RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy9556
         (62 letters)



>gnl|CDD|217325 pfam03028, Dynein_heavy, Dynein heavy chain and region D6 of dynein
           motor.  This family represents the C-terminal region of
           dynein heavy chain. The chain also contains ATPase
           activity and microtubule binding ability and acts as a
           motor for the movement of organelles and vesicles along
           microtubules. Dynein is also involved in cilia and
           flagella movement. The dynein subunit consists of at
           least two heavy chains and a number of intermediate and
           light chains. The 380 kDa motor unit of dynein belongs
           to the AAA class of chaperone-like ATPases. The core of
           the 380 kDa motor unit contains a concatenated chain of
           six AAA modules, of which four correspond to the ATP
           binding sites with P-loop signatures described
           previously, and two are modules in which the P loop has
           been lost in evolution. This C-terminal domain carries
           the D6 region of the dynein motor where the P-loop has
           been lost in evolution but the general structure of a
           potential ATP binding site appears to be retained.
          Length = 706

 Score = 62.7 bits (153), Expect = 1e-13
 Identities = 22/60 (36%), Positives = 32/60 (53%)

Query: 1   MPVIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETDNNPRHWTLRGVALLCD 60
           MPVI++ A+     ++  +YECP+Y+   R    YV +   +T   P  W L GVALL  
Sbjct: 647 MPVIWVKAVPADKQEEKSVYECPVYKTETRGGTTYVFTFLLKTKEPPSKWILAGVALLLQ 706


>gnl|CDD|166698 PLN03059, PLN03059, beta-galactosidase; Provisional.
          Length = 840

 Score = 25.7 bits (56), Expect = 1.3
 Identities = 10/15 (66%), Positives = 11/15 (73%)

Query: 33  LKYVGSIDFETDNNP 47
           LKYV  I+F TDN P
Sbjct: 135 LKYVPGIEFRTDNGP 149


>gnl|CDD|217077 pfam02514, CobN-Mg_chel, CobN/Magnesium Chelatase.  This family
           contains a domain common to the cobN protein and to
           magnesium protoporphyrin chelatase. CobN is implicated
           in the conversion of hydrogenobyrinic acid a,c-diamide
           to cobyrinic acid. Magnesium protoporphyrin chelatase is
           involved in chlorophyll biosynthesis.
          Length = 1079

 Score = 25.2 bits (56), Expect = 1.9
 Identities = 5/10 (50%), Positives = 7/10 (70%)

Query: 1   MPVIYIYAIN 10
           +P IY Y +N
Sbjct: 460 LPHIYPYIVN 469


>gnl|CDD|214350 CHL00062, psbB, photosystem II 47 kDa protein.
          Length = 504

 Score = 25.4 bits (56), Expect = 2.0
 Identities = 10/20 (50%), Positives = 11/20 (55%)

Query: 38 SIDFETDNNPRHWTLRGVAL 57
          SI  ET  NP  W+  GVA 
Sbjct: 79 SITGETVTNPGIWSYEGVAG 98


>gnl|CDD|173935 cd08176, LPO, Lactadehyde:propanediol oxidoreductase (LPO)
           catalyzes the interconversion between L-lactaldehyde and
           L-1,2-propanediol in Escherichia coli and other
           enterobacteria.  Lactadehyde:propanediol oxidoreductase
           (LPO) is a member of the group III iron-activated
           dehydrogenases which catalyze the interconversion
           between L-lactaldehyde and L-1,2-propanediol in
           Escherichia coli and other enterobacteria. L-Fucose and
           L-rhamnose is used by Escherichia coli through an
           inducible pathway mediated by the fucose regulon
           comprising four linked oeprons fucO, fucA, fucPIK, and
           fucR. The fucA-encoded aldolase catalyzes the formation
           of dihydroxyacetone phosphate and L-lactaldehyde. Under
           anaerobic conditions, with NADH as a cofactor,
           lactaldehyde is converted by a fucO-encoded
           Lactadehyde:propanediol oxidoreductase (LPO) to
           L-1,2-propanediol, which is excreted as a fermentation
           product. In mutant strains, E. coli adapted to grow on
           L-1,2-propanediol, FucO catalyzes the oxidation of the
           polyol to L-lactaldehyde. FucO is induced regardless of
           the respiratory conditions of the culture, remains fully
           active in the absence of oxygen. In the presence of
           oxygen, this enzyme becomes oxidatively inactivated by a
           metal-catalyzed oxidation mechanism. FucO is an
           iron-dependent metalloenzyme that is inactivated by
           other metals, such as zinc, copper, or cadmium. This
           enzyme can also reduces glycol aldehyde with similar
           efficiency.  Beside L-1,2-propanediol, the enzyme is
           also able to oxidize methanol as alternative substrates.
          Length = 377

 Score = 24.9 bits (55), Expect = 2.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)

