Query         psy9508
Match_columns 511
No_of_seqs    83 out of 85
Neff          3.8 
Searched_HMMs 46136
Date          Fri Aug 16 21:19:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9508.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9508hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05217 STOP:  STOP protein;    95.4    0.34 7.3E-06   46.0  12.9   37  420-456   165-204 (215)
  2 PF05217 STOP:  STOP protein;    95.3    0.31 6.7E-06   46.2  12.1   22  331-352   165-187 (215)
  3 PF15373 DUF4601:  Domain of un   5.4 2.3E+03    0.05   24.1   7.7   22  481-502   299-321 (440)
  4 PRK09678 DNA-binding transcrip   3.1 8.7E+02   0.019   20.7   1.9   23    1-23     37-59  (72)
  5 PF06773 Bim_N:  Bim protein N-   2.3 1.2E+03   0.026   18.0   1.6   16  192-207    13-28  (41)
  6 PF15643 Tox-PL-2:  Papain fold   1.9 8.9E+02   0.019   22.1   0.5   11  234-244    78-88  (100)
  7 PF15000 TUSC2:  Tumour suppres   1.8 9.1E+02    0.02   22.5   0.3   42   28-69     47-93  (111)
  8 PF06442 DHFR_2:  R67 dihydrofo   1.6 9.5E+02   0.021   20.6  -0.0   31  185-215    13-54  (78)
  9 PF07193 DUF1408:  Protein of u   1.4 1.5E+03   0.033   19.4   0.9   18   25-42     37-54  (75)
 10 cd00389 microbial_RNases micro   1.1 3.1E+03   0.068   17.1   2.1   28    9-36     39-66  (71)

No 1  
>PF05217 STOP:  STOP protein;  InterPro: IPR007882 Neurons contain abundant subsets of highly stable microtubules that resist de-polymerising conditions such as exposure to the cold. Stable microtubules are thought to be essential for neuronal development, maintenance, and function. STOP is a major factor responsible for the intriguing stability properties of neuronal microtubules and is important for synaptic plasticity. STOPs (for stable tubule only polypeptides) are calmodulin-binding and calmodulin-regulated proteins which, in mammals, are encoded by a single gene but exhibit substantial cell specific variability due to mRNA splicing and alternative promoter use. STOP microtubule stabilising activity has been ascribed to two classes of new bifunctional calmodulin- and microtubule-binding motifs, with distinct microtubule binding properties in vivo. STOPs seem to be restricted to vertebrates and are composed of a conserved domain split by the apparent insertion of variable sequences that are completely unrelated among species [].  N-STOP (for neuronal adult STOP) contains two repeat domains. The central repeat domain is composed of five repeated sequences of 46 amino acids. These sequences are almost completely identical, exhibiting an unusual degree of conservation of the repeat motif, compared to repeated sequences in other microtubule-associated proteins. The carboxy-terminal repeat domain is composed of 28 imperfect repeats of an 11 amino acid consensus sequence. Upstream of the carboxy-terminal repeat domain, rat N-STOP contains a highly basic sequence (called the "KR domain" after its high content in lysine and arginine residues) and a so-called "linker domain" located between the central repeat domain and the KR domain. To date, two splicing variants of STOP, E-STOP and F-STOP, have been characterised in rodents. Knowledge of STOPs function and properties may help in the treatment of neuroleptics in illnesses such as schizophrenia, currently thought to result from synaptic defects [].
Probab=95.43  E-value=0.34  Score=45.99  Aligned_cols=37  Identities=35%  Similarity=0.664  Sum_probs=21.0

Q ss_pred             CCCCccCC-CCCCCCCCCCCCCC--CCCCCCCCCCCcccc
Q psy9508         420 PEGDFEGR-PKDDYGPKVGDRAP--VKKPQDNLYPEGEFE  456 (511)
Q Consensus       420 peG~F~~~-~k~~y~pK~~eRp~--~~kP~DNL~peG~F~  456 (511)
                      +.+.|.+. .+.+|.++.+++..  .++....+.+...|.
T Consensus       165 ~~~pF~~~T~~~~y~~~~~~~~~~~~~~~~~~~~~~~~F~  204 (215)
T PF05217_consen  165 PSGPFDGTTYQSDYQPKQGEPAKSPCKPTSQPPQPSPSFQ  204 (215)
T ss_pred             CCCcccCCccccccCCCCCCcccccccCccCCCCcCcCcc
Confidence            45556332 56788888888777  333344444444444


