Query         psy9556
Match_columns 62
No_of_seqs    101 out of 714
Neff          6.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:39:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9556.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9556hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03028 Dynein_heavy:  Dynein   99.7 5.3E-19 1.1E-23  128.9   2.2   60    1-60    648-707 (707)
  2 PF05166 YcgL:  YcgL domain;  I  51.8      18  0.0004   20.3   2.4   12   33-44     36-47  (74)
  3 COG3100 Uncharacterized protei  50.8      15 0.00033   21.8   2.0   14   19-32     10-23  (103)
  4 KOG2925|consensus               46.1     9.2  0.0002   24.5   0.6   24   33-58     45-68  (167)
  5 cd05792 S1_eIF1AD_like S1_eIF1  44.4      19 0.00042   20.2   1.7   23   37-59     25-47  (78)
  6 PF13995 YebF:  YebF-like prote  38.7      68  0.0015   18.6   3.4   38    2-41     44-81  (89)
  7 PHA02782 hypothetical protein;  30.5 1.9E+02  0.0042   21.6   5.4   48    1-53    429-485 (503)
  8 cd08684 C2A_Tac2-N C2 domain f  28.1       5 0.00011   23.9  -2.5    8   25-32     37-44  (103)
  9 PF14709 DND1_DSRM:  double str  26.0      96  0.0021   17.1   2.6   33   21-53     17-56  (80)
 10 PF14952 zf-tcix:  Putative tre  25.8      22 0.00048   18.1  -0.0   11   46-56      2-12  (44)
 11 PRK10113 cell division modulat  24.9      27 0.00058   19.6   0.2   13   47-59     34-48  (80)
 12 PF10287 DUF2401:  Putative TOS  24.4      59  0.0013   22.1   1.8   33   21-53     82-130 (235)
 13 PRK13680 hypothetical protein;  24.1 1.8E+02  0.0039   17.7   4.2   39    2-42     70-108 (117)
 14 PRK02220 4-oxalocrotonate taut  23.6      59  0.0013   16.3   1.4   13   44-56     45-57  (61)
 15 PF14260 zf-C4pol:  C4-type zin  23.6      25 0.00054   18.8  -0.1   12   16-27     60-71  (73)
 16 PF07351 DUF1480:  Protein of u  23.4      42 0.00091   19.2   0.8   10   44-53     69-78  (80)
 17 TIGR03488 cas_Cas5p CRISPR-ass  22.9      36 0.00078   22.6   0.5   11   16-26    196-206 (237)
 18 PF09888 DUF2115:  Uncharacteri  22.9      43 0.00093   21.2   0.8   15   16-30    134-148 (163)
 19 COG3506 Uncharacterized conser  21.0      92   0.002   20.4   2.1   24   33-56     54-90  (189)

No 1  
>PF03028 Dynein_heavy:  Dynein heavy chain and region D6 of dynein motor;  InterPro: IPR004273 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.  Dynein is composed of a number of ATP-binding large subunits, intermediate size subunits and small subunits (see IPR001372 from INTERPRO). This family represents the C-terminal region of dynein heavy chain. The dynein heavy chain also exhibits ATPase activity and microtubule binding ability and acts as a motor for the movement of organelles and vesicles along microtubules. ; GO: 0003777 microtubule motor activity, 0007018 microtubule-based movement, 0030286 dynein complex; PDB: 3VKG_A 3VKH_C 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=99.74  E-value=5.3e-19  Score=128.93  Aligned_cols=60  Identities=42%  Similarity=0.873  Sum_probs=42.3

Q ss_pred             CceEEEEeeecCCCCCCCeEEeeceeeccCCCcceEEEEEecCCCCCchheeeheeeccc
Q psy9556           1 MPVIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETDNNPRHWTLRGVALLCD   60 (62)
Q Consensus         1 ~Pvi~~~p~~~~~~~~~~~Y~cPvY~t~~R~~~~~v~~~~L~t~~~p~~Wi~rGvAll~~   60 (62)
                      ||++|++|++.......+.|+||||+|+.|+++|||++++||+++++++||+|||||+||
T Consensus       648 ~pv~~~~~~~~~~~~~~~~y~~PvY~~~~R~~~~~v~~l~l~~~~~~~~Wi~rGvAl~lq  707 (707)
T PF03028_consen  648 MPVIWLKPVQASPQSSDNSYECPVYKTSSREGLNFVFSLPLPTDEDPDHWILRGVALLLQ  707 (707)
T ss_dssp             EEEE-EE-----TTCGGCSEEEEEESSTT--S--EEEEEEE-B-T-HHHHHTTT-EEES-
T ss_pred             CceeEeccccccccCCCCEEECCceecCcCCCCeEEEEEEcCCCCCHHHHHHHhHHHhcC
Confidence            699999999875566778999999999999999999999999999999999999999997


