Diaphorina citri psyllid: psy9642


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MATALEQFVNNVRQLSAQGSFRELTEIIQKSMDVLTKYGQHLDNVLETLETFQHSLGILAILSAKLTLLSSSNTGSEYQEELFSQIQEFLNMCNPDQIRHAGDLYAELSHQYTKTVMDLKTPQRGIPLIQTAIKKIQTSDSQLTSLHSDLCQLCLLAQNFKPALEFLDVDITTIANEGPQFDTKYFLQYFYYGGMIYLALKNYERALYFFEVIITTPALAVSHIMLEGYKKYLLIYLIVYGKAPNLPKNVSQAICRYIKPLSQPYLDLVSVYTNNNSTELQHLLLKYADVFSRDENTGLTKQIVASLYKNNIKRLTKTFLTLSLADVASRVQLGTPVQAEIYILKMISQNEIYATINKKDGMVVFNDNPQRFNNPLTFAQIESNIRACMHLDGKFQAMEEEILVNPLYVKKAASPSDEETGSSKPGGRVMEVENSIY
ccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHccEEEEEEEccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccccccccccccc
**TALEQFVNNVRQLSAQGSFRELTEIIQKSMDVLTKYGQHLDNVLETLETFQHSLGILAILSAKLTLLSSSNTGSEYQEELFSQIQEFLNMCNPDQIRHAGDLYAELSHQYTKTVMDLKTPQRGIPLIQTAIKKIQTSDSQLTSLHSDLCQLCLLAQNFKPALEFLDVDITTIANEGPQFDTKYFLQYFYYGGMIYLALKNYERALYFFEVIITTPALAVSHIMLEGYKKYLLIYLIVYGKAPNLPKNVSQAICRYIKPLSQPYLDLVSVYTNNNSTELQHLLLKYADVFSRDENTGLTKQIVASLYKNNIKRLTKTFLTLSLADVASRVQLGTPVQAEIYILKMISQNEIYATINKKDGMVVFNDNPQRFNNPLTFAQIESNIRACMHLDGKFQAMEEEILVNPLYV***********************ENSIY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATALEQFVNNVRQLSAQGSFRELTEIIQKSMDVLTKYGQHLDNVLETLETFQHSLGILAILSAKLTLLSSSNTGSEYQEELFSQIQEFLNMCNPDQIRHAGDLYAELSHQYTKTVMDLKTPQRGIPLIQTAIKKIQTSDSQLTSLHSDLCQLCLLAQNFKPALEFLDVDITTIANEGPQFDTKYFLQYFYYGGMIYLALKNYERALYFFEVIITTPALAVSHIMLEGYKKYLLIYLIVYGKAPNLPKNVSQAICRYIKPLSQPYLDLVSVYTNNNSTELQHLLLKYADVFSRDENTGLTKQIVASLYKNNIKRLTKTFLTLSLADVASRVQLGTPVQAEIYILKMISQNEIYATINKKDGMVVFNDNPQRFNNPLTFAQIESNIRACMHLDGKFQAMEEEILVNPLYVKKAASPSDEETGSSKPGGRVMEVENSIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
COP9 signalosome complex subunit 3 Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Essential to maintain the survival of epiblast cells and thus the development of the postimplantation embryo.very confidentQ68FW9
COP9 signalosome complex subunit 3 Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity.very confidentQ5ZJF1
COP9 signalosome complex subunit 3 Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Essential to maintain the survival of epiblast cells and thus the development of the postimplantation embryo.very confidentO88543

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008180 [CC]signalosomeconfidentGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010388 [BP]cullin deneddylationconfidentGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0000338, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0019538, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009416 [BP]response to light stimulusprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0050821 [BP]protein stabilizationprobableGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0007095 [BP]mitotic G2 DNA damage checkpointprobableGO:0010948, GO:0044773, GO:1901991, GO:1901990, GO:0050789, GO:0044699, GO:0051716, GO:0031572, GO:0031570, GO:0010564, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:0044774, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0033554, GO:0022402, GO:0048523, GO:0007093
GO:0010971 [BP]positive regulation of G2/M transition of mitotic cell cycleprobableGO:0045931, GO:0090068, GO:0007346, GO:0045787, GO:0051726, GO:0010564, GO:0050794, GO:0050789, GO:1901987, GO:0065007, GO:1901990, GO:1901992, GO:0048518, GO:0008150, GO:0048522, GO:0010389, GO:1901989

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain S
Confidence level:confident
Coverage over the Query: 121-371
View the alignment between query and template
View the model in PyMOL