Diaphorina citri psyllid: psy9631


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MHDHVEAQIYLLTKEEGGRTRPYTPWGQAHVYSKTWDVAARIIDMGGKDMFMPGEDGNPDPLRGPMRPHHLLLQSCPHKAEYIEELGSLY
cccEEEEEEEEEEcccccccccccccccCEEEEEcccEEEEEEcccccCEECcccccccCEECcccccccHHHcccccHHHHHHHHHccc
*HDHVEAQIYLLTKEEGGRTRPYTPWGQAHVYSKTWDVAARIIDMGGKDMFMPGEDGNPDPLRGPMRPHHLLLQSCPHKAEYIEELGSLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDHVEAQIYLLTKEEGGRTRPYTPWGQAHVYSKTWDVAARIIDMGGKDMFMPGEDGNPDPLRGPMRPHHLLLQSCPHKAEYIEELGSLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor Tu, mitochondrial This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.confidentP85834
Elongation factor Tu, mitochondrial This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.confidentQ8BFR5
Elongation factor Tu, mitochondrial This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.confidentP49410

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042645 [CC]mitochondrial nucleoidprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0003746 [MF]translation elongation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006414 [BP]translational elongationprobableGO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2E, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL