligned_cols=27  Identities=37%  Similarity=0.557  Sum_probs=23.4

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      -++.+-+|-...-|..|.-||||||.+
T Consensus        40 ~l~~v~~G~s~~kfi~G~YGsGKTf~l   66 (416)
T PF10923_consen   40 DLDRVADGGSSFKFIRGEYGSGKTFFL   66 (416)
T ss_pred             HHHHHhCCCCeEEEEEeCCCCcHHHHH
Confidence            456777898888999999999999987


No 329
>PRK14527 adenylate kinase; Provisional
Probab=45.53  E-value=11  Score=30.60  Aligned_cols=17  Identities=29%  Similarity=0.370  Sum_probs=13.9

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|+.+|.+|||||...
T Consensus         7 ~~i~i~G~pGsGKsT~a   23 (191)
T PRK14527          7 KVVIFLGPPGAGKGTQA   23 (191)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            45888999999998743


No 330
>PTZ00014 myosin-A; Provisional
Probab=45.36  E-value=12  Score=37.90  Aligned_cols=21  Identities=29%  Similarity=0.390  Sum_probs=18.5

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.|.||+.-|.+|+|||.+.
T Consensus       180 ~~~~QsIiiSGESGAGKTe~t  200 (821)
T PTZ00014        180 VKKSQTIIVSGESGAGKTEAT  200 (821)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            488999999999999999653


No 331
>smart00488 DEXDc2 DEAD-like helicases superfamily.
Probab=45.14  E-value=9.4  Score=33.47  Aligned_cols=40  Identities=23%  Similarity=0.184  Sum_probs=26.0

Q ss_pred             ecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         128 FSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       128 F~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      |.+...|.++-+.    +.+.+-+|.+  ++.=.+||+|||.+.+-
T Consensus         7 y~~r~~Q~~~m~~----v~~~~~~~~~--~~~eapTGtGKTl~~L~   46 (289)
T smart00488        7 YEPYPIQYEFMEE----LKRVLDRGKI--GILESPTGTGKTLSLLC   46 (289)
T ss_pred             CCCCHHHHHHHHH----HHHHHHcCCc--EEEECCCCcchhHHHHH
Confidence            3446667776444    3444555644  56678999999987764


No 332
>smart00489 DEXDc3 DEAD-like helicases superfamily.
Probab=45.14  E-value=9.4  Score=33.47  Aligned_cols=40  Identities=23%  Similarity=0.184  Sum_probs=26.0

Q ss_pred             ecCCCcchhhhccccchhHHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         128 FSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       128 F~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      |.+...|.++-+.    +.+.+-+|.+  ++.=.+||+|||.+.+-
T Consensus         7 y~~r~~Q~~~m~~----v~~~~~~~~~--~~~eapTGtGKTl~~L~   46 (289)
T smart00489        7 YEPYPIQYEFMEE----LKRVLDRGKI--GILESPTGTGKTLSLLC   46 (289)
T ss_pred             CCCCHHHHHHHHH----HHHHHHcCCc--EEEECCCCcchhHHHHH
Confidence            3446667776444    3444555644  56678999999987764


No 333
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=45.11  E-value=9.6  Score=30.98  Aligned_cols=15  Identities=33%  Similarity=0.423  Sum_probs=11.9

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |.-.|.+|||||+.-
T Consensus         2 IgI~G~sgSGKTTla   16 (194)
T PF00485_consen    2 IGIAGPSGSGKTTLA   16 (194)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            445799999998764


No 334
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional
Probab=44.80  E-value=11  Score=33.42  Aligned_cols=15  Identities=40%  Similarity=0.691  Sum_probs=12.4

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+-.|+||||||--
T Consensus         6 ii~I~GpTasGKS~L   20 (300)
T PRK14729          6 IVFIFGPTAVGKSNI   20 (300)
T ss_pred             EEEEECCCccCHHHH
Confidence            577889999999753


No 335
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=44.64  E-value=11  Score=27.45  Aligned_cols=15  Identities=27%  Similarity=0.412  Sum_probs=12.1

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |...|.+|+|||.-+
T Consensus         2 V~iiG~~~~GKSTli   16 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLI   16 (116)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            456899999998755


No 336
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=44.58  E-value=8.3  Score=31.85  Aligned_cols=18  Identities=39%  Similarity=0.591  Sum_probs=14.8

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      ++.-+|++|+|||..+..
T Consensus        24 ~~~i~G~NGsGKTTLl~a   41 (204)
T cd03240          24 LTLIVGQNGAGKTTIIEA   41 (204)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            667789999999987743


No 337
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=44.46  E-value=12  Score=24.98  Aligned_cols=15  Identities=27%  Similarity=0.483  Sum_probs=11.0

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |.--|..|||||...
T Consensus         2 i~i~G~~gsGKst~~   16 (69)
T cd02019           2 IAITGGSGSGKSTVA   16 (69)
T ss_pred             EEEECCCCCCHHHHH
Confidence            344699999997654


No 338
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=44.34  E-value=8.3  Score=31.13  Aligned_cols=16  Identities=25%  Similarity=0.594  Sum_probs=12.8

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .++-.|++|||||..+
T Consensus         4 ~i~l~G~sGsGKsTl~   19 (186)
T PRK10078          4 LIWLMGPSGSGKDSLL   19 (186)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4566899999998765


No 339
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=44.31  E-value=9.9  Score=35.79  Aligned_cols=22  Identities=36%  Similarity=0.557  Sum_probs=16.5

Q ss_pred             HhcCCceEEEEeccCCCCcceEee
Q psy9445         149 VLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       149 ~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +..|.|  ++.||+.|||||....
T Consensus       195 AAGgHn--Ll~~GpPGtGKTmla~  216 (490)
T COG0606         195 AAGGHN--LLLVGPPGTGKTMLAS  216 (490)
T ss_pred             HhcCCc--EEEecCCCCchHHhhh
Confidence            344555  6789999999987663


No 340
>PRK01172 ski2-like helicase; Provisional
Probab=44.28  E-value=14  Score=36.21  Aligned_cols=24  Identities=33%  Similarity=0.432  Sum_probs=17.8

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .++.+.+|.|  ++..++||||||..
T Consensus        30 ai~~l~~~~n--vlv~apTGSGKTl~   53 (674)
T PRK01172         30 AIEQLRKGEN--VIVSVPTAAGKTLI   53 (674)
T ss_pred             HHHHHhcCCc--EEEECCCCchHHHH
Confidence            3445567776  56778999999975


No 341
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=43.99  E-value=20  Score=29.53  Aligned_cols=30  Identities=30%  Similarity=0.437  Sum_probs=21.2

Q ss_pred             chhHHHHhc-CC--ceEEEEeccCCCCcceEee
Q psy9445         143 NPLIDEVLS-GY--NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       143 ~~~v~~~~~-G~--n~~i~ayG~tgsGKt~Tm~  172 (243)
                      -+-++.++. |+  ...+.-+|.+|+|||..+.
T Consensus         5 ~~~lD~~l~GG~~~g~v~~I~G~~GsGKT~l~~   37 (226)
T cd01393           5 SKALDELLGGGIPTGRITEIFGEFGSGKTQLCL   37 (226)
T ss_pred             cHHHHHHhCCCCcCCcEEEEeCCCCCChhHHHH
Confidence            345677775 44  3456778999999998654


No 342
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=43.99  E-value=16  Score=30.62  Aligned_cols=18  Identities=28%  Similarity=0.283  Sum_probs=12.9

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      .-.|---|.+|||||+.+
T Consensus        33 ~~iigi~G~~GsGKTTl~   50 (229)
T PRK09270         33 RTIVGIAGPPGAGKSTLA   50 (229)
T ss_pred             CEEEEEECCCCCCHHHHH
Confidence            334444599999999854


No 343
>KOG0745|consensus
Probab=43.98  E-value=11  Score=35.24  Aligned_cols=15  Identities=47%  Similarity=0.802  Sum_probs=12.4

Q ss_pred             eEEEEeccCCCCcce
Q psy9445         155 CTVFAYGQTGTGKTF  169 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~  169 (243)
                      ..|+..|+||||||+
T Consensus       227 SNvLllGPtGsGKTl  241 (564)
T KOG0745|consen  227 SNVLLLGPTGSGKTL  241 (564)
T ss_pred             ccEEEECCCCCchhH
Confidence            346789999999986


No 344
>KOG2035|consensus
Probab=43.95  E-value=14  Score=32.71  Aligned_cols=33  Identities=24%  Similarity=0.406  Sum_probs=20.3

Q ss_pred             ccccchhHHHHhc-CCceEEEEeccCCCCcceEe
Q psy9445         139 KYVVNPLIDEVLS-GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       139 ~~~~~~~v~~~~~-G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..-..+.+.++.. |----++.||++|+||-..+
T Consensus        18 ~~e~~~~Lksl~~~~d~PHll~yGPSGaGKKTri   51 (351)
T KOG2035|consen   18 HEELANLLKSLSSTGDFPHLLVYGPSGAGKKTRI   51 (351)
T ss_pred             HHHHHHHHHHhcccCCCCeEEEECCCCCCchhhH
Confidence            3334444444443 43356889999999985543


No 345
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=43.92  E-value=8.7  Score=35.79  Aligned_cols=18  Identities=44%  Similarity=0.654  Sum_probs=14.6

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..++..|++|+|||.|+.
T Consensus       224 ~vi~lvGptGvGKTTtaa  241 (432)
T PRK12724        224 KVVFFVGPTGSGKTTSIA  241 (432)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            456677999999999874


No 346
>TIGR02688 conserved hypothetical protein TIGR02688. Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687.
Probab=43.81  E-value=10  Score=35.44  Aligned_cols=21  Identities=33%  Similarity=0.757  Sum_probs=16.1

Q ss_pred             cCCceEEEEeccCCCCcceEeec
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++|  ++-.|++|+||||...+
T Consensus       208 ~~~N--li~lGp~GTGKThla~~  228 (449)
T TIGR02688       208 PNYN--LIELGPKGTGKSYIYNN  228 (449)
T ss_pred             cCCc--EEEECCCCCCHHHHHHH
Confidence            4555  55689999999987755


No 347
>TIGR01389 recQ ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ.
Probab=43.81  E-value=15  Score=35.56  Aligned_cols=27  Identities=33%  Similarity=0.548  Sum_probs=20.6

Q ss_pred             chhHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+++.+++|.+  +++-.+||+|||.+.
T Consensus        19 ~~~i~~il~g~d--vlv~~PTG~GKTl~y   45 (591)
T TIGR01389        19 EEIISHVLDGRD--VLVVMPTGGGKSLCY   45 (591)
T ss_pred             HHHHHHHHcCCC--EEEEcCCCccHhHHH
Confidence            345667788987  456679999999874


No 348
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=43.76  E-value=9.9  Score=36.24  Aligned_cols=21  Identities=29%  Similarity=0.483  Sum_probs=16.9

Q ss_pred             cCCceEEEEeccCCCCcceEe
Q psy9445         151 SGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...+..|+-+|.+||||++..
T Consensus       224 A~~~~pvlI~GE~GtGK~~lA  244 (520)
T PRK10820        224 AMLDAPLLITGDTGTGKDLLA  244 (520)
T ss_pred             hCCCCCEEEECCCCccHHHHH
Confidence            446777999999999997654


No 349
>PF02367 UPF0079:  Uncharacterised P-loop hydrolase UPF0079;  InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements [].; PDB: 1HTW_A 1FL9_A.
Probab=43.70  E-value=13  Score=28.46  Aligned_cols=19  Identities=32%  Similarity=0.504  Sum_probs=16.1

Q ss_pred             eEEEEeccCCCCcceEeec
Q psy9445         155 CTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ..|+-+|.-|+|||+-..|
T Consensus        16 ~vi~L~GdLGaGKTtf~r~   34 (123)
T PF02367_consen   16 DVILLSGDLGAGKTTFVRG   34 (123)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5688899999999987754


No 350
>KOG0741|consensus
Probab=43.66  E-value=13  Score=35.81  Aligned_cols=15  Identities=47%  Similarity=0.837  Sum_probs=13.0

Q ss_pred             eEEEEeccCCCCcce
Q psy9445         155 CTVFAYGQTGTGKTF  169 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~  169 (243)
                      --|+-||+.|+|||.
T Consensus       257 KGiLLyGPPGTGKTL  271 (744)
T KOG0741|consen  257 KGILLYGPPGTGKTL  271 (744)
T ss_pred             eeEEEECCCCCChhH
Confidence            348999999999986


No 351
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=43.56  E-value=12  Score=29.69  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=12.2

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|...|++|||||..
T Consensus         3 ii~l~G~~GsGKsTl   17 (180)
T TIGR03263         3 LIVISGPSGVGKSTL   17 (180)
T ss_pred             EEEEECCCCCCHHHH
Confidence            356789999999874


No 352
>PRK05580 primosome assembly protein PriA; Validated
Probab=43.34  E-value=14  Score=36.52  Aligned_cols=18  Identities=33%  Similarity=0.361  Sum_probs=14.7

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..++.+|.||||||....
T Consensus       163 ~~~Ll~~~TGSGKT~v~l  180 (679)
T PRK05580        163 SPFLLDGVTGSGKTEVYL  180 (679)
T ss_pred             CcEEEECCCCChHHHHHH
Confidence            448899999999997653


No 353
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=43.20  E-value=13  Score=35.29  Aligned_cols=28  Identities=25%  Similarity=0.554  Sum_probs=19.7

Q ss_pred             HHHHhcCCce------EEEEeccCCCCcceEeec
Q psy9445         146 IDEVLSGYNC------TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       146 v~~~~~G~n~------~i~ayG~tgsGKt~Tm~G  173 (243)
                      +..++++.+.      .++-.|++|||||+.|-+
T Consensus        18 l~~vL~~Vsl~i~~GEiv~L~G~SGsGKSTLLr~   51 (504)
T TIGR03238        18 LERILVKFNKELPSSSLLFLCGSSGDGKSEILAE   51 (504)
T ss_pred             HHHHHhCCceeecCCCEEEEECCCCCCHHHHHhc
Confidence            3345666443      356789999999998874


No 354
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=43.13  E-value=12  Score=31.92  Aligned_cols=17  Identities=29%  Similarity=0.509  Sum_probs=13.8

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.+..+|++|||||..+
T Consensus        31 e~~~i~G~nGsGKSTL~   47 (235)
T COG1122          31 ERVLLIGPNGSGKSTLL   47 (235)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            35677899999998765


No 355
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=42.90  E-value=12  Score=37.25  Aligned_cols=17  Identities=47%  Similarity=0.706  Sum_probs=14.5

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.|+-||++|+|||+.+
T Consensus       213 ~giLL~GppGtGKT~la  229 (733)
T TIGR01243       213 KGVLLYGPPGTGKTLLA  229 (733)
T ss_pred             ceEEEECCCCCChHHHH
Confidence            46889999999999764


No 356
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]
Probab=42.79  E-value=14  Score=31.07  Aligned_cols=15  Identities=40%  Similarity=0.465  Sum_probs=12.2

Q ss_pred             EeccCCCCcceEeec
Q psy9445         159 AYGQTGTGKTFTMEG  173 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G  173 (243)
                      -.|+.|+|||.|.+-
T Consensus        35 LLGPNGAGKTT~Fym   49 (243)
T COG1137          35 LLGPNGAGKTTTFYM   49 (243)
T ss_pred             EECCCCCCceeEEEE
Confidence            369999999988643


No 357
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional
Probab=42.79  E-value=11  Score=37.15  Aligned_cols=22  Identities=36%  Similarity=0.602  Sum_probs=17.6

Q ss_pred             hcCCceEEEEeccCCCCcceEe
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +...+..|+-+|.+||||++.-
T Consensus       395 ~a~~~~pVLI~GE~GTGK~~lA  416 (686)
T PRK15429        395 VAQSDSTVLILGETGTGKELIA  416 (686)
T ss_pred             HhCCCCCEEEECCCCcCHHHHH
Confidence            3456778999999999998643


No 358
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=42.73  E-value=14  Score=33.32  Aligned_cols=20  Identities=30%  Similarity=0.403  Sum_probs=17.1

Q ss_pred             CCceEEEEeccCCCCcceEe
Q psy9445         152 GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +....|+..|-.|+|||.|+
T Consensus       137 ~~p~Vil~vGVNG~GKTTTI  156 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTI  156 (340)
T ss_pred             CCcEEEEEEecCCCchHhHH
Confidence            44667888899999999998


No 359
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=42.70  E-value=12  Score=34.80  Aligned_cols=17  Identities=35%  Similarity=0.649  Sum_probs=14.6

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|+-+|+||+|||...
T Consensus       117 ~~iLL~GP~GsGKT~lA  133 (413)
T TIGR00382       117 SNILLIGPTGSGKTLLA  133 (413)
T ss_pred             ceEEEECCCCcCHHHHH
Confidence            57889999999998765


No 360
>PRK00279 adk adenylate kinase; Reviewed
Probab=42.63  E-value=12  Score=31.06  Aligned_cols=14  Identities=29%  Similarity=0.520  Sum_probs=12.1

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+.+|..|||||..
T Consensus         3 I~v~G~pGsGKsT~   16 (215)
T PRK00279          3 LILLGPPGAGKGTQ   16 (215)
T ss_pred             EEEECCCCCCHHHH
Confidence            78899999999863


No 361
>TIGR01074 rep ATP-dependent DNA helicase Rep. Designed to identify rep members of the uvrD/rep subfamily.
Probab=42.63  E-value=10  Score=37.12  Aligned_cols=20  Identities=20%  Similarity=0.348  Sum_probs=16.6

Q ss_pred             ceEEEEeccCCCCcceEeec
Q psy9445         154 NCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      ...++..|..|||||.||..
T Consensus        14 ~~~~~V~Ag~GSGKT~~L~~   33 (664)
T TIGR01074        14 TGPCLVLAGAGSGKTRVITN   33 (664)
T ss_pred             CCCEEEEecCCCCHHHHHHH
Confidence            34578899999999999965


No 362
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=42.46  E-value=19  Score=28.85  Aligned_cols=24  Identities=38%  Similarity=0.613  Sum_probs=17.9

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +...+.+  -+++..|++|.|||..+
T Consensus        29 l~~~l~~--k~~vl~G~SGvGKSSLi   52 (161)
T PF03193_consen   29 LKELLKG--KTSVLLGQSGVGKSSLI   52 (161)
T ss_dssp             HHHHHTT--SEEEEECSTTSSHHHHH
T ss_pred             HHHHhcC--CEEEEECCCCCCHHHHH
Confidence            4455666  46667899999998776


No 363
>PRK10865 protein disaggregation chaperone; Provisional
Probab=42.29  E-value=13  Score=37.90  Aligned_cols=17  Identities=35%  Similarity=0.413  Sum_probs=14.5

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      +.++-+|++|+|||++.
T Consensus       599 ~~~Lf~Gp~G~GKT~lA  615 (857)
T PRK10865        599 GSFLFLGPTGVGKTELC  615 (857)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            56788899999999865


No 364
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=42.09  E-value=13  Score=28.53  Aligned_cols=14  Identities=29%  Similarity=0.534  Sum_probs=10.9

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |.-.|++|||||.-
T Consensus         2 i~i~GpsGsGKstl   15 (137)
T cd00071           2 IVLSGPSGVGKSTL   15 (137)
T ss_pred             EEEECCCCCCHHHH
Confidence            34569999999863


No 365
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional
Probab=42.07  E-value=12  Score=36.05  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=17.2

Q ss_pred             hcCCceEEEEeccCCCCcceE
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      +...+..|+-+|.+||||++.
T Consensus       238 ~A~s~~pVLI~GE~GTGKe~~  258 (538)
T PRK15424        238 YARSSAAVLIQGETGTGKELA  258 (538)
T ss_pred             HhCCCCcEEEECCCCCCHHHH
Confidence            356788999999999999653


No 366
>PRK02496 adk adenylate kinase; Provisional
Probab=41.81  E-value=12  Score=29.95  Aligned_cols=14  Identities=29%  Similarity=0.494  Sum_probs=11.8

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+..|..|||||..
T Consensus         4 i~i~G~pGsGKst~   17 (184)
T PRK02496          4 LIFLGPPGAGKGTQ   17 (184)
T ss_pred             EEEECCCCCCHHHH
Confidence            56789999999874


No 367
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR. At least five distinct pathways exists for the catabolism of propionate by way of propionyl-CoA. Members of this family represent the transcriptional regulatory protein PrpR, whose gene is found in most cases divergently transcribed from an operon for the methylcitric acid cycle of propionate catabolism. 2-methylcitric acid, a catabolite by this pathway, is a coactivator of PrpR.
Probab=41.76  E-value=11  Score=36.07  Aligned_cols=22  Identities=32%  Similarity=0.575  Sum_probs=17.8

Q ss_pred             hcCCceEEEEeccCCCCcceEe
Q psy9445         150 LSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       150 ~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +...+..|+-+|.+||||+..-
T Consensus       231 ~A~~~~pVLI~GE~GTGKe~lA  252 (526)
T TIGR02329       231 YARSDATVLILGESGTGKELVA  252 (526)
T ss_pred             HhCCCCcEEEECCCCcCHHHHH
Confidence            3567789999999999996543


No 368
>PF03668 ATP_bind_2:  P-loop ATPase protein family;  InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins. This is a family of putative P-loop ATPases [], as they contain an ATP-binding site and display ATPase and GTPase activities.; GO: 0005524 ATP binding
Probab=41.71  E-value=30  Score=30.45  Aligned_cols=16  Identities=31%  Similarity=0.555  Sum_probs=13.8

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+.-|.+|+|||..|
T Consensus         3 ~vIiTGlSGaGKs~Al   18 (284)
T PF03668_consen    3 LVIITGLSGAGKSTAL   18 (284)
T ss_pred             EEEEeCCCcCCHHHHH
Confidence            3677899999999888


No 369
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=41.65  E-value=9.1  Score=38.77  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=15.2

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      |...+..|.+|||||++|
T Consensus       449 N~N~~I~G~sGsGKS~l~  466 (844)
T PRK13721        449 NYNMAVCGTSGAGKTGLI  466 (844)
T ss_pred             cccEEEEcCCCCCHHHHH
Confidence            445778999999999988


No 370
>KOG1534|consensus
Probab=41.64  E-value=16  Score=30.97  Aligned_cols=16  Identities=25%  Similarity=0.476  Sum_probs=13.0

Q ss_pred             eEEEEeccCCCCcceE
Q psy9445         155 CTVFAYGQTGTGKTFT  170 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~T  170 (243)
                      ..+|.+|+.||||+.-
T Consensus         4 ya~lV~GpAgSGKSTy   19 (273)
T KOG1534|consen    4 YAQLVMGPAGSGKSTY   19 (273)
T ss_pred             eeEEEEccCCCCcchH
Confidence            3578999999999753


No 371
>PRK00300 gmk guanylate kinase; Provisional
Probab=41.47  E-value=15  Score=29.87  Aligned_cols=17  Identities=24%  Similarity=0.428  Sum_probs=13.0

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|.-.|++|||||..+
T Consensus         6 ~~i~i~G~sGsGKstl~   22 (205)
T PRK00300          6 LLIVLSGPSGAGKSTLV   22 (205)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            34667799999999643


No 372
>PF08298 AAA_PrkA:  PrkA AAA domain;  InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length. PrkA possesses the A-motif of nucleotide-binding proteins and exhibits distant homology to eukaryotic protein kinases []. Note that many of these are hypothetical.
Probab=41.45  E-value=30  Score=31.44  Aligned_cols=48  Identities=19%  Similarity=0.477  Sum_probs=32.1

Q ss_pred             HHHHhcCC---ceEEEEeccCCCCcc---------------eEeecCCCCCCCCCCCCCCCCCchhHHHHHHHH
Q psy9445         146 IDEVLSGY---NCTVFAYGQTGTGKT---------------FTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFD  201 (243)
Q Consensus       146 v~~~~~G~---n~~i~ayG~tgsGKt---------------~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~  201 (243)
                      +.++-.|.   .--+.-.|+.|+|||               ||+.|.+-...+        -+|||.-+++.|.
T Consensus        77 fk~AA~g~~~~krIl~L~GPvg~GKSsl~~~Lk~~le~y~~Y~l~~~Pm~e~P--------L~L~P~~~r~~~~  142 (358)
T PF08298_consen   77 FKSAAQGLEERKRILLLLGPVGGGKSSLAELLKRGLEEYPIYTLKGCPMHEEP--------LHLFPKELRREFE  142 (358)
T ss_pred             HHHHHhccCccceEEEEECCCCCCHHHHHHHHHHHhheEEEEEecCCccccCh--------hhhCCHhHHHHHH
Confidence            34444454   345777899999995               788777643322        3778888887764


