BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9508
         (511 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1WW1|A Chain A, Crystal Structure Of Trnase Z From Thermotoga Maritima
 pdb|1WW1|B Chain B, Crystal Structure Of Trnase Z From Thermotoga Maritima
 pdb|2E7Y|A Chain A, High Resolution Structure Of T. Maritima Trnase Z
 pdb|2E7Y|B Chain B, High Resolution Structure Of T. Maritima Trnase Z
          Length = 280

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 347 IGDRAPVKKPQDNLYPEGEFERPEYPEFQKAERPK---AFKPH-------DNLKPEGDFE 396
           +GDR   +KP D  YPEG     EY EF K   P    +F  H         L+  G F+
Sbjct: 68  MGDR---EKPLDVFYPEGNRAVEEYTEFIKRANPDLRFSFNVHPLKEGERVFLRNAGGFK 124

Query: 397 RPVK 400
           R V+
Sbjct: 125 RYVQ 128


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.136    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,644,064
Number of Sequences: 62578
Number of extensions: 1077307
Number of successful extensions: 1282
Number of sequences better than 100.0: 43
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 42
Number of HSP's that attempted gapping in prelim test: 1183
Number of HSP's gapped (non-prelim): 142
length of query: 511
length of database: 14,973,337
effective HSP length: 103
effective length of query: 408
effective length of database: 8,527,803
effective search space: 3479343624
effective search space used: 3479343624
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 54 (25.4 bits)