Query         psy9658
Match_columns 79
No_of_seqs    73 out of 75
Neff          4.6 
Searched_HMMs 46136
Date          Sat Aug 17 01:17:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9658.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9658hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09733 VEFS-Box:  VEFS-Box of 100.0 1.1E-41 2.4E-46  235.5   4.1   74    2-75     18-93  (140)
  2 KOG2350|consensus              100.0 5.3E-37 1.1E-41  224.2   3.9   75    2-76     96-171 (221)
  3 PRK13710 plasmid maintenance p  57.8      11 0.00023   23.6   2.3   24   51-74     49-72  (72)
  4 PF05299 Peptidase_M61:  M61 gl  55.2     5.3 0.00011   27.1   0.6   29    4-32     11-42  (122)
  5 PF08246 Inhibitor_I29:  Cathep  37.7      17 0.00037   20.5   0.9   12   39-50     46-57  (58)
  6 COG5109 Uncharacterized conser  33.4      32  0.0007   27.8   2.0   23   41-63     56-78  (396)
  7 PF06286 Coleoptericin:  Coleop  32.6      27 0.00059   24.6   1.3   37    6-42     34-75  (143)
  8 PF13902 R3H-assoc:  R3H-associ  31.8      38 0.00082   22.5   1.9   12   51-62     69-80  (131)
  9 PF14881 Tubulin_3:  Tubulin do  28.9      47   0.001   23.5   2.1   16    2-17     16-31  (180)
 10 PF07362 CcdA:  Post-segregatio  27.9     5.9 0.00013   24.5  -2.4   20   52-71     50-69  (72)
 11 TIGR02894 DNA_bind_RsfA transc  24.2      38 0.00083   24.4   0.9   10   55-64     49-58  (161)
 12 smart00848 Inhibitor_I29 Cathe  22.0      30 0.00065   18.9   0.0   12   39-50     46-57  (57)
 13 PF08616 SPA:  Stabilization of  20.9      77  0.0017   20.8   1.8   25   51-75     13-37  (113)

No 1  
>PF09733 VEFS-Box:  VEFS-Box of polycomb protein;  InterPro: IPR019135  The VEFS-Box is found in the the C-terminal region of the VRN2, EMF2, FIS2, and Su(z)12 polycomb proteins. This domain is characterised by an acidic cluster and a tryptophan/methionine-rich sequence, the acidic-W/M domain []. In some proteins the VEFS-Box is associated with a zinc-finger domain located roughly 100 residues towards the N terminus. These proteins are part of the polycomb cluster of proteins which control HOX gene transcription as it functions in heterochromatin-mediated repression []. 
Probab=100.00  E-value=1.1e-41  Score=235.47  Aligned_cols=74  Identities=46%  Similarity=0.745  Sum_probs=73.3

Q ss_pred             CccceecccCcccCCCCC--CCCCCCCCCHHHHHHHHHHHhcccCCCChhHHHHHHHHHHHHhhhcccccccCccc
Q psy9658           2 YRLYHHTITCLPVLPKEM--DQDSDDQKDPKWLQTKTKMMIDEFTDVNEGEKELMKLWNLHVMKYGWGRHLSSASQ   75 (79)
Q Consensus         2 ~R~y~Hs~t~~pl~~~e~--d~DSEdE~D~~Wl~~k~r~~l~dF~Dv~~~EKe~M~~WN~fv~r~~~~AD~~vp~~   75 (79)
                      ||+||||+||+||+|+|+  |+|||||+|++||++++|++|+||+|||++||+||++||+||+|||++||+|||++
T Consensus        18 ~R~y~Hs~t~~p~~~~e~~sd~DSedE~D~~wl~~~~r~~l~dF~Dv~~~EKefM~lWN~fv~k~r~~aD~~ip~a   93 (140)
T PF09733_consen   18 NRQYFHSRTCQPMRPEEVLSDRDSEDEVDDEWLDQKHRRMLDDFSDVNEEEKEFMKLWNSFVMKQRVIADGHIPWA   93 (140)
T ss_pred             CcceeccccceeccHHHhcCCCCCCCcCCHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHccCcchHHHHHH
Confidence            899999999999999999  99999999999999999999999999999999999999999999999999999987