No 2  
>PF05217 STOP:  STOP protein;  InterPro: IPR007882 Neurons contain abundant subsets of highly stable microtubules that resist de-polymerising conditions such as exposure to the cold. Stable microtubules are thought to be essential for neuronal development, maintenance, and function. STOP is a major factor responsible for the intriguing stability properties of neuronal microtubules and is important for synaptic plasticity. STOPs (for stable tubule only polypeptides) are calmodulin-binding and calmodulin-regulated proteins which, in mammals, are encoded by a single gene but exhibit substantial cell specific variability due to mRNA splicing and alternative promoter use. STOP microtubule stabilising activity has been ascribed to two classes of new bifunctional calmodulin- and microtubule-binding motifs, with distinct microtubule binding properties in vivo. STOPs seem to be restricted to vertebrates and are composed of a conserved domain split by the apparent insertion of variable sequences that are completely unrelated among species [].  N-STOP (for neuronal adult STOP) contains two repeat domains. The central repeat domain is composed of five repeated sequences of 46 amino acids. These sequences are almost completely identical, exhibiting an unusual degree of conservation of the repeat motif, compared to repeated sequences in other microtubule-associated proteins. The carboxy-terminal repeat domain is composed of 28 imperfect repeats of an 11 amino acid consensus sequence. Upstream of the carboxy-terminal repeat domain, rat N-STOP contains a highly basic sequence (called the "KR domain" after its high content in lysine and arginine residues) and a so-called "linker domain" located between the central repeat domain and the KR domain. To date, two splicing variants of STOP, E-STOP and F-STOP, have been characterised in rodents. Knowledge of STOPs function and properties may help in the treatment of neuroleptics in illnesses such as schizophrenia, currently thought to result from synaptic defects [].
Probab=95.25  E-value=0.31  Score=46.21  Aligned_cols=22  Identities=45%  Similarity=0.901  Sum_probs=12.1

Q ss_pred             ccccccC-CCCCCCCCCCCCCCC
Q psy9508         331 PEGEFEG-RPKDDYGPKIGDRAP  352 (511)
Q Consensus       331 pEGef~~-~~k~dy~pk~~eRp~  352 (511)
                      .++.|+. ..+.+|.+..+++..
T Consensus       165 ~~~pF~~~T~~~~y~~~~~~~~~  187 (215)
T PF05217_consen  165 PSGPFDGTTYQSDYQPKQGEPAK  187 (215)
T ss_pred             CCCcccCCccccccCCCCCCccc
Confidence            4455554 245566666666655


No 3  
>PF15373 DUF4601:  Domain of unknown function (DUF4601)
Probab=5.36  E-value=2.3e+03  Score=24.14  Aligned_cols=22  Identities=23%  Similarity=0.126  Sum_probs=12.0

Q ss_pred             CCccccC-CCCCCCccchhhhcc
Q psy9508         481 EGDFERP-VKEKPKQAEKVEAFK  502 (511)
Q Consensus       481 eG~f~~~-~k~~~~paer~~~~~  502 (511)
                      -|.|+.+ -...|.|.+.+..++
T Consensus       299 ~~~ff~TT~~sdy~p~~~~~~~~  321 (440)
T PF15373_consen  299 LGRFFSTTMGSDYCPPEKPRPQK  321 (440)
T ss_pred             ccccccccCCCCcCCCCCcccCc
Confidence            4566554 344667766554333


No 4  
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=3.13  E-value=8.7e+02  Score=20.70  Aligned_cols=23  Identities=22%  Similarity=0.209  Sum_probs=19.1

