BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy960
         (83 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Y69|D Chain D, Bovine Heart Cytochrome C Oxidase Re-Refined With
           Molecular Oxygen
 pdb|2Y69|Q Chain Q, Bovine Heart Cytochrome C Oxidase Re-Refined With
           Molecular Oxygen
          Length = 169

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 27/38 (71%)

Query: 15  TLSEEHRQEMLQKMIDLRWNPITGTASKWDYEKNDWKK 52
           T  EE   +  ++M+D++  PI G ++KWDY+KN+WKK
Sbjct: 132 TFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK 169


>pdb|1OCC|D Chain D, Structure Of Bovine Heart Cytochrome C Oxidase At The
           Fully Oxidized State
 pdb|1OCC|Q Chain Q, Structure Of Bovine Heart Cytochrome C Oxidase At The
           Fully Oxidized State
 pdb|2OCC|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|2OCC|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|1OCO|D Chain D, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-bound
           State
 pdb|1OCO|Q Chain Q, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-bound
           State
 pdb|1OCR|D Chain D, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 pdb|1OCR|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 pdb|1OCZ|D Chain D, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
 pdb|1OCZ|Q Chain Q, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
 pdb|1V54|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|1V54|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|1V55|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
           State
 pdb|1V55|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
           State
 pdb|2DYR|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|2DYR|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|2DYS|D Chain D, Bovine Heart Cytochrome C Oxidase Modified By Dccd
 pdb|2DYS|Q Chain Q, Bovine Heart Cytochrome C Oxidase Modified By Dccd
 pdb|2EIJ|D Chain D, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 pdb|2EIJ|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 pdb|2EIK|D Chain D, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 pdb|2EIK|Q Chain Q, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 pdb|2EIL|D Chain D, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 pdb|2EIL|Q Chain Q, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 pdb|2EIM|D Chain D, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 pdb|2EIM|Q Chain Q, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 pdb|2EIN|D Chain D, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 pdb|2EIN|Q Chain Q, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 pdb|2ZXW|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (1-S X-Ray Exposure Dataset)
 pdb|2ZXW|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (1-S X-Ray Exposure Dataset)
 pdb|3ABL|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (15-S X-Ray Exposure Dataset)
 pdb|3ABL|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (15-S X-Ray Exposure Dataset)
 pdb|3ABM|D Chain D, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (200-S X-Ray Exposure Dataset)
 pdb|3ABM|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (200-S X-Ray Exposure Dataset)
 pdb|3ABK|D Chain D, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
           Reduced State (50k)
 pdb|3ABK|Q Chain Q, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
           Reduced State (50k)
 pdb|3AG1|D Chain D, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 280 K
 pdb|3AG1|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 280 K
 pdb|3AG2|D Chain D, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 100 K
 pdb|3AG2|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 100 K
 pdb|3AG3|D Chain D, Bovine Heart Cytochrome C Oxidase In The Nitric
           Oxide-Bound Reduced State At 100 K
 pdb|3AG3|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Nitric
           Oxide-Bound Reduced State At 100 K
 pdb|3AG4|D Chain D, Bovine Heart Cytochrome C Oxidase In The Cyanide Ion-Bound
           F Reduced State At 100 K
 pdb|3AG4|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Cyanide Ion-Bound
           F Reduced State At 100 K
 pdb|3ASN|D Chain D, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
           State Measured At 1.7470 Angstrom Wavelength
 pdb|3ASN|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
           State Measured At 1.7470 Angstrom Wavelength
 pdb|3ASO|D Chain D, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
           State Measured At 0.9 Angstrom Wavelength
 pdb|3ASO|Q Chain Q, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
           State Measured At 0.9 Angstrom Wavelength
 pdb|2YBB|O Chain O, Fitted Model For Bovine  Mitochondrial Supercomplex
           I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
          Length = 147

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 27/38 (71%)

Query: 15  TLSEEHRQEMLQKMIDLRWNPITGTASKWDYEKNDWKK 52
           T  EE   +  ++M+D++  PI G ++KWDY+KN+WKK
Sbjct: 110 TFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK 147


