Query         psy9493
Match_columns 175
No_of_seqs    87 out of 104
Neff          4.5 
Searched_HMMs 46136
Date          Fri Aug 16 20:47:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9493.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9493hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3956|consensus              100.0 1.1E-44 2.4E-49  315.3  12.2  162    4-175    15-181 (359)
  2 PF06400 Alpha-2-MRAP_N:  Alpha 100.0 1.2E-41 2.6E-46  263.6   8.8  110    3-120     3-113 (120)
  3 PF06401 Alpha-2-MRAP_C:  Alpha  99.9 6.3E-26 1.4E-30  191.1   7.8  116   46-175     1-138 (214)
  4 KOG3956|consensus               99.8   1E-19 2.2E-24  159.4  11.0  116   45-175   149-285 (359)
  5 PF06401 Alpha-2-MRAP_C:  Alpha  97.3 0.00046 9.9E-09   59.0   5.1   44   45-88    106-150 (214)
  6 PF06400 Alpha-2-MRAP_N:  Alpha  91.8    0.14   3E-06   40.5   2.6   34  142-175    36-69  (120)
  7 TIGR03798 ocin_TIGR03798 bacte  71.1     6.4 0.00014   26.9   3.4   25  151-175    27-53  (64)
  8 PF07862 Nif11:  Nitrogen fixat  59.3     8.8 0.00019   24.7   2.2   19  151-169    29-49  (49)
  9 PRK02539 hypothetical protein;  39.2      31 0.00068   25.8   2.6   22   49-70      5-27  (85)
 10 PF05979 DUF896:  Bacterial pro  36.9      38 0.00083   24.0   2.7   21   50-70      4-25  (65)
 11 PRK01631 hypothetical protein;  34.5      41 0.00089   24.7   2.6   21   50-70      5-26  (76)
 12 PRK01546 hypothetical protein;  34.2      41  0.0009   24.8   2.6   22   49-70      6-28  (79)
 13 cd08325 CARD_CASP1-like Caspas  31.6      66  0.0014   23.1   3.3   25  150-174    17-42  (83)
 14 PF09968 DUF2202:  Uncharacteri  31.1      66  0.0014   26.6   3.6   42  107-165    44-86  (162)
 15 PF05979 DUF896:  Bacterial pro  30.6      54  0.0012   23.3   2.6   21  149-169     5-25  (65)
 16 PF02787 CPSase_L_D3:  Carbamoy  28.8      68  0.0015   24.9   3.1   20  153-172    63-82  (123)
 17 cd07313 terB_like_2 tellurium   26.5      90  0.0019   22.2   3.3   24  150-173    75-99  (104)
 18 PF06569 DUF1128:  Protein of u  24.8      87  0.0019   22.7   2.9   26  150-175    40-66  (71)
 19 cd07316 terB_like_DjlA N-termi  24.7 1.1E+02  0.0023   21.7   3.4   24  150-173    76-100 (106)
 20 PF14771 DUF4476:  Domain of un  24.1      86  0.0019   22.5   2.8   31  142-172    18-49  (95)
 21 PF01476 LysM:  LysM domain;  I  23.6      99  0.0021   18.5   2.6   20  153-172     8-27  (44)
 22 PF04032 Rpr2:  RNAse P Rpr2/Rp  23.5 1.3E+02  0.0027   20.8   3.5   26   51-76      1-28  (85)
 23 cd08804 Death_ank2 Death domai  23.0      92   0.002   22.5   2.7   20  155-174    18-38  (84)
 24 PF08671 SinI:  Anti-repressor   22.6 1.5E+02  0.0033   17.9   3.2   23  149-171     3-25  (30)
 25 COG5018 KapD Inhibitor of the   22.5      42 0.00091   28.7   1.0   24  144-167   139-164 (210)
 26 PRK01631 hypothetical protein;  22.1      84  0.0018   23.1   2.4   21  149-169     6-26  (76)
 27 PRK02539 hypothetical protein;  22.1      85  0.0018   23.5   2.4   21  149-169     7-27  (85)
 28 cd08318 Death_NMPP84 Death dom  21.7      96  0.0021   22.3   2.6   21  154-174    20-41  (86)
 29 PRK01546 hypothetical protein;  21.6      86  0.0019   23.1   2.3   21  149-169     8-28  (79)
 30 PF04679 DNA_ligase_A_C:  ATP d  20.9      49  0.0011   23.8   1.0   15  161-175    28-42  (97)
 31 PF14440 XOO_2897-deam:  Xantho  20.5 1.1E+02  0.0023   24.0   2.8   32   47-78     43-75  (118)

No 1  
>KOG3956|consensus
Probab=100.00  E-value=1.1e-44  Score=315.31  Aligned_cols=162  Identities=30%  Similarity=0.501  Sum_probs=141.1

Q ss_pred             hhhhhhhhcccCCCCCcchhhhcccccccCCCCCcccccCCCCccchhhhHHHHHHHHccCCHH-HHHHHHHHhhhhHHH
Q psy9493           4 LCVFALLYTVAVSSENIYSRESNVRFKSQLDVEPNIQLRHLDNPFRMGKLNLLWKKAQVRLSEP-KLKSIYNELKIHDKE   82 (175)
Q Consensus         4 ~~~~~~~~~~~~~~~~kys~e~n~~~~~~~~~~~~~~~~~~~~~FR~~KLN~LWeKAq~~fs~~-eL~~L~~ELk~qeK~   82 (175)
                      |.+.++|+|+++.+++|||+|+|.| +|      .|.+.++. ||||+|||+||+|||+++|++ .|++|+.||++||++
T Consensus        15 llll~~G~~~~kkqskKySkEaNdP-ky------dPdfkSiq-pFRmeklN~iweKAq~~~t~p~~La~L~~eLki~d~~   86 (359)
T KOG3956|consen   15 LLLLVIGSAHNKKQSKKYSKEANDP-KY------DPDFKSIQ-PFRMEKLNFIWEKAQQHVTDPQNLARLEKELKIYDAI   86 (359)
T ss_pred             HHHHHhCcccchhhccccchhccCC-CC------Cccccccc-hhHHHHHHHHHHHHHHhcCCHhHHHHHHHHhhhhhHH
Confidence            3445578999999999999999999 63      67777777 999999999999999977775 599999999999999