No 373
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=41.37  E-value=10  Score=31.36  Aligned_cols=17  Identities=29%  Similarity=0.581  Sum_probs=13.1

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      .+.-.|++|||||..|.
T Consensus        30 ~~~i~G~NGsGKSTll~   46 (213)
T cd03279          30 LFLICGPTGAGKSTILD   46 (213)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            44567999999987763


No 374
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=40.91  E-value=13  Score=29.71  Aligned_cols=16  Identities=19%  Similarity=0.339  Sum_probs=13.0

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+.-|.+|||||...
T Consensus         4 ~i~l~G~~gsGKst~a   19 (175)
T cd00227           4 IIILNGGSSAGKSSIA   19 (175)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4778899999998654


No 375
>KOG0736|consensus
Probab=40.90  E-value=14  Score=37.05  Aligned_cols=23  Identities=26%  Similarity=0.440  Sum_probs=18.5

Q ss_pred             CCCCCCchhHHHHHHHHHHHhcC
Q psy9445         185 DDPLSGIVPRAMNHLFDELRLLG  207 (243)
Q Consensus       185 ~~~~~Gii~r~~~~lf~~~~~~~  207 (243)
                      ....-|+|-|++.+|..+++...
T Consensus       783 sGDSGGVMDRVVSQLLAELDgls  805 (953)
T KOG0736|consen  783 SGDSGGVMDRVVSQLLAELDGLS  805 (953)
T ss_pred             CCCccccHHHHHHHHHHHhhccc
Confidence            34456999999999999998743


No 376
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=40.89  E-value=13  Score=37.02  Aligned_cols=17  Identities=41%  Similarity=0.653  Sum_probs=13.9

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|+-||++|+|||+..
T Consensus       488 ~giLL~GppGtGKT~la  504 (733)
T TIGR01243       488 KGVLLFGPPGTGKTLLA  504 (733)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            35788999999999754


No 377
>PRK14528 adenylate kinase; Provisional
Probab=40.87  E-value=13  Score=30.17  Aligned_cols=16  Identities=25%  Similarity=0.451  Sum_probs=13.0

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+..|.+|||||+..
T Consensus         3 ~i~i~G~pGsGKtt~a   18 (186)
T PRK14528          3 NIIFMGPPGAGKGTQA   18 (186)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3678999999997654


No 378
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=40.82  E-value=17  Score=35.45  Aligned_cols=20  Identities=25%  Similarity=0.401  Sum_probs=15.4

Q ss_pred             CCceEEEEeccCCCCcceEe
Q psy9445         152 GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ......+..|+||||||...
T Consensus       254 ~~~~~~Ll~g~TGSGKT~va  273 (630)
T TIGR00643       254 DVPMNRLLQGDVGSGKTLVA  273 (630)
T ss_pred             CCCccEEEECCCCCcHHHHH
Confidence            33445788999999999764


No 379
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=40.63  E-value=13  Score=30.64  Aligned_cols=16  Identities=31%  Similarity=0.358  Sum_probs=12.2

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|.-.|.+|||||+.+
T Consensus         8 vi~I~G~sGsGKSTl~   23 (207)
T TIGR00235         8 IIGIGGGSGSGKTTVA   23 (207)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3556799999998654


No 380
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=40.61  E-value=16  Score=31.45  Aligned_cols=16  Identities=25%  Similarity=0.387  Sum_probs=13.6

Q ss_pred             ceEEEEeccCCCCcce
Q psy9445         154 NCTVFAYGQTGTGKTF  169 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~  169 (243)
                      ..+++.+|.+|+|||.
T Consensus        36 gs~~lI~G~pGtGKT~   51 (259)
T TIGR03878        36 YSVINITGVSDTGKSL   51 (259)
T ss_pred             CcEEEEEcCCCCCHHH
Confidence            4667889999999986


No 381
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=40.57  E-value=13  Score=32.15  Aligned_cols=15  Identities=27%  Similarity=0.510  Sum_probs=12.7

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+..|..|||||+.
T Consensus         4 liil~G~pGSGKSTl   18 (300)
T PHA02530          4 IILTVGVPGSGKSTW   18 (300)
T ss_pred             EEEEEcCCCCCHHHH
Confidence            577789999999865


No 382
>PLN02200 adenylate kinase family protein
Probab=40.51  E-value=13  Score=31.52  Aligned_cols=16  Identities=31%  Similarity=0.542  Sum_probs=13.4

Q ss_pred             eEEEEeccCCCCcceE
Q psy9445         155 CTVFAYGQTGTGKTFT  170 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~T  170 (243)
                      ..|+..|.+|||||.-
T Consensus        44 ~ii~I~G~PGSGKsT~   59 (234)
T PLN02200         44 FITFVLGGPGSGKGTQ   59 (234)
T ss_pred             EEEEEECCCCCCHHHH
Confidence            4578899999999865


No 383
>PHA02774 E1; Provisional
Probab=40.07  E-value=19  Score=34.92  Aligned_cols=26  Identities=27%  Similarity=0.523  Sum_probs=19.4

Q ss_pred             HHHHhcCCc--eEEEEeccCCCCcceEe
Q psy9445         146 IDEVLSGYN--CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       146 v~~~~~G~n--~~i~ayG~tgsGKt~Tm  171 (243)
                      +..++.|..  .|++-||+.|+||||-.
T Consensus       424 lk~~l~~~PKknciv~~GPP~TGKS~fa  451 (613)
T PHA02774        424 LKDFLKGIPKKNCLVIYGPPDTGKSMFC  451 (613)
T ss_pred             HHHHHhcCCcccEEEEECCCCCCHHHHH
Confidence            344556543  58999999999998864


No 384
>PTZ00301 uridine kinase; Provisional
Probab=39.98  E-value=9.3  Score=31.93  Aligned_cols=12  Identities=33%  Similarity=0.554  Sum_probs=9.9

Q ss_pred             eccCCCCcceEe
Q psy9445         160 YGQTGTGKTFTM  171 (243)
Q Consensus       160 yG~tgsGKt~Tm  171 (243)
                      -|.+|||||+.-
T Consensus         9 aG~SgSGKTTla   20 (210)
T PTZ00301          9 SGASGSGKSSLS   20 (210)
T ss_pred             ECCCcCCHHHHH
Confidence            499999998853


No 385
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=39.94  E-value=24  Score=29.27  Aligned_cols=26  Identities=38%  Similarity=0.673  Sum_probs=18.0

Q ss_pred             HHHHhc-CC--ceEEEEeccCCCCcceEe
Q psy9445         146 IDEVLS-GY--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       146 v~~~~~-G~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++.++. |+  ...++-+|.+|+|||...
T Consensus         5 LD~~l~gGi~~g~~~li~G~~G~GKt~~~   33 (224)
T TIGR03880         5 LDEMLGGGFPEGHVIVVIGEYGTGKTTFS   33 (224)
T ss_pred             hHHHhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            455554 54  456677899999997643


No 386
>PRK10867 signal recognition particle protein; Provisional
Probab=39.77  E-value=15  Score=34.37  Aligned_cols=19  Identities=32%  Similarity=0.436  Sum_probs=15.3

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ...|+..|.+|+|||.|..
T Consensus       100 p~vI~~vG~~GsGKTTtaa  118 (433)
T PRK10867        100 PTVIMMVGLQGAGKTTTAG  118 (433)
T ss_pred             CEEEEEECCCCCcHHHHHH
Confidence            4567777999999998763


No 387
>PRK13889 conjugal transfer relaxase TraA; Provisional
Probab=39.76  E-value=14  Score=38.13  Aligned_cols=27  Identities=26%  Similarity=0.406  Sum_probs=20.6

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .|..++.+.+.+ +..|..|+||||+|-
T Consensus       354 Av~~il~s~~v~-vv~G~AGTGKTT~l~  380 (988)
T PRK13889        354 ALAHVTDGRDLG-VVVGYAGTGKSAMLG  380 (988)
T ss_pred             HHHHHhcCCCeE-EEEeCCCCCHHHHHH
Confidence            466677776644 488999999999864


No 388
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=39.45  E-value=14  Score=34.54  Aligned_cols=17  Identities=35%  Similarity=0.472  Sum_probs=14.1

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|+.+|++|+|||+..
T Consensus        48 ~~ILLiGppG~GKT~lA   64 (441)
T TIGR00390        48 KNILMIGPTGVGKTEIA   64 (441)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            45889999999998654


No 389
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.40  E-value=8.5  Score=37.74  Aligned_cols=16  Identities=31%  Similarity=0.596  Sum_probs=14.0

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .++.||++|+|||.++
T Consensus       112 illL~GP~GsGKTTl~  127 (637)
T TIGR00602       112 ILLITGPSGCGKSTTI  127 (637)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4788999999999876


No 390
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=39.32  E-value=16  Score=29.83  Aligned_cols=17  Identities=41%  Similarity=0.565  Sum_probs=12.2

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -+|+-.|+.|||||.-+
T Consensus         4 ~~vlL~Gps~SGKTaLf   20 (181)
T PF09439_consen    4 PTVLLVGPSGSGKTALF   20 (181)
T ss_dssp             -EEEEE-STTSSHHHHH
T ss_pred             ceEEEEcCCCCCHHHHH
Confidence            46788999999998544


No 391
>KOG1532|consensus
Probab=39.28  E-value=13  Score=32.71  Aligned_cols=20  Identities=30%  Similarity=0.484  Sum_probs=17.2

Q ss_pred             CceEEEEeccCCCCcceEee
Q psy9445         153 YNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+||+..|-.|||||.-|.
T Consensus        18 ~p~~ilVvGMAGSGKTTF~Q   37 (366)
T KOG1532|consen   18 RPVIILVVGMAGSGKTTFMQ   37 (366)
T ss_pred             CCcEEEEEecCCCCchhHHH
Confidence            46799999999999998774


No 392
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=39.21  E-value=28  Score=30.92  Aligned_cols=29  Identities=24%  Similarity=0.344  Sum_probs=20.9

Q ss_pred             chhHHHHhcC-C--ceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLSG-Y--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~G-~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+-++.++.| +  ...+.-||++|+|||.-+
T Consensus        82 ~~~LD~lLgGGi~~G~iteI~G~~GsGKTql~  113 (313)
T TIGR02238        82 SQALDGILGGGIESMSITEVFGEFRCGKTQLS  113 (313)
T ss_pred             CHHHHHHhCCCCcCCeEEEEECCCCCCcCHHH
Confidence            4557777774 3  345668999999998755


No 393
>PF05872 DUF853:  Bacterial protein of unknown function (DUF853);  InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold. This family is restricted to bacterial proteins, none of which have currently been characterised.
Probab=39.17  E-value=11  Score=35.40  Aligned_cols=15  Identities=53%  Similarity=0.691  Sum_probs=12.5

Q ss_pred             EeccCCCCcceEeec
Q psy9445         159 AYGQTGTGKTFTMEG  173 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G  173 (243)
                      --|.||+|||-|+.-
T Consensus        24 IaGATGTGKTvTLqv   38 (502)
T PF05872_consen   24 IAGATGTGKTVTLQV   38 (502)
T ss_pred             eeccCCCCceehHHH
Confidence            359999999999853


No 394
>CHL00176 ftsH cell division protein; Validated
Probab=39.02  E-value=13  Score=36.38  Aligned_cols=17  Identities=41%  Similarity=0.532  Sum_probs=14.7

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.|+-||++|+|||+..
T Consensus       217 ~gVLL~GPpGTGKT~LA  233 (638)
T CHL00176        217 KGVLLVGPPGTGKTLLA  233 (638)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            45899999999999875


No 395
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=38.94  E-value=24  Score=35.51  Aligned_cols=31  Identities=32%  Similarity=0.427  Sum_probs=24.9

Q ss_pred             ccchhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         141 VVNPLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       141 ~~~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      .+..+++++-+|.+-.+++. .||||||+|-+
T Consensus       173 AI~rv~Eaf~~g~~raLlvM-ATGTGKTrTAi  203 (875)
T COG4096         173 AIRRVIEAFSKGQNRALLVM-ATGTGKTRTAI  203 (875)
T ss_pred             HHHHHHHHHhcCCceEEEEE-ecCCCcceeHH
Confidence            35678888889999865555 69999999975


No 396
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=38.93  E-value=16  Score=30.87  Aligned_cols=17  Identities=24%  Similarity=0.399  Sum_probs=14.5

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+..+|++|+|||...
T Consensus        25 ~~~~i~G~~G~GKTtl~   41 (230)
T PRK08533         25 SLILIEGDESTGKSILS   41 (230)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            47788999999999883