Query: 2   PVIYIYAINTTAG 14
           P + I AINTTAG
Sbjct: 126 PAVPIVAINTTAG 138


>gnl|CDD|200498 cd11237, Sema_1A, The Sema domain, a protein interacting module, of
           semaphorin 1A (Sema1A).  Sema1A is a transmembrane
           protein. It has been shown to mediate the
           defasciculation of motor axon bundles at specific choice
           points. Sema1A binds to its receptor plexin A (PlexA),
           which in turn triggers downstream signaling events
           involving the receptor tyrosine kinase Otk, the
           evolutionarily conserved flavoprotein monooxygenase
           molecule interacting with CasL (MICAL), and the A kinase
           anchoring protein Nervy, leading to repulsive
           growth-cone response. Sema1A has also been shown to be
           involved in synaptic formation. It is a member of the
           semaphorin family of proteins. Semaphorins are
           regulatory molecules in the development of the nervous
           system and in axonal guidance. They also play important
           roles in other biological processes, such as
           angiogenesis, immune regulation, respiration systems and
           cancer. The Sema domain is located at the N-terminus and
           contains four disulfide bonds formed by eight conserved
           cysteine residues. It serves as a receptor-recognition
           and -binding module.
          Length = 446

 Score = 25.0 bits (55), Expect = 2.7
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 14/39 (35%)

Query: 13  AGKDPKLYECPIYRKPQRT---DLK------YVGSIDFE 42
           +G DP      IYR+P RT   DLK      +V S  + 
Sbjct: 136 SGADPL-----IYREPLRTERYDLKQLNAPNFVSSFAYG 169


>gnl|CDD|220644 pfam10238, Eapp_C, E2F-associated phosphoprotein.  This entry
          represents the conserved C-terminal portion of an E2F
          binding protein. E2F transcription factors play an
          essential role in cell proliferation and apoptosis and
          their activity is frequently deregulated in human
          cancers. E2F activity is regulated by a variety of
          mechanisms, frequently mediated by proteins binding to
          individual members or a subgroup of the family. EAPP
          interacts with a subset of E2F factors and influences
          E2F-dependent promoter activity. EAPP is present
          throughout the cell cycle but disappears during
          mitosis.
          Length = 128

 Score = 24.6 bits (54), Expect = 3.4
 Identities = 12/41 (29%), Positives = 19/41 (46%)

Query: 6  IYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETDNN 46
          ++AIN    ++  LY  PI RK +R + K        T  +
Sbjct: 56 MFAINCKVDEEKVLYSKPINRKKRRRNSKKNELNPNNTATS 96


>gnl|CDD|216405 pfam01274, Malate_synthase, Malate synthase. 
          Length = 517

 Score = 24.2 bits (53), Expect = 4.9
 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 4/26 (15%)

Query: 37  GSIDFETDNNPRHWTLR----GVALL 58
           G IDF  +N  + + L     G ALL
Sbjct: 133 GRIDFRDENAGKSYKLNDGLHGRALL 158


>gnl|CDD|199903 cd10150, CobN_like, CobN subunit of cobaltochelatase, bchH and chlH
           subunits of magnesium chelatases, and similar proteins. 
           Cobaltochelatase is a complex enzyme that catalyzes the
           insertion of cobalt into hydrogenobyrinic acid
           a,c-diamide, resulting in cobyrinic acid, as
           demonstrated for Pseudomonas denitrificans. This is an
           essential step in the bacterial synthesis of cobalamine
           (B12). The insertion of cobalt requires a complex
           composed of three polypeptides, cobN, cobS, and cobT.
           Also included in this family are protoporphyrin IX
           magnesium chelatases involved in the synthesis of
           chlorophyll and bacteriochlorophyll, specifically the
           large (chlH or bchH) subunits.They are thought to bind
           both the protoporphyrin and the magnesium ion.
           Hydrolysis of ATP by the smaller subunits in the complex
           may trigger a conformational change that results in the
           insertion of the ion into the protoporphyrin scaffold.
           Cryo electron microscopy studies have suggested that a
           distinct bchH C-terminal domain may bind tightly to the
           N-terminal domain upon substrate binding, requiring a
           substantial conformational change of the bchH subunit.
           It has also been suggested that chlH of higher plants
           binds abscisic acid via a C-terminal domain and plays a
           role in abscisic acid signaling, and that the protein
           spans the chloroplast envelope, with the C-terminus
           exposed to the cytosol.
          Length = 910

 Score = 24.1 bits (53), Expect = 6.2
 Identities = 4/10 (40%), Positives = 7/10 (70%)

Query: 1   MPVIYIYAIN 10
           +P IY Y ++
Sbjct: 528 LPNIYPYIVD 537


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.142    0.458 

Gapped
Lambda     K      H
   0.267   0.0702    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,133,380
Number of extensions: 207891
Number of successful extensions: 154
Number of sequences better than 10.0: 1
Number of HSP's gapped: 154
Number of HSP's successfully gapped: 9
Length of query: 62
Length of database: 10,937,602
Length adjustment: 33
Effective length of query: 29
Effective length of database: 9,473,920
Effective search space: 274743680
Effective search space used: 274743680
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.2 bits)