Q ss_pred             CceeeccceeeeeeCCccccccc
Q psy9508           1 MIFVTSAHEEFTEKTPERVKPQR   23 (511)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~   23 (511)
                      .||++.++..-|++.|.++.|.-
T Consensus        37 ~tF~t~es~s~tis~p~~~~~~~   59 (72)
T PRK09678         37 ATFITYESVQRYIVKPGEVHAVR   59 (72)
T ss_pred             CEEEEEEEEEEEEcCCCCCCCCC
Confidence            37999999999999998876653


No 5  
>PF06773 Bim_N:  Bim protein N-terminus;  InterPro: IPR014771 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  This entry represents the N-terminal region of several mammal specific Bim proteins. The Bim protein is one of the BH3-only proteins, members of the Bcl-2 family that have only one of the Bcl-2 homology regions, BH3.
Probab=2.34  E-value=1.2e+03  Score=18.03  Aligned_cols=16  Identities=31%  Similarity=0.600  Sum_probs=9.9

Q ss_pred             CcccccCCCCCCCCCC
Q psy9508         192 EHQEYKKGERPTAYKP  207 (511)
Q Consensus       192 ek~~y~p~eRp~~vr~  207 (511)
                      |--..+|+|||.+.++
T Consensus        13 EGgqLqp~er~~q~r~   28 (41)
T PF06773_consen   13 EGGQLQPTERPPQLRP   28 (41)
T ss_pred             cccccccccCCcccCc
Confidence            3345567777777665


No 6  
>PF15643 Tox-PL-2:  Papain fold toxin 2
Probab=1.94  E-value=8.9e+02  Score=22.10  Aligned_cols=11  Identities=55%  Similarity=0.534  Sum_probs=8.6

Q ss_pred             cccCCCcCCCC
Q psy9508         234 FKVRDNLKTEG  244 (511)
Q Consensus       234 ~Kp~DNLkpEG  244 (511)
                      -+-.|||+++|
T Consensus        78 ~~VFDNl~p~G   88 (100)
T PF15643_consen   78 EIVFDNLHPEG   88 (100)
T ss_pred             eEEecccCccc
Confidence            45678888888


No 7  
>PF15000 TUSC2:  Tumour suppressor candidate 2
Probab=1.81  E-value=9.1e+02  Score=22.46  Aligned_cols=42  Identities=26%  Similarity=0.362  Sum_probs=25.7

Q ss_pred             cccCCceeeccc--CccccccC---CCcccccCccccCCCCcCCCcc
Q psy9508          28 TKQDGEIYFQTT--SATEFTEH---STTDLRQAQVRHVDNLKTGGTF   69 (511)
Q Consensus        28 ~~~~~~~~~~~~--~~~ef~~~---~~~~eRp~~vr~~DNLkpEG~F   69 (511)
                      +.--|+.|+.+.  -+-||-+.   -.++.|..-.|-..||.|.|..
T Consensus        47 ~tr~sS~y~DeDGdlAhEFYeE~v~~~g~~~~~l~rv~knL~PqG~v   93 (111)
T PF15000_consen   47 FTRRSSMYFDEDGDLAHEFYEEVVTKNGRKRAKLRRVQKNLRPQGIV   93 (111)
T ss_pred             EecCCceeEcCCcchhhhhhhhhhccCCccchhhhhhhhcCCcccee
Confidence            344556666552  22255443   1246677888888999998876