No 397
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=38.92  E-value=12  Score=29.66  Aligned_cols=16  Identities=38%  Similarity=0.549  Sum_probs=12.6

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      +...|.+|+|||.+..
T Consensus         3 ~~~~G~~G~GKTt~~~   18 (173)
T cd03115           3 ILLVGLQGVGKTTTAA   18 (173)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            4556999999998853


No 398
>PRK06851 hypothetical protein; Provisional
Probab=38.77  E-value=15  Score=33.58  Aligned_cols=28  Identities=36%  Similarity=0.547  Sum_probs=21.7

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +.+.++++.+-.++--|.+|+|||++|.
T Consensus        21 ~~~~~~~~~~~~~il~G~pGtGKStl~~   48 (367)
T PRK06851         21 LYDSIIDGANRIFILKGGPGTGKSTLMK   48 (367)
T ss_pred             hhhhhccccceEEEEECCCCCCHHHHHH
Confidence            3445566777778889999999998874


No 399
>PF01745 IPT:  Isopentenyl transferase;  InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [].; GO: 0004161 dimethylallyltranstransferase activity, 0009058 biosynthetic process; PDB: 2ZE8_C 2ZE5_A 2ZE7_A 2ZE6_A.
Probab=38.75  E-value=15  Score=31.06  Aligned_cols=14  Identities=50%  Similarity=0.612  Sum_probs=10.5

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      +.-+|+||+|||..
T Consensus         4 ~~i~GpT~tGKt~~   17 (233)
T PF01745_consen    4 YLIVGPTGTGKTAL   17 (233)
T ss_dssp             EEEE-STTSSHHHH
T ss_pred             EEEECCCCCChhHH
Confidence            45689999999875


No 400
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=38.75  E-value=10  Score=37.74  Aligned_cols=31  Identities=26%  Similarity=0.284  Sum_probs=22.2

Q ss_pred             hhHHHHhcCCceEEEEeccCCCCcceEeecC
Q psy9445         144 PLIDEVLSGYNCTVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       144 ~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~G~  174 (243)
                      .+++-+..+....++-||.+|+|||....|-
T Consensus       193 ~~~~~L~~~~~~n~lL~G~pG~GKT~l~~~l  223 (731)
T TIGR02639       193 RTIQVLCRRKKNNPLLVGEPGVGKTAIAEGL  223 (731)
T ss_pred             HHHHHHhcCCCCceEEECCCCCCHHHHHHHH
Confidence            4454444445556788999999999998763


No 401
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=38.59  E-value=14  Score=31.33  Aligned_cols=16  Identities=25%  Similarity=0.405  Sum_probs=13.2

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      |+..|..|||||+...
T Consensus         2 Ivl~G~pGSGKST~a~   17 (249)
T TIGR03574         2 IILTGLPGVGKSTFSK   17 (249)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6778999999987663


No 402
>PRK04296 thymidine kinase; Provisional
Probab=38.56  E-value=8.3  Score=31.45  Aligned_cols=18  Identities=28%  Similarity=0.492  Sum_probs=14.2

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .++-+|..|+|||..+.+
T Consensus         4 i~litG~~GsGKTT~~l~   21 (190)
T PRK04296          4 LEFIYGAMNSGKSTELLQ   21 (190)
T ss_pred             EEEEECCCCCHHHHHHHH
Confidence            456789999999966654


No 403
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional
Probab=38.51  E-value=15  Score=34.65  Aligned_cols=22  Identities=27%  Similarity=0.200  Sum_probs=16.4

Q ss_pred             hcCCc-eEEEEeccCCCCcceEe
Q psy9445         150 LSGYN-CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       150 ~~G~n-~~i~ayG~tgsGKt~Tm  171 (243)
                      -.|.- ..++-||+.|+|||.+.
T Consensus        31 ~~~~l~~~~Lf~GPpGtGKTTlA   53 (472)
T PRK14962         31 KKNSISHAYIFAGPRGTGKTTVA   53 (472)
T ss_pred             HcCCCCeEEEEECCCCCCHHHHH
Confidence            34433 45789999999999775


No 404
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=38.50  E-value=26  Score=30.77  Aligned_cols=28  Identities=32%  Similarity=0.526  Sum_probs=19.6

Q ss_pred             hhHHHHhc-CC--ceEEEEeccCCCCcceEe
Q psy9445         144 PLIDEVLS-GY--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       144 ~~v~~~~~-G~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      +-++.++. |+  ...+..||.+|+|||..+
T Consensus        82 ~~lD~~l~GGi~~g~i~ei~G~~g~GKT~l~  112 (310)
T TIGR02236        82 KELDELLGGGIETQAITEVFGEFGSGKTQIC  112 (310)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            44556666 32  455678999999998754


No 405
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=38.48  E-value=11  Score=33.99  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=14.8

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      .-.++-||+.|+|||.+.
T Consensus        38 ~h~~L~~Gp~G~GKTtla   55 (363)
T PRK14961         38 HHAWLLSGTRGVGKTTIA   55 (363)
T ss_pred             CeEEEEecCCCCCHHHHH
Confidence            446789999999999854


No 406
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=38.29  E-value=16  Score=32.85  Aligned_cols=27  Identities=22%  Similarity=0.359  Sum_probs=18.6

Q ss_pred             hHHHHhcCC-ceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGY-NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~-n~~i~ayG~tgsGKt~Tm  171 (243)
                      +.+.+-.|. .-.++-||+.|+|||++.
T Consensus        29 l~~~i~~~~~~~~~L~~G~~G~GKt~~a   56 (367)
T PRK14970         29 LLNAIENNHLAQALLFCGPRGVGKTTCA   56 (367)
T ss_pred             HHHHHHcCCCCeEEEEECCCCCCHHHHH
Confidence            333344454 447888999999999765


No 407
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=38.26  E-value=16  Score=29.46  Aligned_cols=16  Identities=25%  Similarity=0.499  Sum_probs=12.9

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .+...|.+|||||+.+
T Consensus         5 ~i~l~G~sGsGKSTl~   20 (176)
T PRK09825          5 SYILMGVSGSGKSLIG   20 (176)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4567899999998854


No 408
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=38.22  E-value=16  Score=32.48  Aligned_cols=24  Identities=29%  Similarity=0.361  Sum_probs=17.6

Q ss_pred             HHhcCC-ceEEEEeccCCCCcceEe
Q psy9445         148 EVLSGY-NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       148 ~~~~G~-n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+-.|. .-.++-||+.|+|||.+.
T Consensus        29 ~~~~~~~~~~~Ll~G~~G~GKt~~a   53 (355)
T TIGR02397        29 AIKNGRIAHAYLFSGPRGTGKTSIA   53 (355)
T ss_pred             HHHcCCCCeEEEEECCCCCCHHHHH
Confidence            334453 456889999999999765


No 409
>PRK13949 shikimate kinase; Provisional
Probab=38.18  E-value=15  Score=29.35  Aligned_cols=16  Identities=38%  Similarity=0.509  Sum_probs=13.2

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+-.|+.|||||...
T Consensus         3 ~I~liG~~GsGKstl~   18 (169)
T PRK13949          3 RIFLVGYMGAGKTTLG   18 (169)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4788999999998654


No 410
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=38.08  E-value=18  Score=30.85  Aligned_cols=25  Identities=44%  Similarity=0.735  Sum_probs=18.0

Q ss_pred             HHHHhcC-C--ceEEEEeccCCCCcceE
Q psy9445         146 IDEVLSG-Y--NCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       146 v~~~~~G-~--n~~i~ayG~tgsGKt~T  170 (243)
                      ++.++.| +  ...++.+|.+|||||.-
T Consensus        12 lD~~l~GG~p~g~~~lI~G~pGsGKT~f   39 (260)
T COG0467          12 LDEILGGGLPRGSVVLITGPPGTGKTIF   39 (260)
T ss_pred             hHHHhcCCCcCCcEEEEEcCCCCcHHHH
Confidence            4555553 3  56788999999999743


No 411
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=38.01  E-value=12  Score=35.95  Aligned_cols=17  Identities=41%  Similarity=0.544  Sum_probs=13.5

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ..|...|++|+|||+|+
T Consensus       351 ~vIaLVGPtGvGKTTta  367 (559)
T PRK12727        351 GVIALVGPTGAGKTTTI  367 (559)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            34555599999999997


No 412
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU). CobU is bifunctional cobalbumin biosynthesis enzymes which display adenosylcobinamide kinase and adenosylcobinamide phosphate guanyltransferase activity. This enzyme is a homotrimer with a propeller-like shape.
Probab=38.00  E-value=17  Score=29.25  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=11.4

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      ++..|.+|||||..
T Consensus         2 ~li~G~~~sGKS~~   15 (169)
T cd00544           2 ILVTGGARSGKSRF   15 (169)
T ss_pred             EEEECCCCCCHHHH
Confidence            56789999999754


No 413
>TIGR00959 ffh signal recognition particle protein. This model represents Ffh (Fifty-Four Homolog), the protein component that forms the bacterial (and organellar) signal recognition particle together with a 4.5S RNA. Ffh is a GTPase homologous to eukaryotic SRP54 and also to the GTPase FtsY (TIGR00064) that is the receptor for the signal recognition particle.
Probab=37.99  E-value=15  Score=34.18  Aligned_cols=18  Identities=33%  Similarity=0.495  Sum_probs=15.1

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ...++..|.+|+|||.|.
T Consensus        99 p~vi~~vG~~GsGKTTta  116 (428)
T TIGR00959        99 PTVILMVGLQGSGKTTTC  116 (428)
T ss_pred             CEEEEEECCCCCcHHHHH
Confidence            456778899999999985


No 414
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=37.99  E-value=24  Score=33.41  Aligned_cols=29  Identities=28%  Similarity=0.405  Sum_probs=21.0

Q ss_pred             chhHHHHhc-CC--ceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLS-GY--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~-G~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      -+-++.++. |+  ...++.+|.+|+|||.-.
T Consensus        17 I~~LD~~l~GG~p~Gs~~li~G~pGsGKT~l~   48 (509)
T PRK09302         17 IEGFDDITHGGLPKGRPTLVSGTAGTGKTLFA   48 (509)
T ss_pred             chhHHHhhcCCCCCCcEEEEEeCCCCCHHHHH
Confidence            344666775 44  577888999999997643


No 415
>TIGR01587 cas3_core CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.
Probab=37.89  E-value=16  Score=32.46  Aligned_cols=15  Identities=33%  Similarity=0.317  Sum_probs=12.2

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      ++.-++||||||...
T Consensus         2 vvi~apTGsGKT~~~   16 (358)
T TIGR01587         2 LVIEAPTGYGKTEAA   16 (358)
T ss_pred             EEEEeCCCCCHHHHH
Confidence            567799999999763


No 416
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=37.86  E-value=12  Score=38.08  Aligned_cols=18  Identities=33%  Similarity=0.626  Sum_probs=15.2

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++-.+..|+||||||+.+
T Consensus       488 ~gh~~I~G~tGsGKS~l~  505 (852)
T PRK13891        488 LGHTFMFGPTGAGKSTHL  505 (852)
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            445688999999999887


No 417
>KOG0922|consensus
Probab=37.82  E-value=20  Score=35.07  Aligned_cols=18  Identities=33%  Similarity=0.632  Sum_probs=15.4

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      |..++.-|.||||||.-+
T Consensus        66 nqvlIviGeTGsGKSTQi   83 (674)
T KOG0922|consen   66 NQVLIVIGETGSGKSTQI   83 (674)
T ss_pred             CCEEEEEcCCCCCccccH
Confidence            566778899999999877


No 418
>PRK13873 conjugal transfer ATPase TrbE; Provisional
Probab=37.72  E-value=13  Score=37.51  Aligned_cols=17  Identities=29%  Similarity=0.544  Sum_probs=14.3

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      +-.+..|+||||||+.|
T Consensus       442 gn~~I~G~tGsGKS~l~  458 (811)
T PRK13873        442 GHTLVVGPTGAGKSVLL  458 (811)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            35667999999999988


No 419
>KOG0924|consensus
Probab=37.63  E-value=19  Score=35.61  Aligned_cols=20  Identities=40%  Similarity=0.519  Sum_probs=18.0

Q ss_pred             CCceEEEEeccCCCCcceEe
Q psy9445         152 GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +-|..|+..|.||||||.-+
T Consensus       369 r~n~vvvivgETGSGKTTQl  388 (1042)
T KOG0924|consen  369 RENQVVVIVGETGSGKTTQL  388 (1042)
T ss_pred             hhCcEEEEEecCCCCchhhh
Confidence            66888999999999999877


