Diaphorina citri psyllid: psy9645

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MKQDRGRQRRTWMDDIKEWTNIPGNQQAGASEKHRVRGDINVLLCGDPGTAKSQFLKYMEKIGPRAIFTTGQGASAVGLTAYVGKHPTTKEWTVEADI
cccccccccccHHHHHHHHHHHcccccccccccccEEccEEEEEEccccHHHHHHHHHHHHHcccEEEEccccccccccEEEEEEccccccEEEECcc
*************DDIKEWTNIPGNQ*********VRGDINVLLCGDPGTAKSQFLKYMEKIGPRAIFTTGQGASAVGLTAYVGKHPTTKEWTVEADI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQDRGRQRRTWMDDIKEWTNIPGNQQAGASEKHRVRGDINVLLCGDPGTAKSQFLKYMEKIGPRAIFTTGQGASAVGLTAYVGKHPTTKEWTVEADI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor mcm2 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.confidentQ6DIH3
DNA replication licensing factor MCM2 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division.confidentP97310
DNA replication licensing factor MCM2 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division.confidentP49736

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partconfidentGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030174 [BP]regulation of DNA-dependent DNA replication initiationprobableGO:0009889, GO:0051052, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0006275, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0090329, GO:0050789, GO:0080090
GO:0005656 [CC]pre-replicative complexprobableGO:0036387, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0032991, GO:0043231, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0043140 [MF]ATP-dependent 3'-5' DNA helicase activityprobableGO:0008094, GO:0016818, GO:0016462, GO:0008026, GO:0042623, GO:0004003, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0043138, GO:0003824
GO:0031298 [CC]replication fork protection complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000793 [CC]condensed chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045120 [CC]pronucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006268 [BP]DNA unwinding involved in replicationprobableGO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0051097 [BP]negative regulation of helicase activityprobableGO:0051336, GO:0051346, GO:0051095, GO:0065009, GO:0050790, GO:0050789, GO:0065007, GO:0044092, GO:0008150, GO:0019222, GO:0043086
GO:0003688 [MF]DNA replication origin bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0006271 [BP]DNA strand elongation involved in DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0022616, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0006270 [BP]DNA replication initiationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0006334 [BP]nucleosome assemblyprobableGO:0034728, GO:0071103, GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0031497, GO:0034622, GO:0044699, GO:0071824, GO:0006139, GO:0044260, GO:0006325, GO:1901360, GO:0006323, GO:0065003, GO:0071704, GO:0071840, GO:0065004, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0006333, GO:0044237, GO:0043170, GO:0044085, GO:0006259, GO:0008150
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0031261 [CC]DNA replication preinitiation complexprobableGO:0044446, GO:0032991, GO:0031981, GO:0032993, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030261 [BP]chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0071840, GO:0006139, GO:0044260, GO:0006323, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0044699, GO:0051276, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0017116 [MF]single-stranded DNA-dependent ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0004003, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0043142, GO:0016887, GO:0003678, GO:0003674, GO:0016462, GO:0003824
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0097373 [CC]MCM core complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0040029 [BP]regulation of gene expression, epigeneticprobableGO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0010468
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0000784 [CC]nuclear chromosome, telomeric regionprobableGO:0031974, GO:0000781, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000216 [BP]M/G1 transition of mitotic cell cycleprobable
GO:0000075 [BP]cell cycle checkpointprobableGO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901988, GO:0048519, GO:0050789, GO:0048523
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0007090 [BP]regulation of S phase of mitotic cell cycleprobable
GO:0007292 [BP]female gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0048609
GO:0003712 [MF]transcription cofactor activityprobableGO:0003674, GO:0000989, GO:0000988
GO:0006267 [BP]pre-replicative complex assemblyprobableGO:0022607, GO:0036388, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:0034622, GO:0071840, GO:0071824, GO:0006139, GO:0044260, GO:0071704, GO:1901360, GO:0016043, GO:0065003, GO:0043933, GO:0006260, GO:0006261, GO:0065004, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0044085, GO:0006259
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0097362 [CC]MCM8-MCM9 complexprobableGO:0043234, GO:0005575, GO:0042555, GO:0032991
GO:0005664 [CC]nuclear origin of replication recognition complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043234, GO:0032991, GO:0000808, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0009378 [MF]four-way junction helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0071353 [BP]cellular response to interleukin-4probableGO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0000727 [BP]double-strand break repair via break-induced replicationprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0000724, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0010082 [BP]regulation of root meristem growthprobableGO:0022622, GO:0048638, GO:0009653, GO:0050789, GO:0044699, GO:0040008, GO:0007275, GO:0048513, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009888, GO:0044767, GO:0008150, GO:0010015, GO:0051239, GO:0010073, GO:0044707, GO:0010075, GO:0048856, GO:2000280, GO:0048507, GO:0048364, GO:2000026, GO:0048731, GO:0048509
GO:0040007 [BP]growthprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 8-98
View the alignment between query and template
View the model in PyMOL