Q ss_pred             HHHHHhhhhcCCCCCchhHHHHHHHHHHHHHhhccccccchhhccccccccCCC---C-CCCCCCCCCCChhHHHHHHHH
Q psy9493          83 EILFKKVKADGLDPDGQREGILRKRLVGIMSTYGLLEHFEDIQGEKIKLDTDDN---A-PVHKPRAVFKDKKLNKLWEKA  158 (175)
Q Consensus        83 e~~~k~LK~eg~D~dG~kEa~Lr~kl~~Il~kYgL~~~~~~~~~~~~~~h~~l~---d-~~~~~~~~F~DpKl~kLW~kA  158 (175)
                      +++||.|+..+.|.+|+++++|+|+|++||++|||.+++++++++  ..|+.+.   | ....+++.|.||+|++||++|
T Consensus        87 elAwK~lns~~~d~dg~k~d~l~rkL~~Il~kYgL~~~~da~q~t--~k~k~l~~~~d~~e~~~~~~f~D~~L~kLW~kA  164 (359)
T KOG3956|consen   87 ELAWKSLNSRQGDQDGKKIDKLDRKLGKILEKYGLEKAVDAFQET--YKHKNLFQQTDDNEPLPSGKFTDQNLQKLWSKA  164 (359)
T ss_pred             HHHHHHhhhcccCcchHHHHHHHHHHHHHHHHcchhhhhHHHHHH--HhccchhhcccccccCcccccCchhHHHHHHHH
Confidence            999999999999999999999999999999999999998877641  1222222   2 336678899999999999999


Q ss_pred             HhCCCCHHHHHHHhhhC
Q psy9493         159 EHSGFTCKNVKFNNQEL  175 (175)
Q Consensus       159 ~~sgFS~eEL~sLk~EL  175 (175)
                      ++||||.+||.+||.|+
T Consensus       165 ~~sgFs~eEL~~L~~Ef  181 (359)
T KOG3956|consen  165 QNSGFSQEELNALHGEF  181 (359)
T ss_pred             hccCCCHHHHHHHHHHH
Confidence            99999999999999985


No 2  
>PF06400 Alpha-2-MRAP_N:  Alpha-2-macroglobulin RAP, N-terminal domain;  InterPro: IPR009066 The alpha-2-macroglobulin receptor-associated protein (RAP) is a glycoprotein that binds to the alpha-2-macroglobulin receptor, as well as to other members of the low density lipoprotein receptor family (IPR002172 from INTERPRO). RAP acts to inhibit the binding of all know ligands for these receptors, and may prevent receptor aggregation and degradation in the endoplasmic reticulum, thereby acting as a molecular chaperone []. RAP may be under the regulatory control of calmodulin, since it is able to bind calmodulin and be phosphorylated by calmodulin-dependent kinase II (IPR002048 from INTERPRO). RAP is comprised of three domains. Both domains 1 and 3 are involved in binding to the alpha-2-macroglobulin receptor, while domain 1 is also involved in inhibiting the binding of activated alpha-2-macroglobulin (IPR001599 from INTERPRO). Structural studies have revealed the RAP domain 1 to be comprised of a partly opened bundle of three helices, the first one being shorter than the other two.; PDB: 1NRE_A 2P03_A 1OV2_A 1LRE_A 2FYL_A 1OP1_A 2P01_A.
Probab=100.00  E-value=1.2e-41  Score=263.58  Aligned_cols=110  Identities=55%  Similarity=0.811  Sum_probs=70.6

Q ss_pred             hhhhhhhhhcccCCCCCcchhhhcccccccCCCCCcccccCCCCccchhhhHHHHHHHHc-cCCHHHHHHHHHHhhhhHH
Q psy9493           3 ILCVFALLYTVAVSSENIYSRESNVRFKSQLDVEPNIQLRHLDNPFRMGKLNLLWKKAQV-RLSEPKLKSIYNELKIHDK   81 (175)
Q Consensus         3 ~~~~~~~~~~~~~~~~~kys~e~n~~~~~~~~~~~~~~~~~~~~~FR~~KLN~LWeKAq~-~fs~~eL~~L~~ELk~qeK   81 (175)
                      ++|+++++++.++.+++|||||+|++ .       +|++|.++.||||+||||||+||++ +||+++|++||+||++|||
T Consensus         3 ~~~~ll~~~~~~~~~~~KYSre~Ne~-~-------~~~~~~~~~~FRm~KLN~lW~KA~r~~Ls~~kLk~L~~dLKi~dk   74 (120)
T PF06400_consen    3 LLLLLLLFPIAAVKAAGKYSREANEP-K-------PPSFRELDRPFRMAKLNQLWEKAQRLRLSEVKLKSLYSDLKIHDK   74 (120)
T ss_dssp             ----------------------------------------S---SSSSHHHHHHHHHHHHHT--HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhHHHHhccccCHhhCCC-C-------CCccccccccHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHhHH
Confidence            45666777777788899999999987 3       6789999999999999999999997 9999999999999999999


Q ss_pred             HHHHHHhhhhcCCCCCchhHHHHHHHHHHHHHhhccccc
Q psy9493          82 EEILFKKVKADGLDPDGQREGILRKRLVGIMSTYGLLEH  120 (175)
Q Consensus        82 ~e~~~k~LK~eg~D~dG~kEa~Lr~kl~~Il~kYgL~~~  120 (175)
                      +|++||+||++|.|++|++||+||++|++||++|||.++
T Consensus        75 eEl~wKklk~~g~D~dG~kEa~Lrrkl~~Im~kYgL~g~  113 (120)
T PF06400_consen   75 EELAWKKLKAEGKDKDGEKEAELRRKLNVIMSKYGLDGK  113 (120)
T ss_dssp             HHHHHHHHHHHTS-SSSHHHHHHHHHHHHHHHHHTSSSS
T ss_pred             HHHHHHHHhhhCCCccccHHHHHHHHHHHHHHHhCCCCC
Confidence            999999999999999999999999999999999999864


No 3  
>PF06401 Alpha-2-MRAP_C:  Alpha-2-macroglobulin RAP, C-terminal domain ;  InterPro: IPR010483 The alpha-2-macroglobulin receptor-associated protein (RAP) is a intracellular glycoprotein that binds to the 2-macroglobulin receptor and other members of the low density lipoprotein receptor family. The protein inhibits binding of all currently known ligands of these receptors []. Two different studies have provided conflicting domain boundaries.; GO: 0008201 heparin binding, 0050750 low-density lipoprotein particle receptor binding, 0005783 endoplasmic reticulum; PDB: 2FCW_A 2P03_A 2FTU_A 2P01_A.
Probab=99.93  E-value=6.3e-26  Score=191.05  Aligned_cols=116  Identities=21%  Similarity=0.336  Sum_probs=87.6

Q ss_pred             CccchhhhHHHHHHHHc-c-CCHHHHHHHHHHhhh-hHHHHHHHHhhhhcCC------------C-CC------chhHHH
Q psy9493          46 NPFRMGKLNLLWKKAQV-R-LSEPKLKSIYNELKI-HDKEEILFKKVKADGL------------D-PD------GQREGI  103 (175)
Q Consensus        46 ~~FR~~KLN~LWeKAq~-~-fs~~eL~~L~~ELk~-qeK~e~~~k~LK~eg~------------D-~d------G~kEa~  103 (175)
                      +.|.|+|||+||.||++ + ||+++|.+|+.||+| |+|+..|+..|...+.            + ..      ..+.+.
T Consensus         1 ~~F~D~kL~KLW~kA~~sGkFt~eEL~~Lk~Ef~hHqeKi~eY~~LL~~~~~~~~~~~N~i~~~~~~~~k~~~~~~k~~~   80 (214)
T PF06401_consen    1 DLFKDKKLNKLWHKAETSGKFTDEELDKLKEEFQHHQEKIDEYNSLLETLSRTEEIHENSISPNEMNPEKEEQLHEKHNE   80 (214)
T ss_dssp             -SS-SHHHHHHHHHHHHHS---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTSS---S-TTTT-SSSSCHHHHHH
T ss_pred             CCCCChHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccccccCCccccchhHHHHHHHHHHH
Confidence            47999999999999999 7 999999999999999 7788888887755221            1 01      236789


Q ss_pred             HHHHHHHHHHhhccccccchhhccccccccCCCCCCCCCCCCCCChhHHHHHHHHHhCCCCHHHHHHHhhhC
Q psy9493         104 LRKRLVGIMSTYGLLEHFEDIQGEKIKLDTDDNAPVHKPRAVFKDKKLNKLWEKAEHSGFTCKNVKFNNQEL  175 (175)
Q Consensus       104 Lr~kl~~Il~kYgL~~~~~~~~~~~~~~h~~l~d~~~~~~~~F~DpKl~kLW~kA~~sgFS~eEL~sLk~EL  175 (175)
                      ||.+.+.|.+.|+-+..         ..+.     ++.+..+|++|||++||..|++++||++||+||++||
T Consensus        81 Lk~k~r~i~~~~drL~r---------~~~~-----g~~~~~eF~epkV~~LW~~A~~~nFT~~ELeSlkeEL  138 (214)
T PF06401_consen   81 LKEKHREINDGYDRLRR---------VSHQ-----GPNSDKEFIEPKVQGLWKLAQNANFTEDELESLKEEL  138 (214)
T ss_dssp             HHHHHHHHHHHHHHHHH---------HHHT-----SSSSS-SSSSTTHHHHHHHHCTTT--HHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH---------HHhc-----CCCcccccccHHHHHHHHHHHhCCCCHHHHHHHHHHH
Confidence            99999999999977731         1122     2223378999999999999999999999999999997


No 4  
>KOG3956|consensus
Probab=99.81  E-value=1e-19  Score=159.42  Aligned_cols=116  Identities=19%  Similarity=0.281  Sum_probs=88.0

Q ss_pred             CCccchhhhHHHHHHHHc-cCCHHHHHHHHHHhhh-hHHHHHHHHhhhhcCCCCC-------------------chhHHH
Q psy9493          45 DNPFRMGKLNLLWKKAQV-RLSEPKLKSIYNELKI-HDKEEILFKKVKADGLDPD-------------------GQREGI  103 (175)
Q Consensus        45 ~~~FR~~KLN~LWeKAq~-~fs~~eL~~L~~ELk~-qeK~e~~~k~LK~eg~D~d-------------------G~kEa~  103 (175)
                      .+.|.|.+||+||+||++ +||.++|.+|+.||+| ++|...|+..|..-..+++                   +.+.-+
T Consensus       149 ~~~f~D~~L~kLW~kA~~sgFs~eEL~~L~~Ef~hh~~Kv~vY~~lLe~~tv~~~~HEN~I~~~dlsDvneik~h~~~~k  228 (359)
T KOG3956|consen  149 SGKFTDQNLQKLWSKAQNSGFSQEELNALHGEFKHHEQKVRVYEDLLEDFTVKKVPHENSIQHDDLSDVNEIKIHDKTKK  228 (359)
T ss_pred             ccccCchhHHHHHHHHhccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccccCCchhhhhhhhccccchHHH
Confidence            468999999999999999 9999999999999999 5677777777755311211                   123344


Q ss_pred             HHHHHHHHHHhhccccccchhhccccccccCCCCCCCCCCCCCCChhHHHHHHHHHhCCCCHHHHHHHhhhC
Q psy9493         104 LRKRLVGIMSTYGLLEHFEDIQGEKIKLDTDDNAPVHKPRAVFKDKKLNKLWEKAEHSGFTCKNVKFNNQEL  175 (175)
Q Consensus       104 Lr~kl~~Il~kYgL~~~~~~~~~~~~~~h~~l~d~~~~~~~~F~DpKl~kLW~kA~~sgFS~eEL~sLk~EL  175 (175)
                      |..+...|.+.|+-+..             ..  .+++..++|.+|||++||..||.++||+.||++|++||
T Consensus       229 lke~~r~~n~glDrl~R-------------~v--~sg~h~~~F~EPrV~~LW~lAQ~~nlT~kELe~~k~EL  285 (359)
T KOG3956|consen  229 LKEANRELNDGLDRLHR-------------KV--TSGEHFSPFNEPRVKRLWKLAQENNLTPKELEVLKDEL  285 (359)
T ss_pred             HHHHHHHHHhhHHHHHH-------------Hh--ccCCcccccccHHHHHHHHHHHhcCCCHHHHHHHHHHH
Confidence            55555555554433311             00  24567899999999999999999999999999999997


No 5  
>PF06401 Alpha-2-MRAP_C:  Alpha-2-macroglobulin RAP, C-terminal domain ;  InterPro: IPR010483 The alpha-2-macroglobulin receptor-associated protein (RAP) is a intracellular glycoprotein that binds to the 2-macroglobulin receptor and other members of the low density lipoprotein receptor family. The protein inhibits binding of all currently known ligands of these receptors []. Two different studies have provided conflicting domain boundaries.; GO: 0008201 heparin binding, 0050750 low-density lipoprotein particle receptor binding, 0005783 endoplasmic reticulum; PDB: 2FCW_A 2P03_A 2FTU_A 2P01_A.
Probab=97.26  E-value=0.00046  Score=58.95  Aligned_cols=44  Identities=34%  Similarity=0.431  Sum_probs=35.7

Q ss_pred             CCccchhhhHHHHHHHHc-cCCHHHHHHHHHHhhhhHHHHHHHHh
Q psy9493          45 DNPFRMGKLNLLWKKAQV-RLSEPKLKSIYNELKIHDKEEILFKK   88 (175)
Q Consensus        45 ~~~FR~~KLN~LWeKAq~-~fs~~eL~~L~~ELk~qeK~e~~~k~   88 (175)
                      +.+|..+|+..||.-|+. .||+.+|.+|+.||.|.|..-.....
T Consensus       106 ~~eF~epkV~~LW~~A~~~nFT~~ELeSlkeEL~HfE~rl~K~~H  150 (214)
T PF06401_consen  106 DKEFIEPKVQGLWKLAQNANFTEDELESLKEELKHFEKRLEKHRH  150 (214)
T ss_dssp             S-SSSSTTHHHHHHHHCTTT--HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccccHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            478999999999999999 99999999999999998876443333


No 6  
>PF06400 Alpha-2-MRAP_N:  Alpha-2-macroglobulin RAP, N-terminal domain;  InterPro: IPR009066 The alpha-2-macroglobulin receptor-associated protein (RAP) is a glycoprotein that binds to the alpha-2-macroglobulin receptor, as well as to other members of the low density lipoprotein receptor family (IPR002172 from INTERPRO). RAP acts to inhibit the binding of all know ligands for these receptors, and may prevent receptor aggregation and degradation in the endoplasmic reticulum, thereby acting as a molecular chaperone []. RAP may be under the regulatory control of calmodulin, since it is able to bind calmodulin and be phosphorylated by calmodulin-dependent kinase II (IPR002048 from INTERPRO). RAP is comprised of three domains. Both domains 1 and 3 are involved in binding to the alpha-2-macroglobulin receptor, while domain 1 is also involved in inhibiting the binding of activated alpha-2-macroglobulin (IPR001599 from INTERPRO). Structural studies have revealed the RAP domain 1 to be comprised of a partly opened bundle of three helices, the first one being shorter than the other two.; PDB: 1NRE_A 2P03_A 1OV2_A 1LRE_A 2FYL_A 1OP1_A 2P01_A.
Probab=91.83  E-value=0.14  Score=40.46  Aligned_cols=34  Identities=32%  Similarity=0.439  Sum_probs=27.3

Q ss_pred             CCCCCCChhHHHHHHHHHhCCCCHHHHHHHhhhC
Q psy9493         142 PRAVFKDKKLNKLWEKAEHSGFTCKNVKFNNQEL  175 (175)
Q Consensus       142 ~~~~F~DpKl~kLW~kA~~sgFS~eEL~sLk~EL  175 (175)
                      ...+|.=-|||.||.+|+...+|+--|.+|..||
T Consensus        36 ~~~~FRm~KLN~lW~KA~r~~Ls~~kLk~L~~dL   69 (120)
T PF06400_consen   36 LDRPFRMAKLNQLWEKAQRLRLSEVKLKSLYSDL   69 (120)
T ss_dssp             ---SSSSHHHHHHHHHHHHHT--HHHHHHHHHHH
T ss_pred             ccccHHHHHHHHHHHHHHHccCChHHHHHHHHHH
Confidence            4568999999999999999999999999998875


No 7  
>TIGR03798 ocin_TIGR03798 bacteriocin propeptide, TIGR03798 family. This model describes a conserved, fairly long (about 65 residue) propeptide region for a family of putative microcins, that is, bacteriocins of small size. Members of the seed alignment tend to have the Gly-Gly motif as the last two residues of the matched region. This is a cleavage site for a combination processing/export ABC transporter with a peptidase domain.
Probab=71.11  E-value=6.4  Score=26.91  Aligned_cols=25  Identities=28%  Similarity=0.339  Sum_probs=20.3

Q ss_pred             HHHHHHHHHhCC--CCHHHHHHHhhhC
Q psy9493         151 LNKLWEKAEHSG--FTCKNVKFNNQEL  175 (175)
Q Consensus       151 l~kLW~kA~~sg--FS~eEL~sLk~EL  175 (175)
                      .+.++..|+..|  ||.+||.+...||
T Consensus        27 ~e~~~~lA~~~Gf~ft~~el~~~~~el   53 (64)
T TIGR03798        27 PEDRVAIAKEAGFEFTGEDLKEAGEEL   53 (64)
T ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHhhC
Confidence            567899999999  9999998765554


No 8  
>PF07862 Nif11:  Nitrogen fixation protein of unknown function;  InterPro: IPR012903 This domain is found in the cyanobacteria, and the nitrogen-fixing proteobacterium Azotobacter vinelandii and may be involved in nitrogen fixation, but no role has been assigned []. 
Probab=59.27  E-value=8.8  Score=24.70  Aligned_cols=19  Identities=21%  Similarity=0.342  Sum_probs=16.1

Q ss_pred             HHHHHHHHHhCC--CCHHHHH
Q psy9493         151 LNKLWEKAEHSG--FTCKNVK  169 (175)
Q Consensus       151 l~kLW~kA~~sg--FS~eEL~  169 (175)
                      ...++..|+..|  ||.+||.
T Consensus        29 ~~e~~~lA~~~Gy~ft~~el~   49 (49)
T PF07862_consen   29 PEEVVALAREAGYDFTEEELE   49 (49)
T ss_pred             HHHHHHHHHHcCCCCCHHHhC
Confidence            467899999999  9999873


No 9  
>PRK02539 hypothetical protein; Provisional
Probab=39.22  E-value=31  Score=25.81  Aligned_cols=22  Identities=23%  Similarity=0.315  Sum_probs=18.6

Q ss_pred             chhhhHHHHHHHHc-cCCHHHHH
Q psy9493          49 RMGKLNLLWKKAQV-RLSEPKLK   70 (175)
Q Consensus        49 R~~KLN~LWeKAq~-~fs~~eL~   70 (175)
                      .+.|+|-|-.|++. +||++|.+
T Consensus         5 ~I~RINeLakK~K~~gLT~eEk~   27 (85)
T PRK02539          5 KIARINELAKKKKTEGLTGEEKV   27 (85)
T ss_pred             HHHHHHHHHHHhcccCCCHHHHH
Confidence            36899999999999 99996554


No 10 
>PF05979 DUF896:  Bacterial protein of unknown function (DUF896);  InterPro: IPR009242 This family consists of several short, hypothetical bacterial proteins of unknown function. They may be involved in the bacterial SOS response [].; PDB: 2HEP_A 3BHP_C 2JVD_A.
Probab=36.95  E-value=38  Score=24.04  Aligned_cols=21  Identities=29%  Similarity=0.365  Sum_probs=14.6

Q ss_pred             hhhhHHHHHHHHc-cCCHHHHH
Q psy9493          50 MGKLNLLWKKAQV-RLSEPKLK   70 (175)
Q Consensus        50 ~~KLN~LWeKAq~-~fs~~eL~   70 (175)
                      +.|+|-|-.|++. +||++|..
T Consensus         4 i~RINeLa~K~K~~gLT~eE~~   25 (65)
T PF05979_consen    4 IDRINELAKKSKEEGLTEEEKA   25 (65)
T ss_dssp             HHHHHHHHHHHHTT---HHHHH
T ss_pred             HHHHHHHHHHhccCCCCHHHHH
Confidence            5789999999998 99986654


No 11 
>PRK01631 hypothetical protein; Provisional
Probab=34.53  E-value=41  Score=24.68  Aligned_cols=21  Identities=24%  Similarity=0.244  Sum_probs=17.7

Q ss_pred             hhhhHHHHHHHHc-cCCHHHHH
Q psy9493          50 MGKLNLLWKKAQV-RLSEPKLK   70 (175)
Q Consensus        50 ~~KLN~LWeKAq~-~fs~~eL~   70 (175)
                      +.|+|-|-.|++. +||++|.+
T Consensus         5 i~RINeLakK~K~~gLT~eE~~   26 (76)
T PRK01631          5 LFRINELSKKEKATGLTVDEKQ   26 (76)
T ss_pred             HHHHHHHHHHhcccCCCHHHHH
Confidence            5789999999999 99986654


No 12 
>PRK01546 hypothetical protein; Provisional
Probab=34.20  E-value=41  Score=24.81  Aligned_cols=22  Identities=32%  Similarity=0.465  Sum_probs=18.4

Q ss_pred             chhhhHHHHHHHHc-cCCHHHHH
Q psy9493          49 RMGKLNLLWKKAQV-RLSEPKLK   70 (175)
Q Consensus        49 R~~KLN~LWeKAq~-~fs~~eL~   70 (175)
                      .+.|+|-|-.|++. +||++|.+
T Consensus         6 ~i~RINeLakK~K~~gLT~eEk~   28 (79)
T PRK01546          6 LVERINFLAKKAKAEGLTEEEQR   28 (79)
T ss_pred             HHHHHHHHHHhhcccCCCHHHHH
Confidence            36899999999999 99986554


No 13 
>cd08325 CARD_CASP1-like Caspase activation and recruitment domain found in Caspase-1 and related proteins. Caspase activation and recruitment domain (CARD) similar to those found in Caspase-1 (CASP1, ICE) and related proteins, including CARD-only proteins such as ICEBERG or CARD18, INCA (CARD17), CARD16 (COP1, PSEUDO-ICE), CARD8 (DACAR, NDPP1, TUCAN), and CARD12 (NLRC4), as well as ICE-like caspases such as CASP12, CASP5 (ICH-3) and CASP4 (TX, ICH-2). Caspases are aspartate-specific cysteine proteases with functions in apoptosis and immune signaling. CASP1 plays a central role in the cellular response to a wide variety of microbial and non-microbial stimuli, being activated by the inflammasome or the pyroptosome. CARD8 binds itself and the initiator caspase-9, interfering with the binding of APAF-1 and suppressing caspase-9 activation. CARD12 is a Nod-like receptor (NLR) that plays an important role in the innate immune response to Gram-negative bacteria. Caspase-4 (CASP4), -5 (CASP5),
Probab=31.61  E-value=66  Score=23.14  Aligned_cols=25  Identities=12%  Similarity=0.157  Sum_probs=21.8

Q ss_pred             hHHHHHHHHHhCC-CCHHHHHHHhhh
Q psy9493         150 KLNKLWEKAEHSG-FTCKNVKFNNQE  174 (175)
Q Consensus       150 Kl~kLW~kA~~sg-FS~eEL~sLk~E  174 (175)
                      =+++||+-=...+ ||.+|.++++.|
T Consensus        17 ~i~~llD~Ll~~~Vl~~~E~e~i~~~   42 (83)
T cd08325          17 VINGLLDDLLEKNVLNEEEMEKIKEE   42 (83)
T ss_pred             hHHHHHHHHHHcCCCCHHHHHHHHhc
Confidence            4678998889999 999999999875


No 14 
>PF09968 DUF2202:  Uncharacterized protein domain (DUF2202);  InterPro: IPR019243  This domain, found in various hypothetical archaeal proteins, has no known function.; PDB: 3Q4O_A 3Q4Q_A 3Q4R_A 3Q4N_A.
Probab=31.13  E-value=66  Score=26.56  Aligned_cols=42  Identities=21%  Similarity=0.430  Sum_probs=25.9

Q ss_pred             HHHHHHHhhccccccchhhccccccccCCCCCCCCCCCCCCChhHHHHHHHHHhCC-CCH
Q psy9493         107 RLVGIMSTYGLLEHFEDIQGEKIKLDTDDNAPVHKPRAVFKDKKLNKLWEKAEHSG-FTC  165 (175)
Q Consensus       107 kl~~Il~kYgL~~~~~~~~~~~~~~h~~l~d~~~~~~~~F~DpKl~kLW~kA~~sg-FS~  165 (175)
                      .+..+|++||+..-             .    .+.....|.+|.||.|...-...| .|.
T Consensus        44 av~~Ll~kY~l~dP-------------~----~~~~~G~f~~~~lq~LY~~Lv~~G~~S~   86 (162)
T PF09968_consen   44 AVKALLEKYGLEDP-------------V----EGDPVGVFTNPELQELYNQLVEQGSKSL   86 (162)
T ss_dssp             HHHHHHHHTT---S------------------SS-STT--SSHHHHHHHHHHHHHHTS-H
T ss_pred             HHHHHHHHhCCCCC-------------C----ccCCCCCcCcHHHHHHHHHHHHHhhhcH
Confidence            67788999998621             1    112346799999999999888777 553


No 15 
>PF05979 DUF896:  Bacterial protein of unknown function (DUF896);  InterPro: IPR009242 This family consists of several short, hypothetical bacterial proteins of unknown function. They may be involved in the bacterial SOS response [].; PDB: 2HEP_A 3BHP_C 2JVD_A.
Probab=30.57  E-value=54  Score=23.27  Aligned_cols=21  Identities=24%  Similarity=0.427  Sum_probs=15.7

Q ss_pred             hhHHHHHHHHHhCCCCHHHHH
Q psy9493         149 KKLNKLWEKAEHSGFTCKNVK  169 (175)
Q Consensus       149 pKl~kLW~kA~~sgFS~eEL~  169 (175)
                      .|.|.|=+++++.|+|++|..
T Consensus         5 ~RINeLa~K~K~~gLT~eE~~   25 (65)
T PF05979_consen    5 DRINELAKKSKEEGLTEEEKA   25 (65)
T ss_dssp             HHHHHHHHHHHTT---HHHHH
T ss_pred             HHHHHHHHHhccCCCCHHHHH
Confidence            478999999999999999875


No 16 
>PF02787 CPSase_L_D3:  Carbamoyl-phosphate synthetase large chain, oligomerisation domain;  InterPro: IPR005480 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates [, ]. CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate []. The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain []. CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites []. The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein []. The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP []. There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia []. CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains [].  This entry represents the oligomerisation domain found in the large subunit of carbamoyl phosphate synthases as well as in certain other carboxy phsophate domain-containing enzymes.; GO: 0006807 nitrogen compound metabolic process; PDB: 1M6V_C 1CS0_C 1C30_E 1C3O_G 1BXR_A 1T36_E 1A9X_A 1KEE_G 1CE8_A 1JDB_H ....
Probab=28.85  E-value=68  Score=24.87  Aligned_cols=20  Identities=25%  Similarity=0.308  Sum_probs=12.2

Q ss_pred             HHHHHHHhCCCCHHHHHHHh
Q psy9493         153 KLWEKAEHSGFTCKNVKFNN  172 (175)
Q Consensus       153 kLW~kA~~sgFS~eEL~sLk  172 (175)
                      .+...|+.-|||+..+..|+
T Consensus        63 ~~L~~aK~~GFsD~~IA~l~   82 (123)
T PF02787_consen   63 ELLRKAKRLGFSDRQIARLW   82 (123)
T ss_dssp             HHHHHHHHTT--HHHHHHHH
T ss_pred             HHHHHHHHcCCCHHHHHhcc
Confidence            36677777777777776664


No 17 
>cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2. This family includes several uncharacterized bacterial proteins. Protein sequence homology analysis shows they are similar to tellurium resistance protein terB, but the function of this family is unknown.
Probab=26.54  E-value=90  Score=22.23  Aligned_cols=24  Identities=21%  Similarity=0.332  Sum_probs=20.7

Q ss_pred             hHHHHHHHHHhCC-CCHHHHHHHhh
Q psy9493         150 KLNKLWEKAEHSG-FTCKNVKFNNQ  173 (175)
Q Consensus       150 Kl~kLW~kA~~sg-FS~eEL~sLk~  173 (175)
                      -|.-||..|..-| +++.|.+-|++
T Consensus        75 ~l~~L~~vA~ADG~~~~~E~~~l~~   99 (104)
T cd07313          75 LVEALWEVAYADGELDEYEEHLIRR   99 (104)
T ss_pred             HHHHHHHHHHhcCCCCHHHHHHHHH
Confidence            4667999999999 99999988764


No 18 
>PF06569 DUF1128:  Protein of unknown function (DUF1128);  InterPro: IPR009507 This family consists of several short, hypothetical bacterial proteins of unknown function.
Probab=24.81  E-value=87  Score=22.68  Aligned_cols=26  Identities=19%  Similarity=0.340  Sum_probs=22.1

Q ss_pred             hHHHHHHHHHhCC-CCHHHHHHHhhhC
Q psy9493         150 KLNKLWEKAEHSG-FTCKNVKFNNQEL  175 (175)
Q Consensus       150 Kl~kLW~kA~~sg-FS~eEL~sLk~EL  175 (175)
                      -|..||....+-+ ||..|...|=+||
T Consensus        40 dl~diy~~V~~K~~fS~sEm~aI~~EL   66 (71)
T PF06569_consen   40 DLKDIYEMVMSKDSFSPSEMQAIAEEL   66 (71)
T ss_pred             HHHHHHHHHHhccCCCHHHHHHHHHHH
Confidence            3667898888877 9999999998886


No 19 
>cd07316 terB_like_DjlA N-terminal tellurium resistance protein terB-like domain of heat shock DnaJ-like proteins. Tellurium resistance terB-like domain of the DnaJ-like DjlA proteins. This family represents the terB-like domain of DjlA-like proteins, a subgroup of heat shock DnaJ-like proteins.  Escherichia coli DjlA is a type III membrane protein with a small N-terminal transmembrane region and DnaJ-like domain on the extreme C-terminus.  Overproduction has been shown to activate the RcsC pathway, which regulates the production of the capsular exopolysaccharide colanic acid.  The specific function of this domain is unknown.
Probab=24.66  E-value=1.1e+02  Score=21.74  Aligned_cols=24  Identities=17%  Similarity=0.192  Sum_probs=20.8

Q ss_pred             hHHHHHHHHHhCC-CCHHHHHHHhh
Q psy9493         150 KLNKLWEKAEHSG-FTCKNVKFNNQ  173 (175)
Q Consensus       150 Kl~kLW~kA~~sg-FS~eEL~sLk~  173 (175)
                      -|.-||..|..=| +++.|-+-|++
T Consensus        76 ~l~~l~~vA~ADG~~~~~E~~~l~~  100 (106)
T cd07316          76 LLEFLFQIAYADGELSEAERELLRR  100 (106)
T ss_pred             HHHHHHHHHHHcCCCCHHHHHHHHH
Confidence            4677999999999 99999988764


No 20 
>PF14771 DUF4476:  Domain of unknown function (DUF4476)
Probab=24.11  E-value=86  Score=22.52  Aligned_cols=31  Identities=32%  Similarity=0.424  Sum_probs=26.7

Q ss_pred             CCCCCCChhHHHHHHHHHhCC-CCHHHHHHHh
Q psy9493         142 PRAVFKDKKLNKLWEKAEHSG-FTCKNVKFNN  172 (175)
Q Consensus       142 ~~~~F~DpKl~kLW~kA~~sg-FS~eEL~sLk  172 (175)
                      ....|.+.|+.-|...+.+.+ ||..+...|=
T Consensus        18 k~~~fd~dkl~~l~~~~~~~~~~T~~Qv~~il   49 (95)
T PF14771_consen   18 KKESFDSDKLKVLEAAAKTNNCFTCAQVKQIL   49 (95)
T ss_pred             HcCCCcHHHHHHHHHHHhcCCceeHHHHHHHH
Confidence            345799999999999999999 9999987764


No 21 
>PF01476 LysM:  LysM domain;  InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation []. This domain may have a general peptidoglycan binding function.; GO: 0016998 cell wall macromolecule catabolic process; PDB: 2DJP_A 3ZQD_A 1Y7M_B 4A52_A 2L9Y_A 1E0G_A.
Probab=23.65  E-value=99  Score=18.48  Aligned_cols=20  Identities=25%  Similarity=0.443  Sum_probs=16.2

Q ss_pred             HHHHHHHhCCCCHHHHHHHh
Q psy9493         153 KLWEKAEHSGFTCKNVKFNN  172 (175)
Q Consensus       153 kLW~kA~~sgFS~eEL~sLk  172 (175)
                      -||..|+.-|.|.++|.++-
T Consensus         8 tl~~IA~~~~~~~~~l~~~N   27 (44)
T PF01476_consen    8 TLWSIAKRYGISVDELMELN   27 (44)
T ss_dssp             -HHHHHHHTTS-HHHHHHHC
T ss_pred             cHHHHHhhhhhhHhHHHHhc
Confidence            58999999999999998764


No 22 
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=23.52  E-value=1.3e+02  Score=20.84  Aligned_cols=26  Identities=27%  Similarity=0.528  Sum_probs=19.7

Q ss_pred             hhhHHHHHHHH-c-cCCHHHHHHHHHHh
Q psy9493          51 GKLNLLWKKAQ-V-RLSEPKLKSIYNEL   76 (175)
Q Consensus        51 ~KLN~LWeKAq-~-~fs~~eL~~L~~EL   76 (175)
                      .++|.||.-|. . ..+.+.|.+.+...
T Consensus         1 ~Ri~~L~~~a~~~~~~~~~~lsr~y~~~   28 (85)
T PF04032_consen    1 QRINFLYQAAHLLLADGSPSLSRHYMKL   28 (85)
T ss_dssp             HHHHHHHHHHH-HHCCC-HHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhcCCHHHHHHHHHH
Confidence            47999999999 5 77778888776543


No 23 
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=23.02  E-value=92  Score=22.46  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=17.3

Q ss_pred             H-HHHHhCCCCHHHHHHHhhh
Q psy9493         155 W-EKAEHSGFTCKNVKFNNQE  174 (175)
Q Consensus       155 W-~kA~~sgFS~eEL~sLk~E  174 (175)
                      | ..|...|||+.+++.++.+
T Consensus        18 Wk~LAr~Lg~se~dI~~i~~~   38 (84)
T cd08804          18 WTELARELDFTEEQIHQIRIE   38 (84)
T ss_pred             HHHHHHHcCCCHHHHHHHHHH
Confidence            6 5799999999999998765


No 24 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=22.57  E-value=1.5e+02  Score=17.95  Aligned_cols=23  Identities=17%  Similarity=0.287  Sum_probs=15.7

Q ss_pred             hhHHHHHHHHHhCCCCHHHHHHH
Q psy9493         149 KKLNKLWEKAEHSGFTCKNVKFN  171 (175)
Q Consensus       149 pKl~kLW~kA~~sgFS~eEL~sL  171 (175)
                      +-=..|=..|+.+|+|.+|...+
T Consensus         3 ~EW~~Li~eA~~~Gls~eeir~F   25 (30)
T PF08671_consen    3 EEWVELIKEAKESGLSKEEIREF   25 (30)
T ss_dssp             HHHHHHHHHHHHTT--HHHHHHH
T ss_pred             HHHHHHHHHHHHcCCCHHHHHHH
Confidence            33445667899999999998764


No 25 
>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only]
Probab=22.47  E-value=42  Score=28.70  Aligned_cols=24  Identities=38%  Similarity=0.511  Sum_probs=20.3

Q ss_pred             CCCCChhHHHHHHHHHhCC--CCHHH
Q psy9493         144 AVFKDKKLNKLWEKAEHSG--FTCKN  167 (175)
Q Consensus       144 ~~F~DpKl~kLW~kA~~sg--FS~eE  167 (175)
                      ..|.+||+-+||..++..|  |+-.+
T Consensus       139 ~v~~~pr~tgln~ale~~G~sf~G~~  164 (210)
T COG5018         139 NVFGDPRLTGLNKALEEYGDSFTGTH  164 (210)
T ss_pred             HHhcCCccccHHHHHHHhccccCCch
Confidence            4589999999999999999  66444


No 26 
>PRK01631 hypothetical protein; Provisional
Probab=22.13  E-value=84  Score=23.06  Aligned_cols=21  Identities=24%  Similarity=0.422  Sum_probs=18.6

Q ss_pred             hhHHHHHHHHHhCCCCHHHHH
Q psy9493         149 KKLNKLWEKAEHSGFTCKNVK  169 (175)
Q Consensus       149 pKl~kLW~kA~~sgFS~eEL~  169 (175)
                      .|.|-|=+++++.|+|.+|..
T Consensus         6 ~RINeLakK~K~~gLT~eE~~   26 (76)
T PRK01631          6 FRINELSKKEKATGLTVDEKQ   26 (76)
T ss_pred             HHHHHHHHHhcccCCCHHHHH
Confidence            478999999999999999875


No 27 
>PRK02539 hypothetical protein; Provisional
Probab=22.12  E-value=85  Score=23.51  Aligned_cols=21  Identities=24%  Similarity=0.373  Sum_probs=18.5

Q ss_pred             hhHHHHHHHHHhCCCCHHHHH
Q psy9493         149 KKLNKLWEKAEHSGFTCKNVK  169 (175)
Q Consensus       149 pKl~kLW~kA~~sgFS~eEL~  169 (175)
                      .|.|-|-+++++.|+|++|..
T Consensus         7 ~RINeLakK~K~~gLT~eEk~   27 (85)
T PRK02539          7 ARINELAKKKKTEGLTGEEKV   27 (85)
T ss_pred             HHHHHHHHHhcccCCCHHHHH
Confidence            378899999999999999875


No 28 
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=21.66  E-value=96  Score=22.30  Aligned_cols=21  Identities=19%  Similarity=0.321  Sum_probs=17.7

Q ss_pred             HH-HHHHhCCCCHHHHHHHhhh
Q psy9493         154 LW-EKAEHSGFTCKNVKFNNQE  174 (175)
Q Consensus       154 LW-~kA~~sgFS~eEL~sLk~E  174 (175)
                      =| ..|..-|||+.+++.++.+
T Consensus        20 ~Wk~Lar~LGls~~dI~~i~~~   41 (86)
T cd08318          20 DWKTLAPHLEMKDKEIRAIESD   41 (86)
T ss_pred             hHHHHHHHcCCCHHHHHHHHhc
Confidence            37 6799999999999998753


No 29 
>PRK01546 hypothetical protein; Provisional
Probab=21.57  E-value=86  Score=23.14  Aligned_cols=21  Identities=29%  Similarity=0.420  Sum_probs=18.6

Q ss_pred             hhHHHHHHHHHhCCCCHHHHH
Q psy9493         149 KKLNKLWEKAEHSGFTCKNVK  169 (175)
Q Consensus       149 pKl~kLW~kA~~sgFS~eEL~  169 (175)
                      .|.|-|=+++++.|+|.+|..
T Consensus         8 ~RINeLakK~K~~gLT~eEk~   28 (79)
T PRK01546          8 ERINFLAKKAKAEGLTEEEQR   28 (79)
T ss_pred             HHHHHHHHhhcccCCCHHHHH
Confidence            378999999999999999865


No 30 
>PF04679 DNA_ligase_A_C:  ATP dependent DNA ligase C terminal region        ;  InterPro: IPR012309 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalysing the formation of an internucleotide ester bond between phosphate and deoxyribose. It is active during DNA replication, DNA repair and DNA recombination. There are two forms of DNA ligase, one requires ATP (6.5.1.1 from EC), the other NAD (6.5.1.2 from EC), the latter being restricted to eubacteria. Eukaryotic, archaebacterial, viral and some eubacterial DNA ligases are ATP-dependent. The first step in the ligation reaction is the formation of a covalent enzyme-AMP complex. The co-factor ATP is cleaved to pyrophosphate and AMP, with the AMP being covalently joined to a highly conserved lysine residue in the active site of the ligase. The activated AMP residue is then transferred to the 5'phosphate of the nick, before the nick is sealed by phosphodiester-bond formation and AMP elimination [,]. Vertebrate cells encode three well-characterised DNA ligases (DNA ligases I, III and IV), all of which are related in structure and sequence. With the exception of the atypically small PBCV-1 viral enzyme, two regions of primary sequence are common to all members of the family. The catalytic region comprises six conserved sequence motifs (I, III, IIIa, IV, V-VI), motif I includes the lysine residue that is adenylated in the first step of the ligation reaction. The function of the second, less well-conserved region is unknown. When folded, each protein comprises of two distinct sub-domains: a large amino-terminal sub-domain ('domain 1') and a smaller carboxy-terminal sub-domain ('domain 2'). The ATP-binding site of the enzyme lies in the cleft between the two sub-domains. Domain 1 consists of two antiparallel beta sheets flanked by alpha helices, whereas domain 2 consists of a five-stranded beta barrel and a single alpha helix, which form the oligonucleotide-binding fold [, ].  This region is found in many but not all ATP-dependent DNA ligase enzymes (6.5.1.1 from EC). It is thought to constitute part of the catalytic core of ATP dependent DNA ligase []. ; GO: 0003910 DNA ligase (ATP) activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 3RR5_A 2CFM_A 1X9N_A 1VS0_B 3GDE_A 2HIX_A 2HIV_A 3L2P_A 4EQ5_A.
Probab=20.91  E-value=49  Score=23.84  Aligned_cols=15  Identities=20%  Similarity=0.434  Sum_probs=10.1

Q ss_pred             CCCCHHHHHHHhhhC
Q psy9493         161 SGFTCKNVKFNNQEL  175 (175)
Q Consensus       161 sgFS~eEL~sLk~EL  175 (175)
                      +|||++++..|.+.|
T Consensus        28 tG~~~~~~~~l~~~l   42 (97)
T PF04679_consen   28 TGFSDEELRELRERL   42 (97)
T ss_dssp             SS--HHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHh
Confidence            579999998887653


No 31 
>PF14440 XOO_2897-deam:  Xanthomonas XOO_2897-like deaminase
Probab=20.46  E-value=1.1e+02  Score=24.02  Aligned_cols=32  Identities=9%  Similarity=0.160  Sum_probs=25.4

Q ss_pred             ccchhhhHHHHHHHHc-cCCHHHHHHHHHHhhh
Q psy9493          47 PFRMGKLNLLWKKAQV-RLSEPKLKSIYNELKI   78 (175)
Q Consensus        47 ~FR~~KLN~LWeKAq~-~fs~~eL~~L~~ELk~   78 (175)
                      +.++.==-.||..++. .++++++.+||+||.-
T Consensus        43 ~~~~H~E~~il~~l~~~~v~p~~I~elYtEl~P   75 (118)
T PF14440_consen   43 GGKPHSERAILHQLRAHGVPPEQITELYTELEP   75 (118)
T ss_pred             CCCCChHHHHHHHHHHcCCcHHHHHHHHHhccc
Confidence            3444444678888886 9999999999999976


Done!