Query         psy9511
Match_columns 1301
No_of_seqs    87 out of 89
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 21:24:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9511.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9511hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05217 STOP:  STOP protein;    96.5   0.019 4.1E-07   60.8  10.7  100  380-511   103-207 (215)
  2 PF05217 STOP:  STOP protein;    96.2   0.028 6.1E-07   59.5  10.0   73  251-324    72-145 (215)
  3 PF15373 DUF4601:  Domain of un  42.7 1.1E+02  0.0025   37.6   9.3   48  265-312   205-255 (440)
  4 PF14162 YozD:  YozD-like prote   3.3 3.5E+02  0.0076   24.9  -0.3    9 1289-1297   14-22  (57)
  5 KOG0629|consensus                2.0 8.3E+02   0.018   30.8   0.5   10 1291-1300  103-112 (510)
  6 PF15373 DUF4601:  Domain of un   1.8 7.6E+03    0.16   22.6   8.1   61  960-1020  239-314 (440)
  7 PF15000 TUSC2:  Tumour suppres   1.2 1.5E+03   0.033   23.7   0.6   21  258-278    74-94  (111)
  8 PF02189 ITAM:  Immunoreceptor    1.2 1.4E+03   0.031   17.5   0.3    8 1294-1301    1-8   (21)
  9 PF06773 Bim_N:  Bim protein N-   1.0 3.4E+03   0.073   17.8   1.8   16  222-237    13-28  (41)
 10 KOG1230|consensus                0.9 1.5E+03   0.032   28.7  -0.8   18 1273-1298   85-102 (521)

No 1  
>PF05217 STOP:  STOP protein;  InterPro: IPR007882 Neurons contain abundant subsets of highly stable microtubules that resist de-polymerising conditions such as exposure to the cold. Stable microtubules are thought to be essential for neuronal development, maintenance, and function. STOP is a major factor responsible for the intriguing stability properties of neuronal microtubules and is important for synaptic plasticity. STOPs (for stable tubule only polypeptides) are calmodulin-binding and calmodulin-regulated proteins which, in mammals, are encoded by a single gene but exhibit substantial cell specific variability due to mRNA splicing and alternative promoter use. STOP microtubule stabilising activity has been ascribed to two classes of new bifunctional calmodulin- and microtubule-binding motifs, with distinct microtubule binding properties in vivo. STOPs seem to be restricted to vertebrates and are composed of a conserved domain split by the apparent insertion of variable sequences that are completely unrelated among species [].  N-STOP (for neuronal adult STOP) contains two repeat domains. The central repeat domain is composed of five repeated sequences of 46 amino acids. These sequences are almost completely identical, exhibiting an unusual degree of conservation of the repeat motif, compared to repeated sequences in other microtubule-associated proteins. The carboxy-terminal repeat domain is composed of 28 imperfect repeats of an 11 amino acid consensus sequence. Upstream of the carboxy-terminal repeat domain, rat N-STOP contains a highly basic sequence (called the "KR domain" after its high content in lysine and arginine residues) and a so-called "linker domain" located between the central repeat domain and the KR domain. To date, two splicing variants of STOP, E-STOP and F-STOP, have been characterised in rodents. Knowledge of STOPs function and properties may help in the treatment of neuroleptics in illnesses such as schizophrenia, currently thought to result from synaptic defects [].
Probab=96.48  E-value=0.019  Score=60.76  Aligned_cols=100  Identities=15%  Similarity=0.236  Sum_probs=55.7

Q ss_pred             chhhhhcccccchhhhcccCCCccc-CCceEEeccccccccccCCccccccccccccccCCcceeccCccccccccCCcc
Q psy9511         380 SSETFQAHQIIKKEEIRRREDNLVQ-EGEMIFVTSAHEEFTEKTPERVKPQRRRTWTKQDGEIYFQTTSATEFTEHSTTD  458 (1301)
Q Consensus       380 ~~~~y~~~~~~ER~~~~rp~DNLr~-EGef~~~t~~~~df~~~~~e~~~~~~~~~~~k~eg~~~~~~~~k~~~~~~~~~g  458 (1301)
                      ++++|..|. +.+...+++..+..+ .+-|...|+++.+|+....++++..                             
T Consensus       103 y~~dy~~~~-~~~~~~~kp~~~~~~~~~pF~~~TtYr~~y~~~~~~~~~~~-----------------------------  152 (215)
T PF05217_consen  103 YKSDYPPKP-IPPPPSFKPPNQPTSSDAPFDGETTYRDDYQPWQGQRPKPE-----------------------------  152 (215)
T ss_pred             cccccccCC-CCcccccCCCCCCCCCCCCccccccCccccccCcccccCcc-----------------------------
Confidence            455666543 334455555554444 4667778888888886433221111                             


Q ss_pred             ccccccccC-CCcccCCccCCCC-CCCCCccCCCCCCC--CCCCCCCCCCCCccCCC
Q psy9511         459 LRQAQVRHV-DNLKTGGTFEGKP-KDDYMPVTAERPKQ--QKPKDNLRPEGDFERPT  511 (1301)
Q Consensus       459 ERp~~vrp~-DNL~pEG~Fe~~~-k~dy~p~~aERp~~--kkP~DNL~pEGdFe~~~  511 (1301)
                        +..+.+. -.+.+.+.|++.| +.+|.+..+++..+  ++...++.+...|.+..
T Consensus       153 --~~~~~~~~~~~p~~~pF~~~T~~~~y~~~~~~~~~~~~~~~~~~~~~~~~F~gq~  207 (215)
T PF05217_consen  153 --PKFKPPKETYSPPSGPFDGTTYQSDYQPKQGEPAKSPCKPTSQPPQPSPSFQGQF  207 (215)
T ss_pred             --ccccccccccCCCCCcccCCccccccCCCCCCcccccccCccCCCCcCcCccccc
Confidence              0011111 1234577888776 88999988888873  33344444555555443


No 2  
>PF05217 STOP:  STOP protein;  InterPro: IPR007882 Neurons contain abundant subsets of highly stable microtubules that resist de-polymerising conditions such as exposure to the cold. Stable microtubules are thought to be essential for neuronal development, maintenance, and function. STOP is a major factor responsible for the intriguing stability properties of neuronal microtubules and is important for synaptic plasticity. STOPs (for stable tubule only polypeptides) are calmodulin-binding and calmodulin-regulated proteins which, in mammals, are encoded by a single gene but exhibit substantial cell specific variability due to mRNA splicing and alternative promoter use. STOP microtubule stabilising activity has been ascribed to two classes of new bifunctional calmodulin- and microtubule-binding motifs, with distinct microtubule binding properties in vivo. STOPs seem to be restricted to vertebrates and are composed of a conserved domain split by the apparent insertion of variable sequences that are completely unrelated among species [].  N-STOP (for neuronal adult STOP) contains two repeat domains. The central repeat domain is composed of five repeated sequences of 46 amino acids. These sequences are almost completely identical, exhibiting an unusual degree of conservation of the repeat motif, compared to repeated sequences in other microtubule-associated proteins. The carboxy-terminal repeat domain is composed of 28 imperfect repeats of an 11 amino acid consensus sequence. Upstream of the carboxy-terminal repeat domain, rat N-STOP contains a highly basic sequence (called the "KR domain" after its high content in lysine and arginine residues) and a so-called "linker domain" located between the central repeat domain and the KR domain. To date, two splicing variants of STOP, E-STOP and F-STOP, have been characterised in rodents. Knowledge of STOPs function and properties may help in the treatment of neuroleptics in illnesses such as schizophrenia, currently thought to result from synaptic defects [].
Probab=96.19  E-value=0.028  Score=59.51  Aligned_cols=73  Identities=19%  Similarity=0.289  Sum_probs=40.0

Q ss_pred             CCCCCCCccccccccccCCCcccCCcccccccccccccccccCCCCccccCCCccc-cccccccccccccccccC
Q psy9511         251 SQPLVPLKGERAEIKRYEDHKITGGEFTGITTQQVEFTGELTERPPLIRRNTWTKL-EGEFTSETTSQTEFKRFD  324 (1301)
Q Consensus       251 ~k~y~~~p~ERa~~kRp~DNLkpEGeFe~~t~~~~dy~~~~gERp~~iRp~DnLk~-eGeF~~~T~n~~eF~~y~  324 (1301)
                      +.||...... ...++......+.+.|.++|+++.+|++....+...+++..+..+ .+-|++.|+.+.+|..+.
T Consensus        72 ~~Dy~~~~~~-~~~~~~~~~~~~~~~f~~~Tty~~dy~~~~~~~~~~~kp~~~~~~~~~pF~~~TtYr~~y~~~~  145 (215)
T PF05217_consen   72 RQDYKPWPIP-PPKKPKPQYPPPSGPFDGTTTYKSDYPPKPIPPPPSFKPPNQPTSSDAPFDGETTYRDDYQPWQ  145 (215)
T ss_pred             cccCCCCCcc-cccCccccccccCCCCCCCcccccccccCCCCcccccCCCCCCCCCCCCccccccCccccccCc
Confidence            4455555455 222222233444666666666666666666666666666555333 455666666666665544


