Diaphorina citri psyllid: psy9572


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MNDHKNVLRYNIREKVYLYEFEVFRRKKLTIKANSGSTTTFVITPKELGYIGIKVTATSNLAGDSMEGKLLVKPEGETQYKNKAIFVDLRKNKTFSVNVTLDMPKNIVPGSEHVEVSAVACKIGDLLGPSIPNLANLIKMPFGCGEQNMLNFVPNIVVLEYLK
cccccccccccEEEEEEEEEEcEEEEEEEEEccccCEEEEEEEEEEECccEEEEEEEEEcccccCEEEEEEEccccEEEEEEEEEEEEEEccccEEEEEECcccccccccccEEEEEEEEECcccccccccccHHHHccccccccHHHHHccHHHHHHHHHcc
*NDHKNVLRYNIREKVYLYEFEVFRRKKLTIKANSGSTTTFVITPKELGYIGIKVTATSNLAGDSMEGKLLVKPEGETQYKNKAIFVDLRKNKTFSVNVTLDMPKNIVPGSEHVEVSAVACKIGDLLGPSIPNLANLIKMPFGCGEQNMLNFVPNIVVLEYLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDHKNVLRYNIREKVYLYEFEVFRRKKLTIKANSGSTTTFVITPKELGYIGIKVTATSNLAGDSMEGKLLVKPEGETQYKNKAIFVDLRKNKTFSVNVTLDMPKNIVPGSEHVEVSAVACKIGDLLGPSIPNLANLIKMPFGCGEQNMLNFVPNIVVLEYLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0019731 [BP]antibacterial humoral responseprobableGO:0002376, GO:0009607, GO:0019730, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0006955, GO:0006959, GO:0051707, GO:0051704
GO:0004866 [MF]endopeptidase inhibitor activityprobableGO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PRX, chain B
Confidence level:very confident
Coverage over the Query: 3-126
View the alignment between query and template
View the model in PyMOL