No 2  
>PF05166 YcgL:  YcgL domain;  InterPro: IPR007840 This family of proteins formerly called DUF709 includes the Escherichia coli gene ycgL. Homologues of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure []. The proteins in this entry are functionally uncharacterised.; PDB: 2H7A_A.
Probab=51.81  E-value=18  Score=20.25  Aligned_cols=12  Identities=8%  Similarity=0.393  Sum_probs=7.2

Q ss_pred             cceEEEEEecCC
Q psy9556          33 LKYVGSIDFETD   44 (62)
Q Consensus        33 ~~~v~~~~L~t~   44 (62)
                      ..||+.++|..+
T Consensus        36 p~~vm~l~L~~~   47 (74)
T PF05166_consen   36 PQFVMELNLTPE   47 (74)
T ss_dssp             EEEEEEE-SSS-
T ss_pred             CeEEEEecCCCC
Confidence            368888887654


No 3  
>COG3100 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.82  E-value=15  Score=21.82  Aligned_cols=14  Identities=29%  Similarity=0.790  Sum_probs=11.1

Q ss_pred             eEEeeceeeccCCC
Q psy9556          19 LYECPIYRKPQRTD   32 (62)
Q Consensus        19 ~Y~cPvY~t~~R~~   32 (62)
                      .--|-+|+.+.|.|
T Consensus        10 ~mlCaIYkS~kk~~   23 (103)
T COG3100          10 SMLCAIYKSPKKDG   23 (103)
T ss_pred             eeeeeeeecCcCCc
Confidence            35699999998875


No 4  
>KOG2925|consensus
Probab=46.14  E-value=9.2  Score=24.54  Aligned_cols=24  Identities=17%  Similarity=0.243  Sum_probs=17.4

Q ss_pred             cceEEEEEecCCCCCchheeeheeec
Q psy9556          33 LKYVGSIDFETDNNPRHWTLRGVALL   58 (62)
Q Consensus        33 ~~~v~~~~L~t~~~p~~Wi~rGvAll   58 (62)
                      -+|+.+  +|++-..+.||.||--++
T Consensus        45 q~~lvs--mP~KfRksiWiRRg~Fvv   68 (167)
T KOG2925|consen   45 QNSLVS--MPAKFRKSIWIRRGSFVV   68 (167)
T ss_pred             ceeeee--CCHhhhhceEEeeCCEEE
Confidence            456554  788878889999986544


No 5  
>cd05792 S1_eIF1AD_like S1_eIF1AD_like: eukaryotic translation initiation factor 1A domain containing protein (eIF1AD)-like, S1-like RNA-binding domain. eIF1AD is also known as MGC11102 protein. Little is known about the function of eIF1AD. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins, including translation initiation factor IF1A (also referred to as eIF1A in eukaryotes). eIF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors.
Probab=44.43  E-value=19  Score=20.24  Aligned_cols=23  Identities=22%  Similarity=0.287  Sum_probs=17.9

Q ss_pred             EEEEecCCCCCchheeeheeecc
Q psy9556          37 GSIDFETDNNPRHWTLRGVALLC   59 (62)
Q Consensus        37 ~~~~L~t~~~p~~Wi~rGvAll~   59 (62)
                      +.+.||+.-....||+||--.+.
T Consensus        25 ~l~~iP~KfRk~iWIkrGd~VlV   47 (78)
T cd05792          25 YLVSMPTKFRKNIWIKRGDFVLV   47 (78)
T ss_pred             EEEEechhhcccEEEEeCCEEEE
Confidence            44668888888999999876654


No 6  
>PF13995 YebF:  YebF-like protein; PDB: 2LQV_A 2XGL_A 4AEQ_A.
Probab=38.72  E-value=68  Score=18.61  Aligned_cols=38  Identities=24%  Similarity=0.427  Sum_probs=23.8

Q ss_pred             ceEEEEeeecCCCCCCCeEEeeceeeccCCCcceEEEEEe
Q psy9556           2 PVIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDF   41 (62)
Q Consensus         2 Pvi~~~p~~~~~~~~~~~Y~cPvY~t~~R~~~~~v~~~~L   41 (62)
                      ||++|.+...  ....+.|.-|+=....+++..|...++-
T Consensus        44 PV~wvn~~~i--~~~~~~~~VpltvrG~k~d~~Y~v~vdC   81 (89)
T PF13995_consen   44 PVAWVNANDI--TGDDDTYQVPLTVRGPKGDKHYQVMVDC   81 (89)
T ss_dssp             -EEE--GGG---CCCTTEEEEEEEECSSS-EEEEEEEEET
T ss_pred             CeEEEccccc--cccCCeEEEEEEEEcCCCcEEEEEEEEc
Confidence            8888887554  3567899999877666666677766654


No 7  
>PHA02782 hypothetical protein; Provisional
Probab=30.51  E-value=1.9e+02  Score=21.65  Aligned_cols=48  Identities=19%  Similarity=0.427  Sum_probs=29.9

Q ss_pred             CceEEEEeeecCCCCCCCeEEeeceeeccCCC---cceEEEEEecC------CCCCchheee
Q psy9556           1 MPVIYIYAINTTAGKDPKLYECPIYRKPQRTD---LKYVGSIDFET------DNNPRHWTLR   53 (62)
Q Consensus         1 ~Pvi~~~p~~~~~~~~~~~Y~cPvY~t~~R~~---~~~v~~~~L~t------~~~p~~Wi~r   53 (62)
                      |||.||.- ++    .+=.|.|=+-.--+.+.   -.||..++...      .+.|+-|+.+
T Consensus       429 LPV~HFC~-eK----~kIkYt~KfieVy~~G~l~~~GYVCaIKVErFCCAVFAe~PeSW~Vk  485 (503)
T PHA02782        429 LRVVHFCE-KK----EDIKYACRFIKVYKPGEETTSTYVCAIKVERCCCAVFADWPESWYMD  485 (503)
T ss_pred             CCeeEeec-cC----CccceEEEEEEEecCCcccceeEEEEEEecceeEEEEcCCCceeEEc
Confidence            79999973 21    22347775444333332   25888888763      5678889876


No 8  
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus). Tac2-N contains two C2 domains and a short C-terminus including a WHXL motif, which are key in stabilizing transport vesicles to the plasma membrane by binding to a plasma membrane.  However unlike the usual carboxyl-terminal-type (C-type) tandem C2 proteins, it lacks a transmembrane domain, a Slp-homology domain, and a Munc13-1-interacting domain. Homology search analysis indicate that no known protein motifs are located in its N-terminus, making Tac2-N a novel class of Ca2+-independent, C-type tandem C2 proteins. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphos
Probab=28.06  E-value=5  Score=23.85  Aligned_cols=8  Identities=0%  Similarity=0.451  Sum_probs=6.2

Q ss_pred             eeeccCCC
Q psy9556          25 YRKPQRTD   32 (62)
Q Consensus        25 Y~t~~R~~   32 (62)
                      +||+.|+|
T Consensus        37 ~KsS~rrg   44 (103)
T cd08684          37 FKSSAKEG   44 (103)
T ss_pred             ccchhhcC
Confidence            57888887


No 9  
>PF14709 DND1_DSRM:  double strand RNA binding domain from DEAD END PROTEIN 1
Probab=26.00  E-value=96  Score=17.07  Aligned_cols=33  Identities=9%  Similarity=0.089  Sum_probs=22.2

Q ss_pred             EeeceeeccCCC----cceEEEEEecCCCCC---chheee
Q psy9556          21 ECPIYRKPQRTD----LKYVGSIDFETDNNP---RHWTLR   53 (62)
Q Consensus        21 ~cPvY~t~~R~~----~~~v~~~~L~t~~~p---~~Wi~r   53 (62)
                      .-|+|......|    ..|++.|.+|....+   ..|+.-
T Consensus        17 ~~P~y~l~~~~Gp~~~~~F~ykV~i~~~~~~~~~~~~~~~   56 (80)
T PF14709_consen   17 GPPVYELVSESGPDHRKLFLYKVVIPGLEYPFEGSIECFG   56 (80)
T ss_pred             CCCeEEEEeccCCCccEEEEEEEEEcCCCCCCcceEEEcc
Confidence            457888765555    469999999987654   345543


