Query         psy9526
Match_columns 113
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:52:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9526.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9526hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2834|consensus               17.0      89  0.0019   28.0   1.8   30   80-109   321-350 (510)
  2 cd04376 RhoGAP_ARHGAP6 RhoGAP_  14.6      73  0.0016   23.2   0.6   17   91-107   142-158 (206)
  3 cd04381 RhoGap_RalBP1 RhoGap_R  12.7      88  0.0019   22.0   0.5   17   91-107   142-158 (182)
  4 cd04400 RhoGAP_fBEM3 RhoGAP_fB  10.0 1.2E+02  0.0026   21.4   0.5   15   93-107   152-166 (190)
  5 cd04385 RhoGAP_ARAP RhoGAP_ARA   9.6 1.2E+02  0.0027   21.3   0.5   17   91-107   140-156 (184)
  6 cd04390 RhoGAP_ARHGAP22_24_25    9.4 1.3E+02  0.0028   21.2   0.5   16   91-106   147-162 (199)
  7 cd00159 RhoGAP RhoGAP: GTPase-   9.3 1.4E+02   0.003   19.1   0.6   14   93-106   125-138 (169)
  8 cd04393 RhoGAP_FAM13A1a RhoGAP   9.1 1.4E+02   0.003   21.0   0.5   15   92-106   145-159 (189)
  9 cd04386 RhoGAP_nadrin RhoGAP_n   8.4 1.5E+02  0.0032   21.1   0.5   17   91-107   145-161 (203)
 10 smart00324 RhoGAP GTPase-activ   8.3 1.6E+02  0.0035   19.4   0.6   16   91-106   127-142 (174)

No 1  
>KOG2834|consensus
Probab=17.04  E-value=89  Score=27.96  Aligned_cols=30  Identities=30%  Similarity=0.345  Sum_probs=26.0

Q ss_pred             eEEeeCCCcceeccccchhhhhhhhhhccc
Q psy9526          80 SVVLASPPMSVNYSQNQMSAKAIALVRADQ  109 (113)
Q Consensus        80 svvlasppmsvnysqnqmsakaialvradq  109 (113)
                      .|+-+-.-++|++..-|+|-.++|||+||-
T Consensus       321 ~visg~~~~~V~f~~YQVSnqc~alv~adl  350 (510)
T KOG2834|consen  321 LVISGDLDGEVHFEGYQVSNQCMALVEADL  350 (510)
T ss_pred             EEEecCCCcceeeeeeehhHHHHHHhhhhh
Confidence            355567789999999999999999999985


No 2  
>cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins. ArhGAP6 shows GAP activity towards RhoA, but not towards Cdc42 and Rac1. ArhGAP6 is often deleted in microphthalmia with linear skin defects syndrome (MLS); MLS is a severe X-linked developmental disorder. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=14.62  E-value=73  Score=23.25  Aligned_cols=17  Identities=24%  Similarity=0.298  Sum_probs=13.4

Q ss_pred             eccccchhhhhhhhhhc
Q psy9526          91 NYSQNQMSAKAIALVRA  107 (113)
Q Consensus        91 nysqnqmsakaialvra  107 (113)
                      |++.|+|+++.+|.|=+
T Consensus       142 ~~~~NkM~~~NLAivf~  158 (206)
T cd04376         142 EVSGNKMTSLNLATIFG  158 (206)
T ss_pred             CCCCCCCCHHHHHHHhh
Confidence            45689999999987643


No 3  
>cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin. RalBP1 plays an important role in endocytosis during interphase. During mitosis, RalBP1 transiently associates with the centromere and has been shown to play an essential role in the proper assembly of the mitotic apparatus. RalBP1 is an effector of the Ral GTPase which itself is an effector of Ras. RalBP1 contains a RhoGAP domain, which shows weak activity towards Rac1 and Cdc42, but not towards Ral, and a Ral effector domain binding motif. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low int
Probab=12.65  E-value=88  Score=22.02  Aligned_cols=17  Identities=18%  Similarity=0.303  Sum_probs=13.3

Q ss_pred             eccccchhhhhhhhhhc
Q psy9526          91 NYSQNQMSAKAIALVRA  107 (113)
Q Consensus        91 nysqnqmsakaialvra  107 (113)
                      +-++|+|+++.+|.+=+
T Consensus       142 ~s~~NkM~~~NLAivfa  158 (182)
T cd04381         142 QELETKMNIQNISIVLS  158 (182)
T ss_pred             hCcccCCCHHHHHHHhC
Confidence            44689999999998744


No 4  
>cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins. Bem3 is a GAP protein of Cdc42, and is specifically involved in the control of the initial assembly of the septin ring in yeast bud formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=10.03  E-value=1.2e+02  Score=21.37  Aligned_cols=15  Identities=20%  Similarity=0.410  Sum_probs=12.1

Q ss_pred             cccchhhhhhhhhhc
Q psy9526          93 SQNQMSAKAIALVRA  107 (113)
Q Consensus        93 sqnqmsakaialvra  107 (113)
                      +.|+|+++.+|.+=+
T Consensus       152 ~~NkM~~~NLa~vf~  166 (190)
T cd04400         152 DVNKMNLRNVCIVFS  166 (190)
T ss_pred             cccCCChHHhhhhcC
Confidence            469999999998754


No 5  
>cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs. ARAPs (also known as centaurin deltas) contain, besides the RhoGAP domain, an Arf GAP, ankyrin repeat ras-associating, and PH domains. Since their ArfGAP activity is PIP3-dependent, ARAPs are considered integration points for phosphoinositide, Arf and Rho signaling. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=9.61  E-value=1.2e+02  Score=21.29  Aligned_cols=17  Identities=41%  Similarity=0.487  Sum_probs=12.9

Q ss_pred             eccccchhhhhhhhhhc
Q psy9526          91 NYSQNQMSAKAIALVRA  107 (113)
Q Consensus        91 nysqnqmsakaialvra  107 (113)
                      +-.+|+|+++.+|.+=+
T Consensus       140 ~~~~NkM~~~nLaiv~~  156 (184)
T cd04385         140 HSDENQMSVHNLALVFG  156 (184)
T ss_pred             cccccCCChHHhhhhhc
Confidence            34579999999987643


No 6  
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25:  GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain. ARHGAP25 (KIA0053) has been identified as a GAP for Rac1 and Cdc42. Short isoforms (without the PH domain) of ARHGAP24, called RC-GAP72 and p73RhoGAP, and of ARHGAP22, called p68RacGAP, has been shown to be involved in angiogenesis and endothelial cell capillary formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the r
Probab=9.41  E-value=1.3e+02  Score=21.24  Aligned_cols=16  Identities=44%  Similarity=0.414  Sum_probs=12.5

Q ss_pred             eccccchhhhhhhhhh
Q psy9526          91 NYSQNQMSAKAIALVR  106 (113)
Q Consensus        91 nysqnqmsakaialvr  106 (113)
                      |-..|+|+++.+|.+=
T Consensus       147 ~s~~NkM~~~NLAivf  162 (199)
T cd04390         147 NSSVNKMSVQNLATVF  162 (199)
T ss_pred             hCcccCCCHHHHHHHh
Confidence            4567999999999653


No 7  
>cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases. Small GTPases (G proteins) cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when bound to GDP. The Rho family of small G proteins, which includes Cdc42Hs, activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. G proteins generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude. The RhoGAPs are one of the major classes of regulators of Rho G proteins.
Probab=9.33  E-value=1.4e+02  Score=19.10  Aligned_cols=14  Identities=36%  Similarity=0.482  Sum_probs=11.3

Q ss_pred             cccchhhhhhhhhh
Q psy9526          93 SQNQMSAKAIALVR  106 (113)
Q Consensus        93 sqnqmsakaialvr  106 (113)
                      ++|+|+++.+|.+=
T Consensus       125 ~~n~M~~~nLa~~f  138 (169)
T cd00159         125 EVNKMTASNLAIVF  138 (169)
T ss_pred             cCCCCCHHHHHHHH
Confidence            48999999988654


No 8  
>cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins. The function of FAM13A1a is unknown. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by up several orders of magnitude.
Probab=9.09  E-value=1.4e+02  Score=21.01  Aligned_cols=15  Identities=33%  Similarity=0.399  Sum_probs=11.8

Q ss_pred             ccccchhhhhhhhhh
Q psy9526          92 YSQNQMSAKAIALVR  106 (113)
Q Consensus        92 ysqnqmsakaialvr  106 (113)
                      -++|+|+++.+|.+=
T Consensus       145 s~~NkMt~~nLA~vf  159 (189)
T cd04393         145 HHENRMTAENLAAVF  159 (189)
T ss_pred             ccccCCCHHHhhhhc
Confidence            456999999998763


No 9  
>cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins. Nadrin, also named Rich-1, has been shown to be involved in the regulation of Ca2+-dependent exocytosis in neurons and recently has been implicated in tight junction maintenance in mammalian epithelium. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=8.40  E-value=1.5e+02  Score=21.05  Aligned_cols=17  Identities=41%  Similarity=0.507  Sum_probs=13.0

Q ss_pred             eccccchhhhhhhhhhc
Q psy9526          91 NYSQNQMSAKAIALVRA  107 (113)
Q Consensus        91 nysqnqmsakaialvra  107 (113)
                      |-.+|+|+++++|.+=+
T Consensus       145 ~~~~NkM~~~nLai~fa  161 (203)
T cd04386         145 KSDENKMSPSNIAIVLA  161 (203)
T ss_pred             hccccCCChHHHHHHhc
Confidence            45789999999887643


No 10 
>smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases. GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. etter domain limits and outliers.
Probab=8.34  E-value=1.6e+02  Score=19.43  Aligned_cols=16  Identities=31%  Similarity=0.528  Sum_probs=12.5

Q ss_pred             eccccchhhhhhhhhh
Q psy9526          91 NYSQNQMSAKAIALVR  106 (113)
Q Consensus        91 nysqnqmsakaialvr  106 (113)
                      |-++|+|+++.+|.+=
T Consensus       127 ~~~~n~M~~~nLa~~f  142 (174)
T smart00324      127 HSEENKMTARNLAIVF  142 (174)
T ss_pred             ccccCCCCHHHHHHHH
Confidence            4567999999988753


Done!