Diaphorina citri psyllid: psy9502

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---

MSDKTHVKLVEVESVEWVNRKTYSVIALVLANRESKILLRAAQGLEDWFELLEECTMTSKERRKALRLYGNAFYKDHSSTMGDSDHLTSLSSHVDDWLLSRNPVLCTHPLHYTNNTTRVKYLRQNNFTEVLSQYKLAVVNFYADWCRFCHLLKPVLEETAAIVDTQYPQDNQVVVAQINCDEEPRIRDFFHITKYPTLKIIRNGLATRSEYRSQRTTEALLNFIAEELKDPVMDLEEAPKFNVHDKTLMLGRFNSKNSPEYELFSRVCSTFNHFDVCKCFARFRHAGPPDVTLQTEDHTEAFQGVFERSRLVQWFTEKCVPLVREITYENAEEISEEGRPLLILCHRHGDLTSVAIFKRIVRDTIGQYAQNLSFVTADDLFYQRIFYHHLHLSSDDLPVLRLDDYKHIYRLPSLITLAENPSTLVSIVEDYFSGKLHADYHDGNSEHCDRRRKAELQANVEDVFPIYELETESMFRNLTPSKLRYTLLKKEEL

cccccEEEEEEEcccccccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHcccccccccEEEEcccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEcccccHHHHHccccEEEEEEEccccHHHHHHcHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHcccccccEEEEEEccccccccccccccHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccHHHHHHHcccccccEEEEccccccccccccccHHHHHHHHHHcccccEEEcccccHHHHHHccccEEEEEECcccHHHHHHHHHHHHHHHHHHcccEEEEEECcccHHHHHHHHcccccccccEEEEECccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccc

***KTHVKLVEVESVEWVNRKTYSVIALVLANRESKILLRAAQGLEDWFELLEECTMTSKERRKALRLYGNAFYKD********DHLTSLSSHVDDWLLSRNPVLCTHPLHYTNNTTRVKYLRQNNFTEVLSQYKLAVVNFYADWCRFCHLLKPVLEETAAIVDTQYPQDNQVVVAQINCDEEPRIRDFFHITKYPTLKIIRNGLATRSEYRSQRTTEALLNFIAEELKDPVMDLEEAPKFNVHDKTLMLGRFNSKNSPEYELFSRVCSTFNHFDVCKCFARFRHAGPPDVTLQTEDHTEAFQGVFERSRLVQWFTEKCVPLVREITYENAEEISEEGRPLLILCHRHGDLTSVAIFKRIVRDTIGQYAQNLSFVTADDLFYQRIFYHHLHLSSDDLPVLRLDDYKHIYRLPSLITLAENPSTLVSIVEDYFSGKLHADYHD************ELQANVEDVFPIYELETESMFRNLTPSKLRYTLL*K***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Endoplasmic reticulum resident protein 44	Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum.	confident	Q3T0L2
Endoplasmic reticulum resident protein 44	Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum.	confident	Q9D1Q6
Endoplasmic reticulum resident protein 44	Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum.	confident	Q9BS26

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005788 [CC]	endoplasmic reticulum lumen	probable	GO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0006457 [BP]	protein folding	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006986 [BP]	response to unfolded protein	probable	GO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0009100 [BP]	glycoprotein metabolic process	probable	GO:0044238, GO:0044260, GO:0019538, GO:1901135, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0003756 [MF]	protein disulfide isomerase activity	probable	GO:0016853, GO:0003824, GO:0003674, GO:0016864, GO:0016862, GO:0016860
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0005793 [CC]	endoplasmic reticulum-Golgi intermediate compartment	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 111-435
View the alignment between query and template
View the model in PyMOL

Template: 2R2J, chain A
Confidence level:very confident
Coverage over the Query: 120-235,246-440,468-488
View the alignment between query and template
View the model in PyMOL

Template: 3F8U, chain A
Confidence level:very confident
Coverage over the Query: 16-99,117-437
View the alignment between query and template
View the model in PyMOL