No 10 
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=25.79  E-value=22  Score=18.14  Aligned_cols=11  Identities=36%  Similarity=0.450  Sum_probs=7.8

Q ss_pred             CCchheeehee
Q psy9556          46 NPRHWTLRGVA   56 (62)
Q Consensus        46 ~p~~Wi~rGvA   56 (62)
                      ...+|++||+-
T Consensus         2 ~l~k~TlRGir   12 (44)
T PF14952_consen    2 DLGKPTLRGIR   12 (44)
T ss_pred             CcchhhHhccc
Confidence            35678888863


No 11 
>PRK10113 cell division modulator; Provisional
Probab=24.90  E-value=27  Score=19.63  Aligned_cols=13  Identities=46%  Similarity=0.866  Sum_probs=8.9

Q ss_pred             Cchheeeh--eeecc
Q psy9556          47 PRHWTLRG--VALLC   59 (62)
Q Consensus        47 p~~Wi~rG--vAll~   59 (62)
                      .+-|++||  ||.++
T Consensus        34 rDVW~LrGKYVAFvl   48 (80)
T PRK10113         34 RDVWMLRGKYVAFVL   48 (80)
T ss_pred             hhhheeccceEEEEE
Confidence            45699998  55544


No 12 
>PF10287 DUF2401:  Putative TOS1-like glycosyl hydrolase (DUF2401);  InterPro: IPR018805  This entry represents a family of proteins conserved primarily in fungi. One member is annotated putatively as OPEL, a house-keeping protein, but this could not be confirmed. It contains 5 highly conserved cysteines two of which form a characteristic CGC sequence motif. 
Probab=24.39  E-value=59  Score=22.05  Aligned_cols=33  Identities=21%  Similarity=0.552  Sum_probs=22.6

Q ss_pred             Eeeceee--ccCCC-----cceEEEEEecCC---------CCCchheee
Q psy9556          21 ECPIYRK--PQRTD-----LKYVGSIDFETD---------NNPRHWTLR   53 (62)
Q Consensus        21 ~cPvY~t--~~R~~-----~~~v~~~~L~t~---------~~p~~Wi~r   53 (62)
                      .|.+|+.  +...|     .-|+|.+.+|+.         +-|..|+|-
T Consensus        82 ~CG~yR~g~~AyhGf~G~~K~Flfef~MP~~~~~~~~~~~DmPAIWlLN  130 (235)
T PF10287_consen   82 DCGYYRPGIPAYHGFGGTTKMFLFEFSMPHETDGGSGFNYDMPAIWLLN  130 (235)
T ss_pred             CcccCcCCchhhccCCCCceEEEEEEECCCCcCCCCCCCCCcChhHhcc
Confidence            7888874  33333     359999999983         236789773


No 13 
>PRK13680 hypothetical protein; Provisional
Probab=24.08  E-value=1.8e+02  Score=17.74  Aligned_cols=39  Identities=15%  Similarity=0.389  Sum_probs=27.6

Q ss_pred             ceEEEEeeecCCCCCCCeEEeeceeeccCCCcceEEEEEec
Q psy9556           2 PVIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFE   42 (62)
Q Consensus         2 Pvi~~~p~~~~~~~~~~~Y~cPvY~t~~R~~~~~v~~~~L~   42 (62)
                      ||+||.+...  ....+.|+-|+=....+++..|-..++-.
T Consensus        70 PVaWin~~~i--tg~~~~~~VPltVRG~k~d~~Y~V~vdC~  108 (117)
T PRK13680         70 PVAWVNVQDI--TGKDDKWQVPLTVRGKSADIHYQVVVDCK  108 (117)
T ss_pred             CeEEEccccc--ccccceEEEEEEEecccCceEEEEEEEcc
Confidence            7888887544  34667899999887777776676555543


No 14 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=23.59  E-value=59  Score=16.29  Aligned_cols=13  Identities=15%  Similarity=0.434  Sum_probs=9.9

Q ss_pred             CCCCchheeehee
Q psy9556          44 DNNPRHWTLRGVA   56 (62)
Q Consensus        44 ~~~p~~Wi~rGvA   56 (62)
                      +.++++|-..|.-
T Consensus        45 e~~~~~~~~gG~~   57 (61)
T PRK02220         45 EMSKNHYAVGGKR   57 (61)
T ss_pred             EeChhHeEECCEE
Confidence            5677889988864