No 420
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=37.60  E-value=21  Score=36.18  Aligned_cols=28  Identities=21%  Similarity=0.287  Sum_probs=19.6

Q ss_pred             chhHHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       143 ~~~v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ..+++.+-++.  .++..|+||||||..+.
T Consensus        11 ~~i~~~l~~~~--~vvv~A~TGSGKTt~~p   38 (812)
T PRK11664         11 PELLTALKTAP--QVLLKAPTGAGKSTWLP   38 (812)
T ss_pred             HHHHHHHHhCC--CEEEEcCCCCCHHHHHH
Confidence            44555554443  46789999999998763


No 421
>KOG2655|consensus
Probab=37.55  E-value=23  Score=32.27  Aligned_cols=23  Identities=30%  Similarity=0.603  Sum_probs=19.7

Q ss_pred             HHhcCCceEEEEeccCCCCcceE
Q psy9445         148 EVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       148 ~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .+-.|+.-++++.|++|+|||.-
T Consensus        15 ~~KkG~~ftlmvvG~sGlGKsTf   37 (366)
T KOG2655|consen   15 SVKKGFDFTLMVVGESGLGKSTF   37 (366)
T ss_pred             HHhcCCceEEEEecCCCccHHHH
Confidence            35579999999999999999653


No 422
>KOG0328|consensus
Probab=37.51  E-value=29  Score=30.76  Aligned_cols=24  Identities=50%  Similarity=0.725  Sum_probs=18.8

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      |..++.|.+  |+|-.|+|+|||.|.
T Consensus        58 i~~IlkGrd--ViaQaqSGTGKTa~~   81 (400)
T KOG0328|consen   58 IPQILKGRD--VIAQAQSGTGKTATF   81 (400)
T ss_pred             hhhhhcccc--eEEEecCCCCceEEE
Confidence            445678887  468889999998776


No 423
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=37.45  E-value=13  Score=31.21  Aligned_cols=15  Identities=27%  Similarity=0.472  Sum_probs=12.3

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      ..-.|++|+|||..|
T Consensus        26 ~~i~GpNGsGKStll   40 (243)
T cd03272          26 NVVVGRNGSGKSNFF   40 (243)
T ss_pred             EEEECCCCCCHHHHH
Confidence            335799999999886


No 424
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=37.34  E-value=18  Score=29.81  Aligned_cols=16  Identities=25%  Similarity=0.420  Sum_probs=12.5

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      ..+-+|++|+|||-.+
T Consensus        26 ~~~i~G~NGsGKS~il   41 (220)
T PF02463_consen   26 LNVIVGPNGSGKSNIL   41 (220)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            4557899999998654


No 425
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated
Probab=37.23  E-value=17  Score=29.19  Aligned_cols=15  Identities=20%  Similarity=0.326  Sum_probs=12.3

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .++..|.+|||||.-
T Consensus         3 ~ili~G~~~sGKS~~   17 (170)
T PRK05800          3 LILVTGGARSGKSRF   17 (170)
T ss_pred             EEEEECCCCccHHHH
Confidence            378899999999753


No 426
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=37.11  E-value=19  Score=28.79  Aligned_cols=16  Identities=31%  Similarity=0.549  Sum_probs=13.7

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+..|.+|+|||...
T Consensus         6 ~I~liG~~GaGKStl~   21 (172)
T PRK05057          6 NIFLVGPMGAGKSTIG   21 (172)
T ss_pred             EEEEECCCCcCHHHHH
Confidence            5888999999998765


No 427
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=37.07  E-value=19  Score=30.90  Aligned_cols=29  Identities=41%  Similarity=0.714  Sum_probs=21.5

Q ss_pred             HHhcCCceEE------EEeccCCCCcc---eEeecCCC
Q psy9445         148 EVLSGYNCTV------FAYGQTGTGKT---FTMEGEKS  176 (243)
Q Consensus       148 ~~~~G~n~~i------~ayG~tgsGKt---~Tm~G~~~  176 (243)
                      .++.|.|.+|      --.|+.|||||   |+++|.+.
T Consensus        18 eILkgvnL~v~~GEvhaiMGPNGsGKSTLa~~i~G~p~   55 (251)
T COG0396          18 EILKGVNLTVKEGEVHAIMGPNGSGKSTLAYTIMGHPK   55 (251)
T ss_pred             hhhcCcceeEcCCcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4677777766      34799999995   67888763


No 428
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.06  E-value=22  Score=28.85  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=12.0

Q ss_pred             EEEeccCCCCcceEeec
Q psy9445         157 VFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~G  173 (243)
                      |+| |+.|||||....-
T Consensus         6 Iva-G~NGsGKstv~~~   21 (187)
T COG4185           6 IVA-GPNGSGKSTVYAS   21 (187)
T ss_pred             EEe-cCCCCCceeeeec
Confidence            444 9999999876544


No 429
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=36.96  E-value=16  Score=29.53  Aligned_cols=15  Identities=40%  Similarity=0.410  Sum_probs=11.7

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |..-|.+|||||+..
T Consensus         2 i~i~G~sgsGKttla   16 (179)
T cd02028           2 VGIAGPSGSGKTTFA   16 (179)
T ss_pred             EEEECCCCCCHHHHH
Confidence            455699999998754


No 430
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=36.89  E-value=16  Score=29.29  Aligned_cols=17  Identities=29%  Similarity=0.346  Sum_probs=13.7

Q ss_pred             EEEEeccCCCCcceEee
Q psy9445         156 TVFAYGQTGTGKTFTME  172 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~  172 (243)
                      -.+-+|++|+|||+.+.
T Consensus        34 l~~i~g~~g~GKT~~~~   50 (193)
T PF13481_consen   34 LTLIAGPPGSGKTTLAL   50 (193)
T ss_dssp             EEEEEECSTSSHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHH
Confidence            46678999999998663


No 431
>PRK05541 adenylylsulfate kinase; Provisional
Probab=36.79  E-value=17  Score=28.81  Aligned_cols=16  Identities=31%  Similarity=0.553  Sum_probs=13.0

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+-.|.+|||||...
T Consensus         9 ~I~i~G~~GsGKst~a   24 (176)
T PRK05541          9 VIWITGLAGSGKTTIA   24 (176)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            5667899999997655


No 432
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=36.72  E-value=11  Score=29.94  Aligned_cols=13  Identities=31%  Similarity=0.590  Sum_probs=11.0

Q ss_pred             eccCCCCcceEee
Q psy9445         160 YGQTGTGKTFTME  172 (243)
Q Consensus       160 yG~tgsGKt~Tm~  172 (243)
                      .|.+|||||+.+.
T Consensus         1 ~G~sGsGKSTla~   13 (163)
T PRK11545          1 MGVSGSGKSAVAS   13 (163)
T ss_pred             CCCCCCcHHHHHH
Confidence            4899999998874


No 433
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=36.71  E-value=22  Score=35.70  Aligned_cols=35  Identities=26%  Similarity=0.241  Sum_probs=0.0

Q ss_pred             chhhhccccchhHHHHhcCC------ceEEEEeccCCCCcce
Q psy9445         134 QVDVYKYVVNPLIDEVLSGY------NCTVFAYGQTGTGKTF  169 (243)
Q Consensus       134 q~ev~~~~~~~~v~~~~~G~------n~~i~ayG~tgsGKt~  169 (243)
                      |.+.-+. +...|.....|.      .++++-+|++|+|||+
T Consensus       463 Q~~ai~~-l~~~i~~~~~gl~~~~kp~~~~Lf~GP~GvGKT~  503 (758)
T PRK11034        463 QDKAIEA-LTEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTE  503 (758)
T ss_pred             cHHHHHH-HHHHHHHHhccccCCCCCcceEEEECCCCCCHHH


No 434
>KOG0925|consensus
Probab=36.55  E-value=21  Score=34.01  Aligned_cols=20  Identities=35%  Similarity=0.458  Sum_probs=17.7

Q ss_pred             CCceEEEEeccCCCCcceEe
Q psy9445         152 GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      +.|.+|..-|.||||||.-+
T Consensus        60 ~~nQ~~v~vGetgsGKttQi   79 (699)
T KOG0925|consen   60 LNNQIIVLVGETGSGKTTQI   79 (699)
T ss_pred             hcCceEEEEecCCCCccccC
Confidence            56889999999999999766


No 435
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=36.53  E-value=27  Score=33.01  Aligned_cols=26  Identities=31%  Similarity=0.543  Sum_probs=19.7

Q ss_pred             hhHHHHhc-CC--ceEEEEeccCCCCcce
Q psy9445         144 PLIDEVLS-GY--NCTVFAYGQTGTGKTF  169 (243)
Q Consensus       144 ~~v~~~~~-G~--n~~i~ayG~tgsGKt~  169 (243)
                      +-++.++. |+  ..+++..|.+|||||.
T Consensus         8 ~gLD~il~GGlp~g~~~Li~G~pGsGKT~   36 (484)
T TIGR02655         8 EGFDDISHGGLPIGRSTLVSGTSGTGKTL   36 (484)
T ss_pred             hhHHHhcCCCCCCCeEEEEEcCCCCCHHH
Confidence            34566676 43  6788999999999974


No 436
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=36.51  E-value=15  Score=34.16  Aligned_cols=19  Identities=32%  Similarity=0.438  Sum_probs=15.7

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      ...|...|.+|+|||.|..
T Consensus       100 ~~vi~lvG~~GvGKTTtaa  118 (429)
T TIGR01425       100 QNVIMFVGLQGSGKTTTCT  118 (429)
T ss_pred             CeEEEEECCCCCCHHHHHH
Confidence            4567778999999999874


No 437
>PF05707 Zot:  Zonular occludens toxin (Zot);  InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophage present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers.; PDB: 2R2A_B.
Probab=36.49  E-value=15  Score=29.91  Aligned_cols=16  Identities=25%  Similarity=0.551  Sum_probs=10.5

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      .+-.|..|||||+.+.
T Consensus         3 ~~~~G~pGsGKS~~av   18 (193)
T PF05707_consen    3 YLITGKPGSGKSYYAV   18 (193)
T ss_dssp             EEEE--TTSSHHHHHH
T ss_pred             EEEEcCCCCcHhHHHH
Confidence            3557999999998653


No 438
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=36.38  E-value=18  Score=32.18  Aligned_cols=15  Identities=33%  Similarity=0.465  Sum_probs=12.2

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+..|+||||||.-
T Consensus         6 ~i~i~GptgsGKt~l   20 (307)
T PRK00091          6 VIVIVGPTASGKTAL   20 (307)
T ss_pred             EEEEECCCCcCHHHH
Confidence            467789999999754


No 439
>PRK13853 type IV secretion system protein VirB4; Provisional
Probab=36.35  E-value=12  Score=37.75  Aligned_cols=17  Identities=35%  Similarity=0.485  Sum_probs=14.5

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      +..+.+|+||||||..+
T Consensus       427 g~~~I~G~tGsGKS~l~  443 (789)
T PRK13853        427 GMTAIFGPIGRGKTTLM  443 (789)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            45778999999999886


No 440
>PRK01184 hypothetical protein; Provisional
Probab=36.33  E-value=16  Score=29.15  Aligned_cols=15  Identities=27%  Similarity=0.284  Sum_probs=12.3

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+..|..|||||+.
T Consensus         3 ~i~l~G~~GsGKsT~   17 (184)
T PRK01184          3 IIGVVGMPGSGKGEF   17 (184)
T ss_pred             EEEEECCCCCCHHHH
Confidence            366789999999884


No 441
>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family. Members of this family include the predicted ATPase, TraG, encoded by transfer region genes of conjugative transposons of Bacteroides, such as CTnDOT, found on the main chromosome. Members also include TraG homologs borne on plasmids in Bacteroides. The protein family is related to the conjugative transfer system ATPase VirB4.
Probab=36.24  E-value=12  Score=37.95  Aligned_cols=18  Identities=39%  Similarity=0.706  Sum_probs=15.6

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      |...+..|++|+|||+.|
T Consensus       438 n~N~~I~G~sGsGKS~l~  455 (829)
T TIGR03783       438 NRNKFILGPSGSGKSFFT  455 (829)
T ss_pred             cCceEEECCCCCCHHHHH
Confidence            566788999999999877


No 442
>PRK13880 conjugal transfer coupling protein TraG; Provisional
Probab=36.10  E-value=25  Score=34.57  Aligned_cols=19  Identities=26%  Similarity=0.378  Sum_probs=16.1

Q ss_pred             ceEEEEeccCCCCcceEee
Q psy9445         154 NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +.-++++|.||||||..+.
T Consensus       175 ~~HvlviapTgSGKgvg~V  193 (636)
T PRK13880        175 PEHVLTYAPTRSGKGVGLV  193 (636)
T ss_pred             CceEEEEecCCCCCceEEE
Confidence            4568899999999999775


No 443
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit. This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.
Probab=36.03  E-value=13  Score=36.15  Aligned_cols=25  Identities=32%  Similarity=0.373  Sum_probs=16.9

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEee
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +..++..  .-.+..|..|||||+|+.
T Consensus       154 ~~~al~~--~~~vitGgpGTGKTt~v~  178 (586)
T TIGR01447       154 VALALKS--NFSLITGGPGTGKTTTVA  178 (586)
T ss_pred             HHHHhhC--CeEEEEcCCCCCHHHHHH
Confidence            3344443  345568999999999864


No 444
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=36.01  E-value=32  Score=31.07  Aligned_cols=30  Identities=33%  Similarity=0.540  Sum_probs=21.5

Q ss_pred             cchhHHHHhcC-C--ceEEEEeccCCCCcceEe
Q psy9445         142 VNPLIDEVLSG-Y--NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       142 ~~~~v~~~~~G-~--n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+-++.++.| +  .....-||..|||||.-.
T Consensus       111 G~~~LD~lLgGGi~~G~ItEI~G~~GsGKTql~  143 (344)
T PLN03187        111 GSQALDELLGGGIETRCITEAFGEFRSGKTQLA  143 (344)
T ss_pred             CcHhHHhhcCCCCCCCeEEEEecCCCCChhHHH
Confidence            45567788874 3  344568999999998743


No 445
>PRK05480 uridine/cytidine kinase; Provisional
Probab=35.82  E-value=17  Score=29.82  Aligned_cols=16  Identities=31%  Similarity=0.395  Sum_probs=12.3

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|.--|.+|||||+..
T Consensus         8 iI~I~G~sGsGKTTl~   23 (209)
T PRK05480          8 IIGIAGGSGSGKTTVA   23 (209)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4556699999998654


No 446
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=35.77  E-value=17  Score=34.26  Aligned_cols=54  Identities=22%  Similarity=0.271  Sum_probs=30.6

Q ss_pred             CCceEEEEeccCCCCcceEeecCCCCC-CCC---C--CCCCCCCCchhHHHHHHHHHHHh
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEGEKSND-PSI---S--WQDDPLSGIVPRAMNHLFDELRL  205 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G~~~~~-~~~---~--~~~~~~~Gii~r~~~~lf~~~~~  205 (243)
                      .....++-||+.|+|||+.----.... .+.   .  .--+..-|-.-..++.+|.....
T Consensus       274 ~~~~giLl~GpPGtGKT~lAkava~~~~~~fi~v~~~~l~sk~vGesek~ir~~F~~A~~  333 (494)
T COG0464         274 RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGESEKNIRELFEKARK  333 (494)
T ss_pred             CCCCeeEEECCCCCCHHHHHHHHHhhCCCeEEEeeCHHHhccccchHHHHHHHHHHHHHc
Confidence            344579999999999987642211000 000   0  00111237777888888887763


No 447
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=35.70  E-value=30  Score=30.95  Aligned_cols=30  Identities=27%  Similarity=0.310  Sum_probs=22.3

Q ss_pred             cchhHHHHhc--CCc--eEEEEeccCCCCcceEe
Q psy9445         142 VNPLIDEVLS--GYN--CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       142 ~~~~v~~~~~--G~n--~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+-++.++.  |+.  ..+.-||++|||||...
T Consensus        39 Gi~~LD~~Lg~GGlp~G~iteI~G~~GsGKTtLa   72 (321)
T TIGR02012        39 GSLSLDLALGVGGLPRGRIIEIYGPESSGKTTLA   72 (321)
T ss_pred             CCHHHHHHhcCCCCcCCeEEEEECCCCCCHHHHH
Confidence            4556777775  664  46788999999998763


No 448
>PRK04182 cytidylate kinase; Provisional
Probab=35.68  E-value=17  Score=28.57  Aligned_cols=14  Identities=36%  Similarity=0.546  Sum_probs=11.6

Q ss_pred             EEEeccCCCCcceE
Q psy9445         157 VFAYGQTGTGKTFT  170 (243)
Q Consensus       157 i~ayG~tgsGKt~T  170 (243)
                      |+..|..|||||..
T Consensus         3 I~i~G~~GsGKsti   16 (180)
T PRK04182          3 ITISGPPGSGKTTV   16 (180)
T ss_pred             EEEECCCCCCHHHH
Confidence            66779999999873


No 449
>KOG0743|consensus
Probab=35.65  E-value=16  Score=34.13  Aligned_cols=14  Identities=43%  Similarity=0.786  Sum_probs=12.0

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      +-||+.|||||.-+
T Consensus       239 LLYGPPGTGKSS~I  252 (457)
T KOG0743|consen  239 LLYGPPGTGKSSFI  252 (457)
T ss_pred             eeeCCCCCCHHHHH
Confidence            78999999998654


No 450
>PF01078 Mg_chelatase:  Magnesium chelatase, subunit ChlI;  InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.
Probab=35.56  E-value=19  Score=30.17  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=12.5

Q ss_pred             eEEEEeccCCCCcceEee
Q psy9445         155 CTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm~  172 (243)
                      --|+.+|..|+|||....
T Consensus        23 h~lLl~GppGtGKTmlA~   40 (206)
T PF01078_consen   23 HHLLLIGPPGTGKTMLAR   40 (206)
T ss_dssp             --EEEES-CCCTHHHHHH
T ss_pred             CCeEEECCCCCCHHHHHH
Confidence            368899999999986543


No 451
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=35.54  E-value=17  Score=38.48  Aligned_cols=22  Identities=32%  Similarity=0.542  Sum_probs=16.1

Q ss_pred             HhcCCceEEEEeccCCCCcceEe
Q psy9445         149 VLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       149 ~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++.+ |..++..|+||||||.-+
T Consensus        85 ai~~-~~VviI~GeTGSGKTTql  106 (1294)
T PRK11131         85 AIRD-HQVVIVAGETGSGKTTQL  106 (1294)
T ss_pred             HHHh-CCeEEEECCCCCCHHHHH
Confidence            3444 345778899999999854


No 452
>PRK13767 ATP-dependent helicase; Provisional
Probab=35.50  E-value=24  Score=36.05  Aligned_cols=25  Identities=32%  Similarity=0.401  Sum_probs=18.3

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+++|.|+.  .-.+||||||...
T Consensus        40 Ai~~il~g~nvl--i~APTGSGKTlaa   64 (876)
T PRK13767         40 AIPLIHEGKNVL--ISSPTGSGKTLAA   64 (876)
T ss_pred             HHHHHHcCCCEE--EECCCCCcHHHHH
Confidence            345567888754  4679999999863


No 453
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=35.40  E-value=19  Score=32.02  Aligned_cols=16  Identities=31%  Similarity=0.372  Sum_probs=13.1

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .++-+|+|+||||..-
T Consensus         5 ~i~I~GPTAsGKT~la   20 (308)
T COG0324           5 LIVIAGPTASGKTALA   20 (308)
T ss_pred             EEEEECCCCcCHHHHH
Confidence            4678899999998754


No 454
>TIGR00174 miaA tRNA isopentenyltransferase (miaA). Catalyzes the first step in the modification of an adenosine near the anticodon to 2-methylthio-N6-isopentyladenosine.
Probab=35.39  E-value=19  Score=31.69  Aligned_cols=15  Identities=33%  Similarity=0.561  Sum_probs=12.2

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |+..|+||||||.-.
T Consensus         2 i~i~G~t~~GKs~la   16 (287)
T TIGR00174         2 IFIMGPTAVGKSQLA   16 (287)
T ss_pred             EEEECCCCCCHHHHH
Confidence            577899999998644


No 455
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM).
Probab=35.30  E-value=13  Score=35.93  Aligned_cols=15  Identities=33%  Similarity=0.689  Sum_probs=12.4

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      -++.+|.||||||..
T Consensus       178 h~li~G~tGsGKs~~  192 (566)
T TIGR02759       178 HILIHGTTGSGKSVA  192 (566)
T ss_pred             ceEEEcCCCCCHHHH
Confidence            467899999999853


No 456
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=35.28  E-value=13  Score=32.76  Aligned_cols=18  Identities=28%  Similarity=0.569  Sum_probs=14.8

Q ss_pred             EEEEeccCCCCcceEeec
Q psy9445         156 TVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G  173 (243)
                      .|...|.+|||||..+.-
T Consensus         8 ~i~i~G~~GsGKtt~~~~   25 (288)
T PRK05416          8 LVIVTGLSGAGKSVALRA   25 (288)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            477889999999988743


No 457
>PRK13531 regulatory ATPase RavA; Provisional
Probab=35.28  E-value=18  Score=34.38  Aligned_cols=25  Identities=32%  Similarity=0.489  Sum_probs=17.6

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++..++.|-  .|+-+|++|+|||+..
T Consensus        32 ll~aalag~--hVLL~GpPGTGKT~LA   56 (498)
T PRK13531         32 CLLAALSGE--SVFLLGPPGIAKSLIA   56 (498)
T ss_pred             HHHHHccCC--CEEEECCCChhHHHHH
Confidence            444455554  5677999999998754


No 458
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=35.15  E-value=13  Score=28.25  Aligned_cols=16  Identities=19%  Similarity=0.353  Sum_probs=12.6

Q ss_pred             EEEeccCCCCcceEee
Q psy9445         157 VFAYGQTGTGKTFTME  172 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm~  172 (243)
                      |...|.+|+|||..+.
T Consensus         2 i~l~G~~g~GKTtL~~   17 (170)
T cd01876           2 IAFAGRSNVGKSSLIN   17 (170)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            4567999999987663


No 459
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=35.05  E-value=18  Score=34.53  Aligned_cols=23  Identities=26%  Similarity=0.330  Sum_probs=17.4

Q ss_pred             HhcCC-ceEEEEeccCCCCcceEe
Q psy9445         149 VLSGY-NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       149 ~~~G~-n~~i~ayG~tgsGKt~Tm  171 (243)
                      +..|. .-.++-+|+.|+|||.+.
T Consensus        37 i~~~ri~~a~Lf~Gp~G~GKTT~A   60 (507)
T PRK06645         37 ILNDRLAGGYLLTGIRGVGKTTSA   60 (507)
T ss_pred             HHcCCCCceEEEECCCCCCHHHHH
Confidence            34444 357889999999999765


No 460
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB. This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.
Probab=35.02  E-value=13  Score=29.33  Aligned_cols=14  Identities=29%  Similarity=0.363  Sum_probs=10.9

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      ...|.+|||||..+
T Consensus         3 ~i~G~~gsGKTtl~   16 (155)
T TIGR00176         3 QIVGPKNSGKTTLI   16 (155)
T ss_pred             EEECCCCCCHHHHH
Confidence            34599999999764


No 461
>PTZ00088 adenylate kinase 1; Provisional
Probab=34.94  E-value=18  Score=30.64  Aligned_cols=13  Identities=31%  Similarity=0.685  Sum_probs=11.4

Q ss_pred             EEEeccCCCCcce
Q psy9445         157 VFAYGQTGTGKTF  169 (243)
Q Consensus       157 i~ayG~tgsGKt~  169 (243)
                      |+..|+.|||||+
T Consensus         9 Ivl~G~PGsGK~T   21 (229)
T PTZ00088          9 IVLFGAPGVGKGT   21 (229)
T ss_pred             EEEECCCCCCHHH
Confidence            7889999999964


No 462
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=34.88  E-value=13  Score=30.01  Aligned_cols=14  Identities=29%  Similarity=0.534  Sum_probs=11.7

Q ss_pred             EEeccCCCCcceEe
Q psy9445         158 FAYGQTGTGKTFTM  171 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm  171 (243)
                      .-.|++|+|||..+
T Consensus        25 ~l~G~nG~GKSTLl   38 (176)
T cd03238          25 VVTGVSGSGKSTLV   38 (176)
T ss_pred             EEECCCCCCHHHHH
Confidence            45799999999876


No 463
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.
Probab=34.69  E-value=19  Score=36.05  Aligned_cols=27  Identities=22%  Similarity=0.405  Sum_probs=19.0