No 8  
>PF06442 DHFR_2:  R67 dihydrofolate reductase;  InterPro: IPR009159 Dihydrofolate reductase (DHFR) (1.5.1.3 from EC) catalyses the NADPH-dependent reduction of dihydrofolate to tetrahydrofolate, an essential step in de novo synthesis both of glycine and of purines and deoxythymidine phosphate (the precursors of DNA synthesis) [], and important also in the conversion of deoxyuridine monophosphate to deoxythymidine monophosphate. Although DHFR is found ubiquitously in prokaryotes and eukaryotes, and is found in all dividing cells, maintaining levels of fully reduced folate coenzymes, the catabolic steps are still not well understood []. Bacterial species possesses distinct DHFR enzymes (based on their pattern of binding diaminoheterocyclic molecules), but mammalian DHFRs are highly similar []. The active site is situated in the N-terminal half of the sequence, which includes a conserved Pro-Trp dipeptide; the tryptophan has been shown [] to be involved in the binding of substrate by the enzyme. Its central role in DNA precursor synthesis, coupled with its inhibition by antagonists such as trimethoprim and methotrexate, which are used as anti-bacterial or anti-cancer agents, has made DHFR a target of anticancer chemotherapy. However, resistance has developed against some drugs, as a result of changes in DHFR itself []. This entry represents a plasmid-encoded DHFR which shows a high level of resistance to the antibiotic trimethoprim. It is a homotetramer with an unusual pore, which contains the active site, passing through the middle of the molecule []. Its structure is unrelated to that of chromosomal DHFRs.; GO: 0004146 dihydrofolate reductase activity, 0042493 response to drug, 0055114 oxidation-reduction process; PDB: 1VIF_A 3SFM_A 2P4T_A 2GQV_A 2RK2_A 2RH2_A 2RK1_A 1VIE_A.
Probab=1.57  E-value=9.5e+02  Score=20.65  Aligned_cols=31  Identities=29%  Similarity=0.560  Sum_probs=10.5

Q ss_pred             CCCcccCCcccccCCCCCCCCCC-----------CCCCCCCC
Q psy9508         185 EGDFERPEHQEYKKGERPTAYKP-----------HDNLKPEG  215 (511)
Q Consensus       185 EG~F~~~ek~~y~p~eRp~~vr~-----------~DNL~pEG  215 (511)
                      .|.|..|+.+.|+-+.|=--++-           +.+|+|||
T Consensus        13 ag~fa~ps~atf~~gdrvrkksgaawqg~vvgwy~t~ltpeg   54 (78)
T PF06442_consen   13 AGQFAFPSNATFGMGDRVRKKSGAAWQGQVVGWYCTKLTPEG   54 (78)
T ss_dssp             --------S-SS-TT-EEEESSSS--EEEEEEEE--SS-SSE
T ss_pred             ccceecccccccccchhhhhcccccccceEeEEEeccccccc
Confidence            68888888888887765433332           66777777


No 9  
>PF07193 DUF1408:  Protein of unknown function (DUF1408);  InterPro: IPR009848 This entry is represented by Bacteriophage bIL285, Orf11. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Lactococcus lactis and related phage proteins of around 75 residues in length. The function of this family is unknown.
Probab=1.42  E-value=1.5e+03  Score=19.39  Aligned_cols=18  Identities=28%  Similarity=0.822  Sum_probs=14.1

Q ss_pred             ccccccCCceeecccCcc
Q psy9508          25 RTWTKQDGEIYFQTTSAT   42 (511)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~   42 (511)
                      ++|-+++|++|+-..+.+
T Consensus        37 ~t~~r~dgs~y~~~r~~~   54 (75)
T PF07193_consen   37 ETWERPDGSMYMTSRKKN   54 (75)
T ss_pred             EEEEcCCCeEEEEEcccc
Confidence            568899999998776543


No 10 
>cd00389 microbial_RNases microbial_RNases. Ribonucleases (RNAses) cleave phosphodiester bonds in RNA and are essential  for both non-specific RNA degradation and for numerous forms of RNA processing. The alignment contains fungal RNases (U2, T1, F1, Th,  Pb, N1, and Ms) and bacterial RNases (barnase, binase, RNase Sa) , the majority of which are guanyl specific and fungal ribotoxins.
Probab=1.12  E-value=3.1e+03  Score=17.08  Aligned_cols=28  Identities=29%  Similarity=0.323  Sum_probs=15.9

Q ss_pred             eeeeeeCCccccccccccccccCCceee
Q psy9508           9 EEFTEKTPERVKPQRRRTWTKQDGEIYF   36 (511)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~   36 (511)
                      ++|+|.+|.--.+--++-+.-.+|++|.
T Consensus        39 ~E~~v~~~g~~~rGa~RIV~~~~g~~y~   66 (71)
T cd00389          39 HEYPVNTPGGGSRGADRVVYGGDGEFYG   66 (71)
T ss_pred             EEeecCCCCCCCCCCCEEEECCCCcEEE
Confidence            5677777763344434445555566664


Done!