No 15 
>PF14260 zf-C4pol:  C4-type zinc-finger of DNA polymerase delta
Probab=23.55  E-value=25  Score=18.75  Aligned_cols=12  Identities=17%  Similarity=0.761  Sum_probs=8.9

Q ss_pred             CCCeEEeeceee
Q psy9556          16 DPKLYECPIYRK   27 (62)
Q Consensus        16 ~~~~Y~cPvY~t   27 (62)
                      .-..++||||..
T Consensus        60 ~C~s~DCpV~Y~   71 (73)
T PF14260_consen   60 ECDSLDCPVFYE   71 (73)
T ss_pred             cccCCCCCccee
Confidence            345689999975


No 16 
>PF07351 DUF1480:  Protein of unknown function (DUF1480);  InterPro: IPR009950 This family consists of several hypothetical Enterobacterial proteins of around 80 residues in length. The function of this family is unknown.
Probab=23.36  E-value=42  Score=19.16  Aligned_cols=10  Identities=30%  Similarity=0.886  Sum_probs=7.4

Q ss_pred             CCCCchheee
Q psy9556          44 DNNPRHWTLR   53 (62)
Q Consensus        44 ~~~p~~Wi~r   53 (62)
                      ++..++||+|
T Consensus        69 D~q~d~Wvmr   78 (80)
T PF07351_consen   69 DKQQDAWVMR   78 (80)
T ss_pred             cccCceeEEE
Confidence            4556789987


No 17 
>TIGR03488 cas_Cas5p CRISPR-associated protein, Cas5p family. CC Members of this protein family are cas, or CRISPR-associated, proteins. The two sequences in the alignment seed are found within cas gene clusters that are adjacent to CRISPR DNA repeats in two members of the order Bacteroidales, Porphyromonas gingivalis W83 and Bacteroides forsythus ATCC 43037. This cas protein family is unique to the Pgingi (Porphyromonas gingivalis) subtype, but shows some sequence similarity to genes of the Cas5 type (see TIGR02593).
Probab=22.93  E-value=36  Score=22.56  Aligned_cols=11  Identities=45%  Similarity=0.655  Sum_probs=5.8

Q ss_pred             CCCeEEeecee
Q psy9556          16 DPKLYECPIYR   26 (62)
Q Consensus        16 ~~~~Y~cPvY~   26 (62)
                      -.+-|+||+-.
T Consensus       196 ~~g~y~~~i~m  206 (237)
T TIGR03488       196 FEGNYECPIKM  206 (237)
T ss_pred             eccceEeeEec
Confidence            34556666543


No 18 
>PF09888 DUF2115:  Uncharacterized protein conserved in archaea (DUF2115);  InterPro: IPR019215  This entry represents various hypothetical archaeal proteins, has no known function. 
Probab=22.89  E-value=43  Score=21.19  Aligned_cols=15  Identities=27%  Similarity=0.547  Sum_probs=10.7

Q ss_pred             CCCeEEeeceeeccC
Q psy9556          16 DPKLYECPIYRKPQR   30 (62)
Q Consensus        16 ~~~~Y~cPvY~t~~R   30 (62)
                      ..+.|.|||=-.+..
T Consensus       134 ~~g~YYCPVKdkq~d  148 (163)
T PF09888_consen  134 KNGNYYCPVKDKQKD  148 (163)
T ss_pred             ECCEEeCccchhhcC
Confidence            467999998665544


No 19 
>COG3506 Uncharacterized conserved protein [Function unknown]
Probab=20.97  E-value=92  Score=20.40  Aligned_cols=24  Identities=13%  Similarity=0.466  Sum_probs=17.2

Q ss_pred             cceEEEEEecC-------------CCCCchheeehee
Q psy9556          33 LKYVGSIDFET-------------DNNPRHWTLRGVA   56 (62)
Q Consensus        33 ~~~v~~~~L~t-------------~~~p~~Wi~rGvA   56 (62)
                      .+|.+++++.-             ..+..|||+.|.-
T Consensus        54 ~dFta~vkV~g~Y~~LyDQaGlmirlde~hWiKagIE   90 (189)
T COG3506          54 GDFTATVKVKGAYKQLYDQAGLMIRLDEQHWIKAGIE   90 (189)
T ss_pred             CCeEEEEEEEeeHHHHHhhcCeEEEEccCCeeEeeeE
Confidence            57888888764             2346899998753


Done!