No 3  
>PF15373 DUF4601:  Domain of unknown function (DUF4601)
Probab=42.72  E-value=1.1e+02  Score=37.63  Aligned_cols=48  Identities=19%  Similarity=0.094  Sum_probs=30.0

Q ss_pred             cccCCCccc-CCcccccccccccccccccCCCCccccCCC--ccccccccc
Q psy9511         265 KRYEDHKIT-GGEFTGITTQQVEFTGELTERPPLIRRNTW--TKLEGEFTS  312 (1301)
Q Consensus       265 kRp~DNLkp-EGeFe~~t~~~~dy~~~~gERp~~iRp~Dn--Lk~eGeF~~  312 (1301)
                      +-..-|+++ .|-|-..|+.-..|-....|+..+.....+  -+++|+...
T Consensus       205 ~I~~vNi~pGDg~f~~~TT~ae~f~~~~~ep~~l~~~~~~~S~i~~Gd~~P  255 (440)
T PF15373_consen  205 HIHQVNIQPGDGLFHDRTTMAEHFYAREPEPFVLHHDQTPESHIPKGDWDP  255 (440)
T ss_pred             hheeeecccCCccccccccchhhccCCCCCCceeccCCCcccccccCCCCC
Confidence            334567777 777877777666666555576666665443  455666544


No 4  
>PF14162 YozD:  YozD-like protein
Probab=3.35  E-value=3.5e+02  Score=24.94  Aligned_cols=9  Identities=56%  Similarity=1.069  Sum_probs=7.4

Q ss_pred             eeehHHhhh
Q psy9511        1289 FEFFYNQLY 1297 (1301)
Q Consensus      1289 ~~~~~~~~~ 1297 (1301)
                      ++|||++|.
T Consensus        14 AefFy~eL~   22 (57)
T PF14162_consen   14 AEFFYHELV   22 (57)
T ss_pred             HHHHHHHHH
Confidence            689999885


No 5  
>KOG0629|consensus
Probab=2.00  E-value=8.3e+02  Score=30.82  Aligned_cols=10  Identities=70%  Similarity=1.009  Sum_probs=6.5

Q ss_pred             ehHHhhhccC
Q psy9511        1291 FFYNQLYSGL 1300 (1301)
Q Consensus      1291 ~~~~~~~~~~ 1300 (1301)
                      -|+|||++||
T Consensus       103 rffNQl~~gl  112 (510)
T KOG0629|consen  103 RFFNQLSSGL  112 (510)
T ss_pred             cchhhhccCC
Confidence            4667777765


No 6  
>PF15373 DUF4601:  Domain of unknown function (DUF4601)
Probab=1.80  E-value=7.6e+03  Score=22.58  Aligned_cols=61  Identities=18%  Similarity=0.389  Sum_probs=30.7

Q ss_pred             CcCcCCCCCCCCCCCCCC-CCccCcccC--------CCCcccccCCccCCCCCCC-----CCCccCCC-CCCCCCC
Q psy9511         960 QKAERPKAFKPHDNLKPE-GDFERPIKE--------KPKQAERVEPFKLRDNLKP-----EGEFEGRP-KDDYGPK 1020 (1301)
Q Consensus       960 ~paERp~~vr~~DNLkpE-GeF~~~~k~--------~~~~aeRp~~~kp~DNLkp-----EGeF~~~~-k~~~~p~ 1020 (1301)
                      ..-.++....++-|+-|+ |.+.+....        +.-+...-.-++..+|..+     -|.|++++ ..+|.|.
T Consensus       239 ~~~~~~~S~i~~Gd~~Pgp~sl~Tt~~~fy~q~~~~~~pp~~~~~~~~~~ShV~LGep~l~~~ff~TT~~sdy~p~  314 (440)
T PF15373_consen  239 HHDQTPESHIPKGDWDPGPGSLSTTMQFFYGQPPPPTQPPSRHVSHERLQSHVTLGEPKLLGRFFSTTMGSDYCPP  314 (440)
T ss_pred             ccCCCcccccccCCCCCCccccccccceeeeccCcCCCCCCcccccccccCceEecCCccccccccccCCCCcCCC
Confidence            334566666666666665 554443222        1112222233445555543     35566655 7888883


