Diaphorina citri psyllid: psy9496

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26

EGWKSFYRGYVPNLLGIIPYAGIDLAVYETLKNSYFRKHDDDNEAPSVLLLLACGTASSTCGQVCSYPLALVRTRLQAQVLTNVPGAPELTMTSLLRHIIQTEGITGLYRGITPNFLKVAPAVSISYVVYERCRQTLGVNMTPTSPKITLKNSYFRKHDDDNEAPSVLLLLACGTASSTCGQVCSYPLALVRTRLQAQEIDPLKVLKTRLALRKTGEYSSILDAAKKISAREGWKSFYRGYVPNLLGIIPYAGIDLAVY

cccHHcccccHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHcccccHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHccccccccHHHHHHHHHHHHcHHHHcccccHHHHHHccccEEEEEEc

EGWKSFYRGYVPNLLGIIPYAGIDLAVYETLKNSYFRKHDDDNEAPSVLLLLACGTASSTCGQVCSYPLALVRTRLQAQVLTNVPGAPELTMTSLLRHIIQTEGITGLYRGITPNFLKVAPAVSISYVVYERCRQTLGVNMTPTSPKITLKNSYFRK*DDDNEAPSVLLLLACGTASSTCGQVCSYPLALVRTRLQAQEIDP**********RKTGEYSSILDAAKKISAREGWKSFYRGYVPNLLGIIPYAGIDLAVY

xxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable calcium-binding mitochondrial carrier F17E5.2	Calcium-dependent mitochondrial solute carrier.	confident	Q19529
Calcium-binding mitochondrial carrier protein SCaMC-2	Calcium-dependent mitochondrial solute carrier.	confident	Q5XH95
Calcium-binding mitochondrial carrier protein SCaMC-2	Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.	confident	Q0V7M4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0006862 [BP]	nucleotide transport	probable	GO:0015931, GO:0015748, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015215 [MF]	nucleotide transmembrane transporter activity	probable	GO:0022891, GO:0015932, GO:0022892, GO:0005215, GO:1901677, GO:0022857, GO:0003674
GO:0008514 [MF]	organic anion transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 1-140,163-202,213-259
View the alignment between query and template
View the model in PyMOL