Diaphorina citri psyllid: psy9659


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MKRLADIPTYAPVVLELDLSDFTTMEERMETALSIFSRIDILINNGGISYRGDIMSTNTDVDYKVMLVNYFGQVAITKALLPSMVRRQSGHIVTVSSVQGKIAIPHRSAYAASKHALQAFCDTLRAEVASHNIKVTLISPGYIHTRLSLNAITGSGHTYGEKRSITTLYGAPKDWISSKIKIFLVHSHETVTQCYYRVWAHIWR
ccccccccccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccHHHcccccHHHHHHHHHHHHHccccEEEEEcccccccccc
*****DIPTYAPVVLELDLSDFTTMEERMETALSIFSRIDILINNGGISYRGDIMSTNTDVDYKVMLVNYFGQVAITKALLPSMVRRQSGHIVTVSSVQGKIAIPHRSAYAASKHALQAFCDTLRAEVASHNIKVTLISPGYIHTRLSLNAITGSGHTYGEKRSITTLYGAPKDWISSKIKIFLVHSHETVTQCYYRVWAHIWR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRLADIPTYAPVVLELDLSDFTTMEERMETALSIFSRIDILINNGGISYRGDIMSTNTDVDYKVMLVNYFGQVAITKALLPSMVRRQSGHIVTVSSVQGKIAIPHRSAYAASKHALQAFCDTLRAEVASHNIKVTLISPGYIHTRLSLNAITGSGHTYGEKRSITTLYGAPKDWISSKIKIFLVHSHETVTQCYYRVWAHIWR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dehydrogenase/reductase SDR family member 7B Putative oxidoreductase.confidentQ5RJY4
Dehydrogenase/reductase SDR family member 7B Putative oxidoreductase.confidentQ99J47
Dehydrogenase/reductase SDR family member 7B Putative oxidoreductase.confidentQ0VFE7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0070013 [CC]intracellular organelle lumenprobableGO:0005575, GO:0043233, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0043226, GO:0044422
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050327 [MF]testosterone 17-beta-dehydrogenase (NAD+) activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FN4, chain A
Confidence level:very confident
Coverage over the Query: 8-199
View the alignment between query and template
View the model in PyMOL