No 7  
>PF15000 TUSC2:  Tumour suppressor candidate 2
Probab=1.25  E-value=1.5e+03  Score=23.74  Aligned_cols=21  Identities=19%  Similarity=0.297  Sum_probs=16.9

Q ss_pred             ccccccccccCCCcccCCccc
Q psy9511         258 KGERAEIKRYEDHKITGGEFT  278 (1301)
Q Consensus       258 p~ERa~~kRp~DNLkpEGeFe  278 (1301)
                      -+.|+.++|-..||+|+|...
T Consensus        74 g~~~~~l~rv~knL~PqG~v~   94 (111)
T PF15000_consen   74 GRKRAKLRRVQKNLRPQGIVK   94 (111)
T ss_pred             CccchhhhhhhhcCCccceee
Confidence            457788999999999998743


No 8  
>PF02189 ITAM:  Immunoreceptor tyrosine-based activation motif;  InterPro: IPR003110 Phosphorylated immunoreceptor signalling motifs (ITAMs) exhibit unique abilities to bind and activate Lyn and Syk tyrosine kinases []. Motif may be dually phosphorylated on tyrosine that links antigen receptors to downstream signalling machinery. ; GO: 0004888 transmembrane signaling receptor activity, 0007166 cell surface receptor linked signaling pathway, 0016020 membrane; PDB: 2K4F_A 1TCE_B 3IOZ_B 3IK5_B 1YGR_D 2OQ1_B 1A81_F 2ROL_B.
Probab=1.23  E-value=1.4e+03  Score=17.53  Aligned_cols=8  Identities=50%  Similarity=0.829  Sum_probs=5.3

Q ss_pred             HhhhccCC
Q psy9511        1294 NQLYSGLH 1301 (1301)
Q Consensus      1294 ~~~~~~~~ 1301 (1301)
                      ||||.+|.
T Consensus         1 d~lYq~L~    8 (21)
T PF02189_consen    1 DQLYQPLR    8 (21)
T ss_dssp             SHHCCTTT
T ss_pred             Cccccccc
Confidence            57777763


No 9  
>PF06773 Bim_N:  Bim protein N-terminus;  InterPro: IPR014771 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  This entry represents the N-terminal region of several mammal specific Bim proteins. The Bim protein is one of the BH3-only proteins, members of the Bcl-2 family that have only one of the Bcl-2 homology regions, BH3.
Probab=0.97  E-value=3.4e+03  Score=17.83  Aligned_cols=16  Identities=44%  Similarity=0.916  Sum_probs=11.6

Q ss_pred             CCCCCCCCCCCCCCCC
Q psy9511         222 EVGKYSPAERPKAVKP  237 (1301)
Q Consensus       222 e~~~~~PaERp~~vrp  237 (1301)
                      |-.+..|+|||.+.++
T Consensus        13 EGgqLqp~er~~q~r~   28 (41)
T PF06773_consen   13 EGGQLQPTERPPQLRP   28 (41)
T ss_pred             cccccccccCCcccCc
Confidence            4556778888887776


No 10 
>KOG1230|consensus
Probab=0.90  E-value=1.5e+03  Score=28.71  Aligned_cols=18  Identities=44%  Similarity=0.772  Sum_probs=0.0

Q ss_pred             CCccccCCCCCCCCCceeehHHhhhc
Q psy9511        1273 EGDFEGRPKDDYGPKTFEFFYNQLYS 1298 (1301)
Q Consensus      1273 eG~f~~~~k~~~~p~~~~~~~~~~~~ 1298 (1301)
                      .|+|+...|.        +|||.||+
T Consensus        85 GGEf~ngqkT--------~vYndLy~  102 (521)
T KOG1230|consen   85 GGEFYNGQKT--------HVYNDLYS  102 (521)
T ss_pred             cceeecceeE--------EEeeeeeE


Done!