Query psy9526
Match_columns 113
No_of_seqs 1 out of 3
Neff 1.0
Searched_HMMs 46136
Date Fri Aug 16 21:52:21 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy9526.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9526hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG2834|consensus 17.0 89 0.0019 28.0 1.8 30 80-109 321-350 (510)
2 cd04376 RhoGAP_ARHGAP6 RhoGAP_ 14.6 73 0.0016 23.2 0.6 17 91-107 142-158 (206)
3 cd04381 RhoGap_RalBP1 RhoGap_R 12.7 88 0.0019 22.0 0.5 17 91-107 142-158 (182)
4 cd04400 RhoGAP_fBEM3 RhoGAP_fB 10.0 1.2E+02 0.0026 21.4 0.5 15 93-107 152-166 (190)
5 cd04385 RhoGAP_ARAP RhoGAP_ARA 9.6 1.2E+02 0.0027 21.3 0.5 17 91-107 140-156 (184)
6 cd04390 RhoGAP_ARHGAP22_24_25 9.4 1.3E+02 0.0028 21.2 0.5 16 91-106 147-162 (199)
7 cd00159 RhoGAP RhoGAP: GTPase- 9.3 1.4E+02 0.003 19.1 0.6 14 93-106 125-138 (169)
8 cd04393 RhoGAP_FAM13A1a RhoGAP 9.1 1.4E+02 0.003 21.0 0.5 15 92-106 145-159 (189)
9 cd04386 RhoGAP_nadrin RhoGAP_n 8.4 1.5E+02 0.0032 21.1 0.5 17 91-107 145-161 (203)
10 smart00324 RhoGAP GTPase-activ 8.3 1.6E+02 0.0035 19.4 0.6 16 91-106 127-142 (174)
No 1
>KOG2834|consensus
Probab=17.04 E-value=89 Score=27.96 Aligned_cols=30 Identities=30% Similarity=0.345 Sum_probs=26.0
Q ss_pred eEEeeCCCcceeccccchhhhhhhhhhccc
Q psy9526 80 SVVLASPPMSVNYSQNQMSAKAIALVRADQ 109 (113)
Q Consensus 80 svvlasppmsvnysqnqmsakaialvradq 109 (113)
.|+-+-.-++|++..-|+|-.++|||+||-
T Consensus 321 ~visg~~~~~V~f~~YQVSnqc~alv~adl 350 (510)
T KOG2834|consen 321 LVISGDLDGEVHFEGYQVSNQCMALVEADL 350 (510)
T ss_pred EEEecCCCcceeeeeeehhHHHHHHhhhhh
Confidence 355567789999999999999999999985
No 2
>cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins. ArhGAP6 shows GAP activity towards RhoA, but not towards Cdc42 and Rac1. ArhGAP6 is often deleted in microphthalmia with linear skin defects syndrome (MLS); MLS is a severe X-linked developmental disorder. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=14.62 E-value=73 Score=23.25 Aligned_cols=17 Identities=24% Similarity=0.298 Sum_probs=13.4
Q ss_pred eccccchhhhhhhhhhc
Q psy9526 91 NYSQNQMSAKAIALVRA 107 (113)
Q Consensus 91 nysqnqmsakaialvra 107 (113)
|++.|+|+++.+|.|=+
T Consensus 142 ~~~~NkM~~~NLAivf~ 158 (206)
T cd04376 142 EVSGNKMTSLNLATIFG 158 (206)
T ss_pred CCCCCCCCHHHHHHHhh
Confidence 45689999999987643
No 3
>cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin. RalBP1 plays an important role in endocytosis during interphase. During mitosis, RalBP1 transiently associates with the centromere and has been shown to play an essential role in the proper assembly of the mitotic apparatus. RalBP1 is an effector of the Ral GTPase which itself is an effector of Ras. RalBP1 contains a RhoGAP domain, which shows weak activity towards Rac1 and Cdc42, but not towards Ral, and a Ral effector domain binding motif. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low int
Probab=12.65 E-value=88 Score=22.02 Aligned_cols=17 Identities=18% Similarity=0.303 Sum_probs=13.3
Q ss_pred eccccchhhhhhhhhhc
Q psy9526 91 NYSQNQMSAKAIALVRA 107 (113)
Q Consensus 91 nysqnqmsakaialvra 107 (113)
+-++|+|+++.+|.+=+
T Consensus 142 ~s~~NkM~~~NLAivfa 158 (182)
T cd04381 142 QELETKMNIQNISIVLS 158 (182)
T ss_pred hCcccCCCHHHHHHHhC
Confidence 44689999999998744
No 4
>cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins. Bem3 is a GAP protein of Cdc42, and is specifically involved in the control of the initial assembly of the septin ring in yeast bud formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=10.03 E-value=1.2e+02 Score=21.37 Aligned_cols=15 Identities=20% Similarity=0.410 Sum_probs=12.1
Q ss_pred cccchhhhhhhhhhc
Q psy9526 93 SQNQMSAKAIALVRA 107 (113)
Q Consensus 93 sqnqmsakaialvra 107 (113)
+.|+|+++.+|.+=+
T Consensus 152 ~~NkM~~~NLa~vf~ 166 (190)
T cd04400 152 DVNKMNLRNVCIVFS 166 (190)
T ss_pred cccCCChHHhhhhcC
Confidence 469999999998754
No 5
>cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs. ARAPs (also known as centaurin deltas) contain, besides the RhoGAP domain, an Arf GAP, ankyrin repeat ras-associating, and PH domains. Since their ArfGAP activity is PIP3-dependent, ARAPs are considered integration points for phosphoinositide, Arf and Rho signaling. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=9.61 E-value=1.2e+02 Score=21.29 Aligned_cols=17 Identities=41% Similarity=0.487 Sum_probs=12.9
Q ss_pred eccccchhhhhhhhhhc
Q psy9526 91 NYSQNQMSAKAIALVRA 107 (113)
Q Consensus 91 nysqnqmsakaialvra 107 (113)
+-.+|+|+++.+|.+=+
T Consensus 140 ~~~~NkM~~~nLaiv~~ 156 (184)
T cd04385 140 HSDENQMSVHNLALVFG 156 (184)
T ss_pred cccccCCChHHhhhhhc
Confidence 34579999999987643
No 6
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain. ARHGAP25 (KIA0053) has been identified as a GAP for Rac1 and Cdc42. Short isoforms (without the PH domain) of ARHGAP24, called RC-GAP72 and p73RhoGAP, and of ARHGAP22, called p68RacGAP, has been shown to be involved in angiogenesis and endothelial cell capillary formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the r
Probab=9.41 E-value=1.3e+02 Score=21.24 Aligned_cols=16 Identities=44% Similarity=0.414 Sum_probs=12.5
Q ss_pred eccccchhhhhhhhhh
Q psy9526 91 NYSQNQMSAKAIALVR 106 (113)
Q Consensus 91 nysqnqmsakaialvr 106 (113)
|-..|+|+++.+|.+=
T Consensus 147 ~s~~NkM~~~NLAivf 162 (199)
T cd04390 147 NSSVNKMSVQNLATVF 162 (199)
T ss_pred hCcccCCCHHHHHHHh
Confidence 4567999999999653
No 7
>cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases. Small GTPases (G proteins) cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when bound to GDP. The Rho family of small G proteins, which includes Cdc42Hs, activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. G proteins generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude. The RhoGAPs are one of the major classes of regulators of Rho G proteins.
Probab=9.33 E-value=1.4e+02 Score=19.10 Aligned_cols=14 Identities=36% Similarity=0.482 Sum_probs=11.3
Q ss_pred cccchhhhhhhhhh
Q psy9526 93 SQNQMSAKAIALVR 106 (113)
Q Consensus 93 sqnqmsakaialvr 106 (113)
++|+|+++.+|.+=
T Consensus 125 ~~n~M~~~nLa~~f 138 (169)
T cd00159 125 EVNKMTASNLAIVF 138 (169)
T ss_pred cCCCCCHHHHHHHH
Confidence 48999999988654
No 8
>cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins. The function of FAM13A1a is unknown. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by up several orders of magnitude.
Probab=9.09 E-value=1.4e+02 Score=21.01 Aligned_cols=15 Identities=33% Similarity=0.399 Sum_probs=11.8
Q ss_pred ccccchhhhhhhhhh
Q psy9526 92 YSQNQMSAKAIALVR 106 (113)
Q Consensus 92 ysqnqmsakaialvr 106 (113)
-++|+|+++.+|.+=
T Consensus 145 s~~NkMt~~nLA~vf 159 (189)
T cd04393 145 HHENRMTAENLAAVF 159 (189)
T ss_pred ccccCCCHHHhhhhc
Confidence 456999999998763
No 9
>cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins. Nadrin, also named Rich-1, has been shown to be involved in the regulation of Ca2+-dependent exocytosis in neurons and recently has been implicated in tight junction maintenance in mammalian epithelium. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=8.40 E-value=1.5e+02 Score=21.05 Aligned_cols=17 Identities=41% Similarity=0.507 Sum_probs=13.0
Q ss_pred eccccchhhhhhhhhhc
Q psy9526 91 NYSQNQMSAKAIALVRA 107 (113)
Q Consensus 91 nysqnqmsakaialvra 107 (113)
|-.+|+|+++++|.+=+
T Consensus 145 ~~~~NkM~~~nLai~fa 161 (203)
T cd04386 145 KSDENKMSPSNIAIVLA 161 (203)
T ss_pred hccccCCChHHHHHHhc
Confidence 45789999999887643
No 10
>smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases. GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. etter domain limits and outliers.
Probab=8.34 E-value=1.6e+02 Score=19.43 Aligned_cols=16 Identities=31% Similarity=0.528 Sum_probs=12.5
Q ss_pred eccccchhhhhhhhhh
Q psy9526 91 NYSQNQMSAKAIALVR 106 (113)
Q Consensus 91 nysqnqmsakaialvr 106 (113)
|-++|+|+++.+|.+=
T Consensus 127 ~~~~n~M~~~nLa~~f 142 (174)
T smart00324 127 HSEENKMTARNLAIVF 142 (174)
T ss_pred ccccCCCCHHHHHHHH
Confidence 4567999999988753
Done!