Q ss_pred             HHHHhcCCceEEEEeccCCCCcceEeec
Q psy9445         146 IDEVLSGYNCTVFAYGQTGTGKTFTMEG  173 (243)
Q Consensus       146 v~~~~~G~n~~i~ayG~tgsGKt~Tm~G  173 (243)
                      +..++.+ +..++..|..|+|||++|-.
T Consensus       361 v~~i~~s-~~~~il~G~aGTGKTtll~~  387 (744)
T TIGR02768       361 VRHVTGS-GDIAVVVGRAGTGKSTMLKA  387 (744)
T ss_pred             HHHHhcC-CCEEEEEecCCCCHHHHHHH
Confidence            4445554 33456789999999988855


No 464
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=34.68  E-value=22  Score=26.62  Aligned_cols=16  Identities=31%  Similarity=0.505  Sum_probs=12.5

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .+.-.|++|||||.-+
T Consensus        13 ~~~i~G~nGsGKStLl   28 (137)
T PF00005_consen   13 IVAIVGPNGSGKSTLL   28 (137)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEEccCCCccccce
Confidence            3455799999998765


No 465
>PTZ00110 helicase; Provisional
Probab=34.49  E-value=24  Score=33.87  Aligned_cols=25  Identities=32%  Similarity=0.440  Sum_probs=19.2

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..+++|.++  ++.++||||||.+.
T Consensus       160 aip~~l~G~dv--I~~ApTGSGKTlay  184 (545)
T PTZ00110        160 GWPIALSGRDM--IGIAETGSGKTLAF  184 (545)
T ss_pred             HHHHHhcCCCE--EEEeCCCChHHHHH
Confidence            35567889875  56789999999763


No 466
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=34.49  E-value=24  Score=27.01  Aligned_cols=17  Identities=18%  Similarity=0.358  Sum_probs=13.8

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      .-|...|.+|+|||..+
T Consensus         2 ~ki~v~G~~~~GKSsli   18 (163)
T cd01860           2 FKLVLLGDSSVGKSSLV   18 (163)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            34678899999998766


No 467
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional
Probab=34.37  E-value=9.1  Score=39.27  Aligned_cols=15  Identities=40%  Similarity=0.468  Sum_probs=11.8

Q ss_pred             eccCCCCcceEeecC
Q psy9445         160 YGQTGTGKTFTMEGE  174 (243)
Q Consensus       160 yG~tgsGKt~Tm~G~  174 (243)
                      -=.||||||||+.+.
T Consensus        65 ~M~TGtGKT~~~~~~   79 (986)
T PRK15483         65 KMETGTGKTYVYTRL   79 (986)
T ss_pred             EeCCCCCHHHHHHHH
Confidence            347999999987663


No 468
>PRK13946 shikimate kinase; Provisional
Probab=34.33  E-value=19  Score=28.97  Aligned_cols=17  Identities=35%  Similarity=0.368  Sum_probs=14.2

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      -.|+..|..|||||..-
T Consensus        11 ~~I~l~G~~GsGKsti~   27 (184)
T PRK13946         11 RTVVLVGLMGAGKSTVG   27 (184)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            36889999999998754


No 469
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=34.29  E-value=25  Score=27.15  Aligned_cols=17  Identities=24%  Similarity=0.472  Sum_probs=13.2

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      .-|...|.+|+|||.-+
T Consensus         4 ~kv~vvG~~~~GKTsli   20 (165)
T cd01864           4 FKIILIGDSNVGKTCVV   20 (165)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            45667899999998654


No 470
>PRK09401 reverse gyrase; Reviewed
Probab=34.15  E-value=27  Score=36.85  Aligned_cols=24  Identities=29%  Similarity=0.382  Sum_probs=18.1

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      .+..++.|.+..+  ..+||||||..
T Consensus        88 ~i~~il~g~dv~i--~ApTGsGKT~f  111 (1176)
T PRK09401         88 WAKRLLLGESFAI--IAPTGVGKTTF  111 (1176)
T ss_pred             HHHHHHCCCcEEE--EcCCCCCHHHH
Confidence            4556788987654  56999999964


No 471
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=34.09  E-value=34  Score=30.20  Aligned_cols=29  Identities=34%  Similarity=0.511  Sum_probs=20.1

Q ss_pred             hhHHHHhcC-C--ceEEEEeccCCCCcceEee
Q psy9445         144 PLIDEVLSG-Y--NCTVFAYGQTGTGKTFTME  172 (243)
Q Consensus       144 ~~v~~~~~G-~--n~~i~ayG~tgsGKt~Tm~  172 (243)
                      +-++.++.| +  ...+.-||.+|+|||...+
T Consensus        89 ~~lD~~l~GGi~~g~vtei~G~~GsGKT~l~~  120 (317)
T PRK04301         89 KELDELLGGGIETQSITEFYGEFGSGKTQICH  120 (317)
T ss_pred             HHHHHHhcCCccCCcEEEEECCCCCCHhHHHH
Confidence            445566653 3  4567789999999987553


No 472
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.
Probab=33.98  E-value=19  Score=28.93  Aligned_cols=15  Identities=27%  Similarity=0.364  Sum_probs=12.0

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |.-.|..|||||+..
T Consensus         2 i~itG~~gsGKst~~   16 (179)
T cd02022           2 IGLTGGIGSGKSTVA   16 (179)
T ss_pred             EEEECCCCCCHHHHH
Confidence            566899999998654


No 473
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=33.81  E-value=21  Score=27.16  Aligned_cols=15  Identities=33%  Similarity=0.499  Sum_probs=12.3

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |..+|.+|+|||.-+
T Consensus         3 i~~~G~~~~GKTsl~   17 (164)
T cd04139           3 VIVVGAGGVGKSALT   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999754


No 474
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=33.68  E-value=21  Score=31.84  Aligned_cols=36  Identities=22%  Similarity=0.438  Sum_probs=22.4

Q ss_pred             chhhhccccchhHHHHhcCCceEEEEeccCCCCcceE
Q psy9445         134 QVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFT  170 (243)
Q Consensus       134 q~ev~~~~~~~~v~~~~~G~n~~i~ayG~tgsGKt~T  170 (243)
                      ...-|+..+.+ |+.+---..+-++..|+||.||+|.
T Consensus       189 rnp~fnrmieq-ierva~rsr~p~ll~gptgagksfl  224 (531)
T COG4650         189 RNPHFNRMIEQ-IERVAIRSRAPILLNGPTGAGKSFL  224 (531)
T ss_pred             cChHHHHHHHH-HHHHHhhccCCeEeecCCCcchhHH
Confidence            33344444333 3344445566788999999999863


No 475
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=33.37  E-value=18  Score=29.35  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=12.8

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|...|.+|+|||.++
T Consensus         2 ~i~lvG~~g~GKSsl~   17 (196)
T cd01852           2 RLVLVGKTGAGKSATG   17 (196)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3667899999999864


No 476
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=33.35  E-value=14  Score=29.87  Aligned_cols=15  Identities=33%  Similarity=0.623  Sum_probs=0.0

Q ss_pred             EeccCCCCcceEeec
Q psy9445         159 AYGQTGTGKTFTMEG  173 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G  173 (243)
                      -+|+.|||||.-+..
T Consensus         4 iiG~N~sGKS~il~a   18 (303)
T PF13304_consen    4 IIGPNGSGKSNILEA   18 (303)
T ss_dssp             ---------------
T ss_pred             ccccccccccccccc
Confidence            479999999988743


No 477
>PLN02165 adenylate isopentenyltransferase
Probab=33.33  E-value=21  Score=32.20  Aligned_cols=16  Identities=38%  Similarity=0.520  Sum_probs=12.6

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+-.|+||||||...
T Consensus        45 iivIiGPTGSGKStLA   60 (334)
T PLN02165         45 VVVIMGATGSGKSRLS   60 (334)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            4566899999998654


No 478
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=33.33  E-value=22  Score=29.96  Aligned_cols=16  Identities=38%  Similarity=0.582  Sum_probs=12.9

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|.+.|++|+|||.-+
T Consensus        33 ~vv~lGpSGcGKTTLL   48 (259)
T COG4525          33 LVVVLGPSGCGKTTLL   48 (259)
T ss_pred             EEEEEcCCCccHHHHH
Confidence            4578899999998754


No 479
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=33.31  E-value=22  Score=26.92  Aligned_cols=15  Identities=33%  Similarity=0.519  Sum_probs=12.5

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |...|..|+|||.-+
T Consensus         2 i~i~G~~~~GKTsli   16 (160)
T cd00876           2 VVVLGAGGVGKSAIT   16 (160)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999998765


No 480
>PRK13947 shikimate kinase; Provisional
Probab=33.24  E-value=20  Score=28.10  Aligned_cols=15  Identities=40%  Similarity=0.543  Sum_probs=12.4

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+..|..|||||+.
T Consensus         3 ~I~l~G~~GsGKst~   17 (171)
T PRK13947          3 NIVLIGFMGTGKTTV   17 (171)
T ss_pred             eEEEEcCCCCCHHHH
Confidence            377889999999764


No 481
>PRK13830 conjugal transfer protein TrbE; Provisional
Probab=33.13  E-value=16  Score=36.98  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.5

Q ss_pred             ceEEEEeccCCCCcceEe
Q psy9445         154 NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       154 n~~i~ayG~tgsGKt~Tm  171 (243)
                      ++..+..|+||+|||+.|
T Consensus       456 ~g~~~i~G~tGsGKS~l~  473 (818)
T PRK13830        456 VGHTLIFGPTGSGKSTLL  473 (818)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            456788999999999887


No 482
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional
Probab=33.12  E-value=20  Score=32.00  Aligned_cols=20  Identities=30%  Similarity=0.491  Sum_probs=16.4

Q ss_pred             CCceEEEEeccCCCCcceEe
Q psy9445         152 GYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..+.-|+-.|.+||||++.-
T Consensus        27 ~~~~pVlI~GE~GtGK~~lA   46 (326)
T PRK11608         27 PLDKPVLIIGERGTGKELIA   46 (326)
T ss_pred             CCCCCEEEECCCCCcHHHHH
Confidence            55677888999999997654


No 483
>PRK05973 replicative DNA helicase; Provisional
Probab=33.06  E-value=31  Score=29.42  Aligned_cols=26  Identities=27%  Similarity=0.321  Sum_probs=18.4

Q ss_pred             HHHHhcCCc--eEEEEeccCCCCcceEe
Q psy9445         146 IDEVLSGYN--CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       146 v~~~~~G~n--~~i~ayG~tgsGKt~Tm  171 (243)
                      .+.+..|+.  ..++..|.+|+|||...
T Consensus        54 ~~~l~GGl~~Gsl~LIaG~PG~GKT~la   81 (237)
T PRK05973         54 AEELFSQLKPGDLVLLGARPGHGKTLLG   81 (237)
T ss_pred             HHHhcCCCCCCCEEEEEeCCCCCHHHHH
Confidence            445666663  45777999999998643


No 484
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=33.03  E-value=22  Score=30.30  Aligned_cols=13  Identities=31%  Similarity=0.511  Sum_probs=11.2

Q ss_pred             EEEeccCCCCcce
Q psy9445         157 VFAYGQTGTGKTF  169 (243)
Q Consensus       157 i~ayG~tgsGKt~  169 (243)
                      |+-+|+.|||||.
T Consensus         2 iLLmG~~~SGKTS   14 (232)
T PF04670_consen    2 ILLMGPRRSGKTS   14 (232)
T ss_dssp             EEEEESTTSSHHH
T ss_pred             EEEEcCCCCChhh
Confidence            5679999999975


No 485
>TIGR00678 holB DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau.
Probab=33.01  E-value=37  Score=27.20  Aligned_cols=24  Identities=21%  Similarity=0.331  Sum_probs=17.4

Q ss_pred             HHhcC-CceEEEEeccCCCCcceEe
Q psy9445         148 EVLSG-YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       148 ~~~~G-~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+-.| ...+++-||+.|+|||...
T Consensus         7 ~i~~~~~~~~~L~~G~~G~gkt~~a   31 (188)
T TIGR00678         7 ALEKGRLAHAYLFAGPEGVGKELLA   31 (188)
T ss_pred             HHHcCCCCeEEEEECCCCCCHHHHH
Confidence            33445 4467888999999998554


No 486
>KOG1970|consensus
Probab=32.87  E-value=18  Score=34.84  Aligned_cols=16  Identities=31%  Similarity=0.569  Sum_probs=13.4

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .++..|++|+|||.|+
T Consensus       112 iLLltGPsGcGKSTtv  127 (634)
T KOG1970|consen  112 ILLLTGPSGCGKSTTV  127 (634)
T ss_pred             EEEEeCCCCCCchhHH
Confidence            3556799999999987


No 487
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional
Probab=32.72  E-value=19  Score=34.98  Aligned_cols=23  Identities=30%  Similarity=0.379  Sum_probs=16.5

Q ss_pred             HhcCC-ceEEEEeccCCCCcceEe
Q psy9445         149 VLSGY-NCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       149 ~~~G~-n~~i~ayG~tgsGKt~Tm  171 (243)
                      +-.|. .-.++-||+.|+|||.+.
T Consensus        29 i~~~r~~ha~Lf~Gp~G~GKTt~A   52 (584)
T PRK14952         29 LDAGRINHAYLFSGPRGCGKTSSA   52 (584)
T ss_pred             HHcCCCCeEEEEECCCCCCHHHHH
Confidence            33444 335789999999999764


No 488
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=32.58  E-value=26  Score=33.40  Aligned_cols=25  Identities=44%  Similarity=0.610  Sum_probs=19.0

Q ss_pred             hHHHHhcCCceEEEEeccCCCCcceEe
Q psy9445         145 LIDEVLSGYNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       145 ~v~~~~~G~n~~i~ayG~tgsGKt~Tm  171 (243)
                      .+..++.|.+  |++..|||||||...
T Consensus        59 ~IP~~l~g~D--vi~~A~TGsGKT~Af   83 (513)
T COG0513          59 AIPLILAGRD--VLGQAQTGTGKTAAF   83 (513)
T ss_pred             HHHHHhCCCC--EEEECCCCChHHHHH
Confidence            4556788854  678899999997654


No 489
>PF01293 PEPCK_ATP:  Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region;  InterPro: IPR001272  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents ATP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004612 phosphoenolpyruvate carboxykinase (ATP) activity, 0005524 ATP binding, 0006094 gluconeogenesis; PDB: 2PY7_X 2OLR_A 1AYL_A 1K3D_A 1OEN_A 1AQ2_A 1OS1_A 2OLQ_A 1K3C_A 2PXZ_X ....
Probab=32.57  E-value=24  Score=33.27  Aligned_cols=20  Identities=40%  Similarity=0.715  Sum_probs=15.9

Q ss_pred             EEEEeccCCCCcce-------EeecCC
Q psy9445         156 TVFAYGQTGTGKTF-------TMEGEK  175 (243)
Q Consensus       156 ~i~ayG~tgsGKt~-------Tm~G~~  175 (243)
                      +.+.||-+|||||.       +|.|..
T Consensus       212 ~alfFGLSGTGKTTLs~d~~r~ligDD  238 (466)
T PF01293_consen  212 TALFFGLSGTGKTTLSADPERELIGDD  238 (466)
T ss_dssp             EEEEEESTTSSHHHHHSBTTSEEEESS
T ss_pred             eEEEEecCCCCccccccCCcceEEeCc
Confidence            46789999999995       666754


No 490
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=32.52  E-value=20  Score=33.54  Aligned_cols=16  Identities=38%  Similarity=0.515  Sum_probs=13.8

Q ss_pred             eEEEEeccCCCCcceE
Q psy9445         155 CTVFAYGQTGTGKTFT  170 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~T  170 (243)
                      ..|+.+|++|+|||..
T Consensus        51 ~~ILliGp~G~GKT~L   66 (443)
T PRK05201         51 KNILMIGPTGVGKTEI   66 (443)
T ss_pred             ceEEEECCCCCCHHHH
Confidence            5789999999999853


No 491
>KOG3354|consensus
Probab=32.48  E-value=29  Score=28.08  Aligned_cols=19  Identities=21%  Similarity=0.546  Sum_probs=15.4

Q ss_pred             cCCceEEEEeccCCCCcce
Q psy9445         151 SGYNCTVFAYGQTGTGKTF  169 (243)
Q Consensus       151 ~G~n~~i~ayG~tgsGKt~  169 (243)
                      .-+..+|...|.+|||||.
T Consensus         9 ~~~k~~i~vmGvsGsGKST   27 (191)
T KOG3354|consen    9 GPFKYVIVVMGVSGSGKST   27 (191)
T ss_pred             CCCceeEEEEecCCCChhh
Confidence            3456688899999999974


No 492
>KOG0923|consensus
Probab=32.47  E-value=27  Score=34.47  Aligned_cols=19  Identities=32%  Similarity=0.501  Sum_probs=16.1

Q ss_pred             CceEEEEeccCCCCcceEe
Q psy9445         153 YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       153 ~n~~i~ayG~tgsGKt~Tm  171 (243)
                      -+..++--|.||||||.-+
T Consensus       279 e~QVLiI~GeTGSGKTTQi  297 (902)
T KOG0923|consen  279 EHQVLIIVGETGSGKTTQI  297 (902)
T ss_pred             hCcEEEEEcCCCCCccccc
Confidence            3567888999999999877


No 493
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=32.45  E-value=16  Score=27.58  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=12.5

Q ss_pred             EEEeccCCCCcceEe
Q psy9445         157 VFAYGQTGTGKTFTM  171 (243)
Q Consensus       157 i~ayG~tgsGKt~Tm  171 (243)
                      |...|.+|+|||..+
T Consensus         4 i~l~G~~~~GKstli   18 (157)
T cd04164           4 VVIVGKPNVGKSSLL   18 (157)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999998765


No 494
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=32.29  E-value=30  Score=35.27  Aligned_cols=17  Identities=35%  Similarity=0.442  Sum_probs=14.0

Q ss_pred             eEEEEeccCCCCcceEe
Q psy9445         155 CTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       155 ~~i~ayG~tgsGKt~Tm  171 (243)
                      ++++..|++|+|||+..
T Consensus       597 ~~~lf~Gp~GvGKT~lA  613 (852)
T TIGR03345       597 GVFLLVGPSGVGKTETA  613 (852)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            46888899999998753


No 495
>PF11406 Tachystatin_A:  Antimicrobial peptide tachystatin A;  InterPro: IPR022717  Tachystatin A contains a cysteine-stabilised triple-stranded beta-sheet and shows features common to membrane-interactive peptides. Tachystatin A is thought to have an antimicrobial activity similar to defensins.Tachystatin A is also a chitin-binding peptide []. ; PDB: 1CIX_A.
Probab=32.29  E-value=10  Score=22.45  Aligned_cols=15  Identities=47%  Similarity=0.975  Sum_probs=8.1

Q ss_pred             HhcCCceEEEEeccC
Q psy9445         149 VLSGYNCTVFAYGQT  163 (243)
Q Consensus       149 ~~~G~n~~i~ayG~t  163 (243)
                      -++||||.|-.||-.
T Consensus         5 qlqgfncvvrsyglp   19 (44)
T PF11406_consen    5 QLQGFNCVVRSYGLP   19 (44)
T ss_dssp             --TTEEE-S--TTS-
T ss_pred             eecccceEEEccCCC
Confidence            378999999999854


No 496
>PRK00625 shikimate kinase; Provisional
Probab=32.21  E-value=21  Score=28.78  Aligned_cols=15  Identities=33%  Similarity=0.439  Sum_probs=12.6

Q ss_pred             EEEEeccCCCCcceE
Q psy9445         156 TVFAYGQTGTGKTFT  170 (243)
Q Consensus       156 ~i~ayG~tgsGKt~T  170 (243)
                      .|+-.|..|||||+.
T Consensus         2 ~I~LiG~pGsGKTT~   16 (173)
T PRK00625          2 QIFLCGLPTVGKTSF   16 (173)
T ss_pred             EEEEECCCCCCHHHH
Confidence            378889999999874


No 497
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=32.19  E-value=16  Score=29.98  Aligned_cols=15  Identities=27%  Similarity=0.525  Sum_probs=12.5

Q ss_pred             EEeccCCCCcceEee
Q psy9445         158 FAYGQTGTGKTFTME  172 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm~  172 (243)
                      .-.|++|+|||..+.
T Consensus        26 ~i~G~nGsGKStll~   40 (197)
T cd03278          26 AIVGPNGSGKSNIID   40 (197)
T ss_pred             EEECCCCCCHHHHHH
Confidence            367999999998774


No 498
>PF02702 KdpD:  Osmosensitive K+ channel His kinase sensor domain;  InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. Signal transducing histidine kinases are the key elements in two-component signal transduction systems, which control complex processes such as the initiation of development in microorganisms [, ]. Examples of histidine kinases are EnvZ, which plays a central role in osmoregulation [], and CheA, which plays a central role in the chemotaxis system []. Histidine kinases usually have an N-terminal ligand-binding domain and a C-terminal kinase domain, but other domains may also be present. The kinase domain is responsible for the autophosphorylation of the histidine with ATP, the phosphotransfer from the kinase to an aspartate of the response regulator, and (with bifunctional enzymes) the phosphotransfer from aspartyl phosphate back to ADP or to water []. The kinase core has a unique fold, distinct from that of the Ser/Thr/Tyr kinase superfamily.  HKs can be roughly divided into two classes: orthodox and hybrid kinases [, ]. Most orthodox HKs, typified by the Escherichia coli EnvZ protein, function as periplasmic membrane receptors and have a signal peptide and transmembrane segment(s) that separate the protein into a periplasmic N-terminal sensing domain and a highly conserved cytoplasmic C-terminal kinase core. Members of this family, however, have an integral membrane sensor domain. Not all orthodox kinases are membrane bound, e.g., the nitrogen regulatory kinase NtrB (GlnL) is a soluble cytoplasmic HK []. Hybrid kinases contain multiple phosphodonor and phosphoacceptor sites and use multi-step phospho-relay schemes instead of promoting a single phosphoryl transfer. In addition to the sensor domain and kinase core, they contain a CheY-like receiver domain and a His-containing phosphotransfer (HPt) domain. This entry represents the N-terminal domain found in KdpD sensor kinase proteins, which regulate the kdpFABC operon responsible for potassium transport []. The N-terminal domain forms part of the cytoplasmic region of the protein, which may be the sensor domain responsible for sensing turgor pressure [].; GO: 0000155 two-component sensor activity, 0004673 protein histidine kinase activity, 0000160 two-component signal transduction system (phosphorelay), 0016020 membrane; PDB: 2R8R_B.
Probab=32.06  E-value=15  Score=30.70  Aligned_cols=19  Identities=37%  Similarity=0.599  Sum_probs=14.0

Q ss_pred             EEEEeccCCCCcceEeecC
Q psy9445         156 TVFAYGQTGTGKTFTMEGE  174 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm~G~  174 (243)
                      .||.--..|.||||.|+-.
T Consensus         7 kIflG~apGVGKTy~ML~e   25 (211)
T PF02702_consen    7 KIFLGAAPGVGKTYAMLQE   25 (211)
T ss_dssp             EEEEESSTTSSHHHHHHHH
T ss_pred             EEEEecCCCCCHHHHHHHH
Confidence            3444457999999999753


No 499
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain. This model represents a clade within a larger family of proteins from viruses of bacteria and animals. Members of this family are found in phage and plasmids of bacteria and archaea only. The model describes a domain of about 300 residues, found generally toward the protein C-terminus.
Probab=32.01  E-value=10  Score=33.34  Aligned_cols=29  Identities=31%  Similarity=0.471  Sum_probs=20.0

Q ss_pred             chhHHHHhcC---CceEEEEeccCCCCcceEe
Q psy9445         143 NPLIDEVLSG---YNCTVFAYGQTGTGKTFTM  171 (243)
Q Consensus       143 ~~~v~~~~~G---~n~~i~ayG~tgsGKt~Tm  171 (243)
                      ..++..++.|   ....++.||..|+|||..+
T Consensus        62 ~~~lg~~L~~~~~~~~~~~l~G~g~nGKStl~   93 (304)
T TIGR01613        62 QRVIGYSLTGNYTEQKLFFLYGNGGNGKSTFQ   93 (304)
T ss_pred             HHHHhHHhcCCCCceEEEEEECCCCCcHHHHH
Confidence            3344445554   4567899999999998654


No 500
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=31.99  E-value=23  Score=27.85  Aligned_cols=16  Identities=38%  Similarity=0.532  Sum_probs=12.9

Q ss_pred             EEEEeccCCCCcceEe
Q psy9445         156 TVFAYGQTGTGKTFTM  171 (243)
Q Consensus       156 ~i~ayG~tgsGKt~Tm  171 (243)
                      .|+-.|..|||||+.-
T Consensus         4 ~i~~~G~~GsGKst~~   19 (171)
T PRK03731          4 PLFLVGARGCGKTTVG   19 (171)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4677899999998754


Done!