Diaphorina citri psyllid: psy9580


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MKELFSVFKIKTKSSAKKRFFIRTGGVIKRGQAFKRHILTKKSTKVKRKLRGLASVHKSNIASVRAMMPNS
cccccccccccccccccccEEEEccccEEEEccccccccccccHHHHHHcccccEEccccHHHHHHccccc
*****SVFKIKTKSSAKKRFFIRTGGVIKRGQAFKRHILTK*************SVHKSNIASVRAMMPNS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKELFSVFKIKTKSSAKKRFFIRTGGVIKRGQAFKRHILTKKSTKVKRKLRGLASVHKSNIASVRAMMPNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L35 very confidentQ2YBS4
50S ribosomal protein L35 very confidentQ7W7C9
50S ribosomal protein L35 very confidentQ2KZL7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022625 [CC]cytosolic large ribosomal subunitconfidentGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain 5
Confidence level:very confident
Coverage over the Query: 9-70
View the alignment between query and template
View the model in PyMOL