Diaphorina citri psyllid: psy9484

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------

MGQLADNETAHQHQELCMALNIDSTTAKEAWNAYKEMSHHYTLEGSQLHWLGCSLYVSCRKATVPTVNSNRTIEGNLVCLTSLLKHCKMSLNQFLNKCRKWADMRKLPDSFRSKIARLERNFAVSKVIFTKYLPMFKEMFKPPDLDELLMHVRHNKKKMIHCTSTKVFEFTWILFVLTKAEYLDVSNDLVNSFHLLIATCDLIYANVIQSKLRDIVNPDFEGMPSNFLDSHFAPLDDPPCIISILCKHHDGCKLCVIVRAEASLSRDIVKHLNLTEEQVLDSLAWVSNSPLWKNIEDSGQEIPGCEQKLRGNIEDLSAILEPENFDYNFKVVNKMYEEYILSVGDFDERIFLPKFQSFDETAPGSSGPGLDDLSPAPAPGGAPPEVDFGIDFTSFRRNLRQKLVPCI

cccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHEEEEEEccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccc

***********QHQELCMALNIDSTTAKEAWNAYKEMSHHYTLEGSQLHWLGCSLYVSCRKATV**********GNLVCLTSLLKHCKMSLNQFLNKCRKWADMRKLPDSFRSKIARLERNFAVSKVIFTKYLPMFKEMFKPPD***************IHCTSTKVFEFTWILFVLTKAEYLDVSNDLVNSFHLLIATCDLIYANVIQSKLRDIVNPDFEGMPSNFLDSHFAPLDDPPCIISILCKHHDGCKLCVIVRAEASLSRDIVKHLNLTEEQVLDSLAWVSNSPLWKNIEDSGQEIPGCEQKLRGNIEDLSAILEPENFDYNFKVVNKMYEEYILSVGDFDERIFLPKFQ*******************************FGIDFTSFR*NLRQKLVPC*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0031981 [CC]	nuclear lumen	probable	GO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0065009 [BP]	regulation of molecular function	probable	GO:0008150, GO:0065007

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ELJ, chain A
Confidence level:very confident
Coverage over the Query: 10-59,72-143,162-224,235-261,290-300,313-357
View the alignment between query and template
View the model in PyMOL

Template: 4ELL, chain A
Confidence level:very confident
Coverage over the Query: 187-238,251-298
View the alignment between query and template
View the model in PyMOL