Diaphorina citri psyllid: psy9632


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MTTPAITISGIHSIAYAFPNVKIVTSAVDPEINENFYVIPGIGNFGDRYFGTEPTITVTGGSIKATAGGSCLPRVETKEASPV
cccccccHHHHHHHHHHccccEEEEEEcccccccccCEEcccccccccccccccccccccccccccccccccccEEEcccccc
*TTPAITISGIHSIAYAFPNVKIVTSAVDPEINENFYVIPGIGNFGDRYFGTEPTIT***G********SCLPR**TK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTPAITISGIHSIAYAFPNVKIVTSAVDPEINENFYVIPGIGNFGDRYFGTEPTITVTGGSIKATAGGSCLPRVETKEASPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uracil phosphoribosyltransferase Catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate.confidentP18562
Uridine kinase-like protein 2, chloroplastic Involved in the pyrimidine salvage pathway. The uracil phosphoribosyltransferase (UPRT) activity, that catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate, is unsure.confidentQ9LK34
Uridine-cytidine kinase-like 1 May contribute to UTP accumulation needed for blast transformation and proliferation.confidentQ91YL3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BD3, chain D
Confidence level:very confident
Coverage over the Query: 1-53
View the alignment between query and template
View the model in PyMOL