BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9638
         (85 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2B4L|A Chain A, Crystal Structure Of The Binding Protein Opuac In Complex
           With Glycine Betaine
 pdb|2B4M|A Chain A, Crystal Structure Of The Binding Protein Opuac In Complex
           With Proline Betaine
 pdb|2B4M|B Chain B, Crystal Structure Of The Binding Protein Opuac In Complex
           With Proline Betaine
 pdb|3CHG|D Chain D, The Compatible Solute-Binding Protein Opuac From Bacillus
           Subtilis In Complex With Dmsa
 pdb|3CHG|A Chain A, The Compatible Solute-Binding Protein Opuac From Bacillus
           Subtilis In Complex With Dmsa
 pdb|3CHG|B Chain B, The Compatible Solute-Binding Protein Opuac From Bacillus
           Subtilis In Complex With Dmsa
 pdb|3CHG|C Chain C, The Compatible Solute-Binding Protein Opuac From Bacillus
           Subtilis In Complex With Dmsa
          Length = 268

 Score = 29.6 bits (65), Expect = 0.47,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 19  VGTGHADTTKFEWLVNIHRDSYASYMGHYN 48
           + TG AD +   WL N H+   A Y G Y+
Sbjct: 209 IATGSADASLSAWLPNTHKAYAAKYKGKYD 238


>pdb|4FO5|A Chain A, Crystal Structure Of A Thioredoxin-Like Protein
          (Bdi_1100) From Parabacteroides Distasonis Atcc 8503 At
          2.02 A Resolution
          Length = 143

 Score = 26.6 bits (57), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 28 KFEWLVNIHRDSYASYMGHYNMLNLFSINENEAKAR 63
          + E+L N  + S+ + +G Y +LN ++  + E++AR
Sbjct: 15 RIEFLGNDAKASFHNQLGRYTLLNFWAAYDAESRAR 50


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.135    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,951,007
Number of Sequences: 62578
Number of extensions: 102680
Number of successful extensions: 190
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 188
Number of HSP's gapped (non-prelim): 3
length of query: 85
length of database: 14,973,337
effective HSP length: 53
effective length of query: 32
effective length of database: 11,656,703
effective search space: 373014496
effective search space used: 373014496
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)