No 2  
>KOG2350|consensus
Probab=100.00  E-value=5.3e-37  Score=224.22  Aligned_cols=75  Identities=37%  Similarity=0.571  Sum_probs=69.0

Q ss_pred             CccceecccCcccCCCCCCCCCCCCCC-HHHHHHHHHHHhcccCCCChhHHHHHHHHHHHHhhhcccccccCcccc
Q psy9658           2 YRLYHHTITCLPVLPKEMDQDSDDQKD-PKWLQTKTKMMIDEFTDVNEGEKELMKLWNLHVMKYGWGRHLSSASQS   76 (79)
Q Consensus         2 ~R~y~Hs~t~~pl~~~e~d~DSEdE~D-~~Wl~~k~r~~l~dF~Dv~~~EKe~M~~WN~fv~r~~~~AD~~vp~~~   76 (79)
                      |||||||+|||||+++++..|+|+|.| ++||+.++++||++|+|||++||+||++||+||+|||||||+|||||-
T Consensus        96 kRqffHS~t~qPl~leqvmsdrdsE~d~dd~a~~e~~~mLe~fvdvne~ekr~mkLWNsfVrkqrviAD~hipwAC  171 (221)
T KOG2350|consen   96 KRQFFHSDTCQPLRLEQVMSDRDSEKDEDDWARLETSTMLEEFVDVNEGEKRVMKLWNSFVRKQRVIADGHIPWAC  171 (221)
T ss_pred             cceeeeccccCCCCHHHHhccccccccchhhhhhHHHHHHHHhccccHHHHHHHHHHHHHHHHhheeccCCCcHHH
Confidence            899999999999999999544444444 999999999999999999999999999999999999999999999984


No 3  
>PRK13710 plasmid maintenance protein CcdA; Provisional
Probab=57.77  E-value=11  Score=23.58  Aligned_cols=24  Identities=13%  Similarity=-0.160  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHhhhcccccccCcc
Q psy9658          51 KELMKLWNLHVMKYGWGRHLSSAS   74 (79)
Q Consensus        51 Ke~M~~WN~fv~r~~~~AD~~vp~   74 (79)
                      ++.|..+|.||-++|..+|.+=+|
T Consensus        49 ~eai~~~n~~ve~~G~~~de~R~~   72 (72)
T PRK13710         49 REGMAEVARFIEMNGSFADENRNW   72 (72)
T ss_pred             HHHHHHHHHHHHHhCCcHHhcCCC
Confidence            678999999999999999876543


No 4  
>PF05299 Peptidase_M61:  M61 glycyl aminopeptidase;  InterPro: IPR007963 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M61 (glycyl aminopeptidase family, clan MA(E)).The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example is glycyl aminopeptidase from Sphingomonas capsulata.
Probab=55.22  E-value=5.3  Score=27.11  Aligned_cols=29  Identities=17%  Similarity=0.460  Sum_probs=23.0

Q ss_pred             cceecccCcccCCCCC---CCCCCCCCCHHHH
Q psy9658           4 LYHHTITCLPVLPKEM---DQDSDDQKDPKWL   32 (79)
Q Consensus         4 ~y~Hs~t~~pl~~~e~---d~DSEdE~D~~Wl   32 (79)
                      .|||+.+..-++|.++   |.+.+.-...-|+
T Consensus        11 EffH~WnvkrirP~~l~p~dy~~~~~t~~LWv   42 (122)
T PF05299_consen   11 EFFHSWNVKRIRPAELGPFDYEKPNYTELLWV   42 (122)
T ss_pred             hccccccceEeccccccCCCCCCCCCCCCEee
Confidence            5999999999999998   6666666655665


