Diaphorina citri psyllid: psy9546

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----
MLLYIIVNTCTKLVSALHLELDHATPLYVIQIVGRGGLATRELSPGEKPLHNFQTLTSSPLHLKYCFTCKIFRPPRASHCSICDNCVDHFDHHCPWVGNCVGKRNYRFFYAFIVSLSFHIVFVFCCSVAHLSILAEGRLVFDAVRESPTSVLVVAVTFSSVWSVLGLAGFHTYLAASNQTTNEDIKGSFTSRRGRASFNPYSYGNACSNCCNATTSRYSIKTDFVSLVPDRRGVVLPENKTVKHLSDKHRSANNNQGTCKLKMNNLDSVDTVPSYPQIVVNKTDFVSLVPDRRGVVLPENKTVKHLSDKHRSANNNQGTCKLKMNNLDSVDTVPSYPQIVVNKNTHENSQAQFSNSPGDCHRSQVTVPTVHYPMGAESIGLSHMS
cEEEEHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccEEEEccccccEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MLLYIIVNTCTKLVSALHLELDHATPLYVIQIVGRGGLATREL*****PLHNFQTLTSSPLHLKYCFTCKIFRPPRASHCSICDNCVDHFDHHCPWVGNCVGKRNYRFFYAFIVSLSFHIVFVFCCSVAHLSILAEGRLVFDAVRESPTSVLVVAVTFSSVWSVLGLAGFHTYLAASNQTTNEDIKGSFTS*R*RASFNPYSYGNACSNCCNATTSRYSIKTDFVSLVPD***************************************************************GVV****************************************************************************PMGAESIGLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLYIIVNTCTKLVSALHLELDHATPLYVIQIVGRGGLATRELSPGEKPLHNFQTLTSSPLHLKYCFTCKIFRPPRASHCSICDNCVDHFDHHCPWVGNCVGKRNYRFFYAFIVSLSFHIVFVFCCSVAHLSILAEGRLVFDAVRESPTSVLVVAVTFSSVWSVLGLAGFHTYLAASNQTTNEDIKGSFTSRRGRASFNPYSYGNACSNCCNATTSRYSIKTDFVSLVPDRRGVVLPENKTVKHLSDKHRSANNNQGTCKLKMNNLDSVDTVPSYPQIVVNKTDFVSLVPDRRGVVLPENKTVKHLSDKHRSANNNQGTCKLKMNNLDSVDTVPSYPQIVVNKNTHENSQAQFSNSPGDCHRSQVTVPTVHYPMGAESIGLSHMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0016409 [MF]palmitoyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted