Diaphorina citri psyllid: psy9651


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MLLYDKHLTLTWSASLLRLPVSVKLYNTLHTSGKAFIQQVKPLYIRTPVGVKLYNTLHTTGKTFIHQVKPSYNSSSTLHCYRVIHTEVKVPLKELVKVVNVNEDGMEYIDFVGDQTFRPLPEYYPELYDQSQCSDMAETVLGLQFIHSPAQVCLSVQSSHLRCHYSALSRVYAVLRDFSSRYGGQLTLKNTGLSMTRALYGATKEFDEKVEVWTKVKLAPGAQLKLVHTNLSFEKKSCRVLWEYSHLTPPRPSTFAPGCPQRSLEPPAILDTLEHFEVRMLPHCELSSNGTYQPSYSHFTFARKQLRRNKIAHNYPSDLIRYLRPSMTSIDEDFKKAVEDVKTLTKRPTDEELLEIYALFKQATEGDNTTARPSMFNLKAKYKWECWTKLKGTSSDQAKQDYVKKVQELLAKYQ
cccccccEEEEEcccccccEEEEEEEEcccccHHHHHHHcccEEEEccccEEEEEcccccccEEEEEccccccccccEEEEEEEEccccccHHHHHHEEEEcccccEEEEEccccccccccccccHccccccccHHHHHHHHHEECccccEEEEEEEcccEEEccHHHHHHHHHHHHHccccccCEEECccccHHHHHHHcccccccccEEEEEEEEccccCEEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc
*LLYDKHLTLTWSASLLRLPVSVKLYNTLHTSGKAFIQQVKPLYIRTPVGVKLYNTLHTTGKTFIHQVKPSYNSSSTLHCYRVIHTEVKVPLKELVKVVNVNEDGMEYIDFVGDQTFRPLPEYYPELYDQSQCSDMAETVLGLQFIHSPAQVCLSVQSSHLRCHYSALSRVYAVLRDFSSRYGGQLTLKNTGLSMTRALYGATKEFDEKVEVWTKVKLAPGAQLKLVHTNLSFEKKSCRVLWEYSHLTP******************AILDTLEHFEVRMLPHCELSSNGTYQPSYSHFTFARKQLRRNKIAHNYPSDLIRYLRPSMTSIDEDFKKAVEDVKTLT***TDEELLEIYALFKQATEGDNTTARPSMFNLKAKYKWECWTKLKGTSSDQAKQDYVKKVQELLAKY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLYDKHLTLTWSASLLRLPVSVKLYNTLHTSGKAFIQQVKPLYIRTPVGVKLYNTLHTTGKTFIHQVKPSYNSSSTLHCYRVIHTEVKVPLKELVKVVNVNEDGMEYIDFVGDQTFRPLPEYYPELYDQSQCSDMAETVLGLQFIHSPAQVCLSVQSSHLRCHYSALSRVYAVLRDFSSRYGGQLTLKNTGLSMTRALYGATKEFDEKVEVWTKVKLAPGAQLKLVHTNLSFEKKSCRVLWEYSHLTPPRPSTFAPGCPQRSLEPPAILDTLEHFEVRMLPHCELSSNGTYQPSYSHFTFARKQLRRNKIAHNYPSDLIRYLRPSMTSIDEDFKKAVEDVKTLTKRPTDEELLEIYALFKQATEGDNTTARPSMFNLKAKYKWECWTKLKGTSSDQAKQDYVKKVQELLAKYQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA-binding protein DBI(32-86) has antibacterial properties.confidentP12026
Acyl-CoA-binding protein Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.confidentQ8WN94
Acyl-CoA-binding protein Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.confidentQ9TQX6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032228 [BP]regulation of synaptic transmission, GABAergicprobableGO:0050804, GO:0044057, GO:0031644, GO:0050794, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0051179 [BP]localizationprobableGO:0008150
GO:0031999 [BP]negative regulation of fatty acid beta-oxidationprobableGO:0045922, GO:0009894, GO:0009895, GO:0009892, GO:0080090, GO:0031329, GO:0031324, GO:0031323, GO:0046320, GO:0046322, GO:0050789, GO:0019222, GO:0010565, GO:0045833, GO:0065007, GO:0048519, GO:0019217, GO:0019216, GO:0031330, GO:0050794, GO:0008150, GO:0031998, GO:0050995, GO:0050994, GO:0048523
GO:0043292 [CC]contractile fiberprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0043226
GO:0030156 [MF]benzodiazepine receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046889 [BP]positive regulation of lipid biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0019216, GO:0009889, GO:0008150, GO:0045834, GO:0046890, GO:0048518, GO:0065007, GO:0050789, GO:0080090
GO:0014009 [BP]glial cell proliferationprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0008283, GO:0009987, GO:0048869, GO:0030154, GO:0044763, GO:0042063, GO:0032501, GO:0008150, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FLV, chain A
Confidence level:very confident
Coverage over the Query: 328-414
View the alignment between query and template
View the model in PyMOL