Diaphorina citri psyllid: psy964

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MYRFFKYIENRDVAKQVMKERGLKKIRLGIEGYPTYKEKIYRSTSTTMYRFFKYIENRDVAKQVMKERGLKKIRLGIEGYPTYKEKVKKRAGGRSDVIYNYVQRPFIHMSWEKEEAKSRHVDFQATLPLDWISDNIEFNLRGYKFITEIGTLVQ
cHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccccCEEEEEccccHHHHHHHHcHHHHHHHHHHHHccEEEccccccccHHHHHHcccccccEEEEEEccccccccccHccccccccCEEEEEcccccccccEEEEcccEEEEEEcccccc
*YRFFKYIENRDVAKQVMKERGLKKIRLGIEGYPTYKEKIYRSTSTTMYRFFKYIENRDVAKQVMKERGLKKIRLGIEGYPTYKEKVKKRAGGRSDVIYNYVQRPFIHMSWEKEEAKSRHVDFQATLPLDWISDNIEFNLRGYKFITEIGTLV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRFFKYIENRDVAKQVMKERGLKKIRLGIEGYPTYKEKIYRSTSTTMYRFFKYIENRDVAKQVMKERGLKKIRLGIEGYPTYKEKVKKRAGGRSDVIYNYVQRPFIHMSWEKEEAKSRHVDFQATLPLDWISDNIEFNLRGYKFITEIGTLVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BTB/POZ domain-containing protein 10 confidentQ80X66
BTB/POZ domain-containing protein 10 confidentQ5R585
BTB/POZ domain-containing protein 10 confidentQ9BSF8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035071 [BP]salivary gland cell autophagic cell deathprobableGO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0050975 [BP]sensory perception of touchprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted