Diaphorina citri psyllid: psy9540

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----

IHNKDTNKCHHESCGYIIKGGVNKSYILHHPMNPMMIEFDRTTRFGVNMSIRHPCKIFEELHSIFGDDKERCPTFEELQNMPVLDRCIKEVLRMYPPGYIIARRIRREIKIGDYDIPKDATIMNYIYAMHRDPNVYENPDQFNPDRFLPEKFGKYPKYNYQPFAAGNRKCIAYKYAMLQMKIVISTVLRHFKILPSPRYKTIDDLKYEMRVTLT

cccccccHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccHHHHHHHHHcccccccccEEEEEcccEEEccEEcccccEEEEEHHHHccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHccEEECccccccccccEEEEEEEEc

*********HHESCGYIIKGGVNKSYILHHPMNPMMIEFDRTTRFGVNMSIRHPCKIFEELHSIFGDDKERCPTFEELQNMPVLDRCIKEVLRMYPPGYIIARRIRREIKIGDYDIPKDATIMNYIYAMHRDPNVYENPDQFNPDRFLPEKFGKYPKYNYQPFAAGNRKCIAYKYAMLQMKIVISTVLRHFKILPSPRYKTIDDLKYEMRVTLT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009308 [BP]	amine metabolic process	probable	GO:0008150, GO:0071704, GO:0006807, GO:1901564, GO:0008152
GO:0048252 [BP]	lauric acid metabolic process	probable	GO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0044237, GO:0008152, GO:0043436, GO:0044255, GO:0051791, GO:0044281
GO:0043651 [BP]	linoleic acid metabolic process	probable	GO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0043436, GO:0008150, GO:0019752, GO:0008152, GO:0001676, GO:0044255, GO:0033559, GO:0044281
GO:0019369 [BP]	arachidonic acid metabolic process	probable	GO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0008150, GO:0044237, GO:0043436, GO:0001676, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0016709 [MF]	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	probable	GO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901362 [BP]	organic cyclic compound biosynthetic process	probable	GO:1901576, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:1901360
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0006725 [BP]	cellular aromatic compound metabolic process	probable	GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0044249 [BP]	cellular biosynthetic process	probable	GO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0034641 [BP]	cellular nitrogen compound metabolic process	probable	GO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DBG, chain A
Confidence level:very confident
Coverage over the Query: 8-200
View the alignment between query and template
View the model in PyMOL