>pdb|4F84|A Chain A, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Sam
 pdb|4F85|A Chain A, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase
 pdb|4F86|A Chain A, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|B Chain B, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|C Chain C, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|D Chain D, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|E Chain E, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|F Chain F, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|G Chain G, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|H Chain H, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|I Chain I, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|J Chain J, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|K Chain K, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
 pdb|4F86|L Chain L, Structure Analysis Of Geranyl Diphosphate
           Methyltransferase In Complex With Gpp And Sinefungin
          Length = 320

 Score = 28.1 bits (61), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 12/43 (27%)

Query: 33  WNPITGTASKWDYEKNDWKKGDSINSHVITKETNIHARGHKIR 75
           WNP  G  SKW  +         IN+H    E NIH+R   +R
Sbjct: 232 WNPRYGQPSKWVSQ---------INAHF---ECNIHSRREYLR 262


>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum
           In Complex With Indirubin E804
 pdb|3EB0|C Chain C, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum
           In Complex With Indirubin E804
          Length = 383

 Score = 26.9 bits (58), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 6   KKIFPEKAETLSEEHRQEMLQKMIDLRWNPITGTASK-WDYEKNDWKKGDSINSH 59
           +KI PE   +L+ +  +++L+   DLR NP    A   +D+ +N ++     NS+
Sbjct: 287 RKILPEGTPSLAIDLLEQILRYEPDLRINPYEAMAHPFFDHLRNSYESEVKNNSN 341


>pdb|3VC1|A Chain A, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|B Chain B, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|C Chain C, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|D Chain D, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|E Chain E, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|F Chain F, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|G Chain G, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|H Chain H, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|I Chain I, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|J Chain J, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|K Chain K, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC1|L Chain L, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl-S- Thiolodiphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|A Chain A, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|B Chain B, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|C Chain C, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|D Chain D, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|E Chain E, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|F Chain F, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|G Chain G, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|H Chain H, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|I Chain I, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|J Chain J, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|K Chain K, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
 pdb|3VC2|L Chain L, Crystal Structure Of Geranyl Diphosphate
           C-Methyltransferase From Streptomyces Coelicolor A3(2)
           In Complex With Mg2+, Geranyl Diphosphate, And
           S-Adenosyl-L-Homocysteine
          Length = 312

 Score = 26.6 bits (57), Expect = 3.5,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 12/43 (27%)

Query: 33  WNPITGTASKWDYEKNDWKKGDSINSHVITKETNIHARGHKIR 75
           WNP  G  SKW  +         IN+H    E NIH+R   +R
Sbjct: 224 WNPRYGQPSKWVSQ---------INAHF---ECNIHSRREYLR 254


>pdb|3NKE|A Chain A, High Resolution Structure Of The C-Terminal Domain
          Crisp-Associated Protein Cas1 From Escherichia Coli
          Str. K-12
 pdb|3NKE|B Chain B, High Resolution Structure Of The C-Terminal Domain
          Crisp-Associated Protein Cas1 From Escherichia Coli
          Str. K-12
 pdb|3NKE|C Chain C, High Resolution Structure Of The C-Terminal Domain
          Crisp-Associated Protein Cas1 From Escherichia Coli
          Str. K-12
          Length = 200

 Score = 26.6 bits (57), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 24 MLQKMIDLRWNPITGTASKWDYEKNDWKKGDSINSHVITKETNIHA 69
          +L K   + WN          Y+  DW+KGD+IN  +    + ++ 
Sbjct: 60 LLAKQYGVTWN-------GRRYDPKDWEKGDTINQCISAATSCLYG 98


>pdb|3NKD|A Chain A, Structure Of Crisp-Associated Protein Cas1 From
           Escherichia Coli Str. K-12
 pdb|3NKD|B Chain B, Structure Of Crisp-Associated Protein Cas1 From
           Escherichia Coli Str. K-12
          Length = 305

 Score = 26.2 bits (56), Expect = 5.7,   Method: Composition-based stats.
 Identities = 8/13 (61%), Positives = 11/13 (84%)

Query: 45  YEKNDWKKGDSIN 57
           Y+  DW+KGD+IN
Sbjct: 165 YDPKDWEKGDTIN 177


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.127    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,542,549
Number of Sequences: 62578
Number of extensions: 85408
Number of successful extensions: 238
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 233
Number of HSP's gapped (non-prelim): 9
length of query: 83
length of database: 14,973,337
effective HSP length: 51
effective length of query: 32
effective length of database: 11,781,859
effective search space: 377019488
effective search space used: 377019488
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)