No 5  
>PF08246 Inhibitor_I29:  Cathepsin propeptide inhibitor domain (I29);  InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This entry represents a peptidase inhibitor domain, which belongs to MEROPS peptidase inhibitor family I29. The domain is also found at the N terminus of a variety of peptidase precursors that belong to MEROPS peptidase subfamily C1A; these include cathepsin L, papain, and procaricain (P10056 from SWISSPROT) []. It forms an alpha-helical domain that runs through the substrate-binding site, preventing access. Removal of this region by proteolytic cleavage results in activation of the enzyme. This domain is also found, in one or more copies, in a variety of cysteine peptidase inhibitors such as salarin [].; PDB: 3QT4_A 3QJ3_A 2C0Y_A 2L95_A 1CJL_A 1CS8_A 7PCK_A 1BY8_A 1PCI_A 2O6X_A ....
Probab=37.69  E-value=17  Score=20.50  Aligned_cols=12  Identities=25%  Similarity=0.578  Sum_probs=9.6

Q ss_pred             HhcccCCCChhH
Q psy9658          39 MIDEFTDVNEGE   50 (79)
Q Consensus        39 ~l~dF~Dv~~~E   50 (79)
                      -|+.|+|++.+|
T Consensus        46 ~~N~fsD~t~eE   57 (58)
T PF08246_consen   46 GLNQFSDMTPEE   57 (58)
T ss_dssp             -SSTTTTSSHHH
T ss_pred             eCccccCcChhh
Confidence            478899999887


No 6  
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=33.45  E-value=32  Score=27.81  Aligned_cols=23  Identities=22%  Similarity=0.523  Sum_probs=20.9

Q ss_pred             cccCCCChhHHHHHHHHHHHHhh
Q psy9658          41 DEFTDVNEGEKELMKLWNLHVMK   63 (79)
Q Consensus        41 ~dF~Dv~~~EKe~M~~WN~fv~r   63 (79)
                      +.|.++++.|+.+-..||+|+.-
T Consensus        56 q~fd~Ls~~e~~~~~s~k~~~k~   78 (396)
T COG5109          56 QEFDTLSHAEADLVGSWKSLLKE   78 (396)
T ss_pred             CCcchhhHHHHHHHHHHHHHHHH
Confidence            57889999999999999999864


No 7  
>PF06286 Coleoptericin:  Coleoptericin;  InterPro: IPR009382 This family consists of several insect coleoptericin, acaloleptin, holotricin and rhinocerosin proteins which are all known to be antibacterial proteins []. These all appear to be short, glycine-rich molecules, inducible by infection.; GO: 0042742 defense response to bacterium, 0005576 extracellular region
Probab=32.61  E-value=27  Score=24.65  Aligned_cols=37  Identities=11%  Similarity=0.170  Sum_probs=27.3

Q ss_pred             eecccCcc-cCCCCC----CCCCCCCCCHHHHHHHHHHHhcc
Q psy9658           6 HHTITCLP-VLPKEM----DQDSDDQKDPKWLQTKTKMMIDE   42 (79)
Q Consensus         6 ~Hs~t~~p-l~~~e~----d~DSEdE~D~~Wl~~k~r~~l~d   42 (79)
                      ||+....| +.|-|+    +.-.|+|++....-+..|+.|+.
T Consensus        34 ~~~~r~~~~~~PaE~~~~~~~~de~~~em~~~~ir~rRSLQp   75 (143)
T PF06286_consen   34 YRLRRSEPQDSPAELNEYVDITDEPEAEMPYEYIRERRSLQP   75 (143)
T ss_pred             hhhhcccccCChHHhhhccccccCcchhhhHHHHHHHhccCC
Confidence            66666666 778776    44558888888877888888874


No 8  
>PF13902 R3H-assoc:  R3H-associated N-terminal domain
Probab=31.81  E-value=38  Score=22.45  Aligned_cols=12  Identities=17%  Similarity=0.266  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHh
Q psy9658          51 KELMKLWNLHVM   62 (79)
Q Consensus        51 Ke~M~~WN~fv~   62 (79)
                      .++|..||.|+-
T Consensus        69 ~~~~~~Wd~f~~   80 (131)
T PF13902_consen   69 YQNAQLWDDFRN   80 (131)
T ss_pred             HHHHHHHHHHhh
Confidence            677888888874


No 9  
>PF14881 Tubulin_3:  Tubulin domain
Probab=28.87  E-value=47  Score=23.51  Aligned_cols=16  Identities=13%  Similarity=-0.056  Sum_probs=14.0

Q ss_pred             CccceecccCcccCCC
Q psy9658           2 YRLYHHTITCLPVLPK   17 (79)
Q Consensus         2 ~R~y~Hs~t~~pl~~~   17 (79)
                      +|.+||.+|.++|..-
T Consensus        16 ~r~~yhPrSl~~l~~~   31 (180)
T PF14881_consen   16 NRVHYHPRSLNQLNDY   31 (180)
T ss_pred             CcceeCCCceEEcCcc
Confidence            6999999999999754


No 10 
>PF07362 CcdA:  Post-segregation antitoxin CcdA;  InterPro: IPR009956 This entry consists of several Enterobacterial post-segregation antitoxin CcdA proteins. The F plasmid-carried bacterial toxin, the CcdB protein, is known to act on DNA gyrase in two different ways. CcdB poisons the gyrase-DNA complex, blocking the passage of polymerases and leading to double-strand breakage of the DNA. Alternatively, in cells that overexpress CcdB, the A subunit of DNA gyrase (GyrA) has been found as an inactive complex with CcdB. Both poisoning and inactivation can be prevented and reversed in the presence of the F plasmid-encoded antidote, the CcdA protein [].; PDB: 3HPW_C 2H3C_A 2H3A_B 2ADN_B 2ADL_B.
Probab=27.85  E-value=5.9  Score=24.51  Aligned_cols=20  Identities=20%  Similarity=0.120  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHhhhccccccc
Q psy9658          52 ELMKLWNLHVMKYGWGRHLS   71 (79)
Q Consensus        52 e~M~~WN~fv~r~~~~AD~~   71 (79)
                      +.|..||.||-++|..+|.+
T Consensus        50 ~ai~~~N~~ve~~G~~~de~   69 (72)
T PF07362_consen   50 EAIEAYNRFVEEHGLFSDEY   69 (72)
T ss_dssp             CSCCSSSHSSSCSSSCSSSC
T ss_pred             HHHHHHHHHHHHcCCcHHHc
Confidence            45778999999999999876


No 11 
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO.
Probab=24.23  E-value=38  Score=24.36  Aligned_cols=10  Identities=40%  Similarity=0.411  Sum_probs=8.4

Q ss_pred             HHHHHHHhhh
Q psy9658          55 KLWNLHVMKY   64 (79)
Q Consensus        55 ~~WN~fv~r~   64 (79)
                      ..||+.|+|+
T Consensus        49 FRWNs~VRkq   58 (161)
T TIGR02894        49 FRWNAYVRKQ   58 (161)
T ss_pred             chHHHHHHHH
Confidence            4799999975


No 12 
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29). This domain is found at the N-terminus of some C1 peptidases such as Cathepsin L where it acts as a propeptide. There are also a number of proteins that are composed solely of multiple copies of this domain such as the peptidase inhibitor salarin. This family is classified as I29 by MEROPS. Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a s
Probab=22.00  E-value=30  Score=18.94  Aligned_cols=12  Identities=25%  Similarity=0.598  Sum_probs=8.8

Q ss_pred             HhcccCCCChhH
Q psy9658          39 MIDEFTDVNEGE   50 (79)
Q Consensus        39 ~l~dF~Dv~~~E   50 (79)
                      -++.|+|++++|
T Consensus        46 ~~N~fsDlt~eE   57 (57)
T smart00848       46 GLNQFADLTNEE   57 (57)
T ss_pred             cCcccccCCCCC
Confidence            357888888765


No 13 
>PF08616 SPA:  Stabilization of polarity axis
Probab=20.94  E-value=77  Score=20.78  Aligned_cols=25  Identities=20%  Similarity=0.217  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHhhhcccccccCccc
Q psy9658          51 KELMKLWNLHVMKYGWGRHLSSASQ   75 (79)
Q Consensus        51 Ke~M~~WN~fv~r~~~~AD~~vp~~   75 (79)
                      -+.|.+||+-+.++|++-=++-|++
T Consensus        13 ~~i~~L~~alL~~krivv~s~~~~~   37 (113)
T PF08616_consen   13 PEIILLWEALLLGKRIVVYSPSPSA   37 (113)
T ss_pred             hHHHHHHHHHHhCCCEEEECCCCCH
Confidence            4689999999999998877776665


Done!