Query         psy967
Match_columns 82
No_of_seqs    123 out of 519
Neff          4.4 
Searched_HMMs 46136
Date          Sat Aug 17 01:38:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy967.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/967hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3840|consensus               99.2 1.7E-12 3.6E-17  103.2   1.3   32   44-75    143-174 (438)
  2 KOG0441|consensus               99.1 1.4E-10   3E-15   83.2   6.0   47    4-50      2-51  (154)
  3 PLN02386 superoxide dismutase   99.0 5.3E-10 1.2E-14   78.9   6.3   47    4-51      2-50  (152)
  4 PLN02642 copper, zinc superoxi  99.0 8.4E-10 1.8E-14   79.3   6.1   47    4-51      8-56  (164)
  5 PLN02957 copper, zinc superoxi  98.8 1.3E-08 2.7E-13   75.3   6.0   47    4-51     81-128 (238)
  6 cd00305 Cu-Zn_Superoxide_Dismu  98.7 4.3E-08 9.3E-13   67.7   6.2   45    5-51      2-49  (144)
  7 PF00080 Sod_Cu:  Copper/zinc s  98.7 4.7E-08   1E-12   66.3   5.1   47    6-52      1-50  (142)
  8 PRK15388 Cu/Zn superoxide dism  98.5 4.3E-07 9.3E-12   66.1   6.1   36   14-51     38-74  (177)
  9 PRK10290 superoxide dismutase;  98.4 1.1E-06 2.5E-11   63.5   6.0   36   14-51     36-72  (173)
 10 KOG4656|consensus               97.5 6.4E-05 1.4E-09   57.3   2.7   41    8-49     86-128 (247)
 11 COG2032 SodC Cu/Zn superoxide   97.0   0.001 2.2E-08   48.9   4.4   44    5-50     30-76  (179)
 12 PF02214 BTB_2:  BTB/POZ domain  88.2    0.16 3.5E-06   31.7   0.2   24   49-72     49-73  (94)
 13 KOG3713|consensus               83.8    0.59 1.3E-05   38.9   1.5   25   49-73     88-112 (477)
 14 PLN02804 chalcone isomerase     79.8       4 8.6E-05   30.6   4.4   45   18-63    142-186 (206)
 15 PF07452 CHRD:  CHRD domain;  I  77.3     9.8 0.00021   24.5   5.3   38   14-51     19-57  (119)
 16 smart00754 CHRD A domain in th  69.9      18 0.00039   23.5   5.2   36   14-50     19-55  (118)
 17 KOG4390|consensus               59.4     4.7  0.0001   34.1   1.1   21   50-70     88-108 (632)
 18 PF07830 PP2C_C:  Protein serin  52.3     6.2 0.00013   25.6   0.5   11   36-46     59-69  (81)
 19 PF11789 zf-Nse:  Zinc-finger o  49.1      11 0.00024   22.5   1.3   16   54-69     37-53  (57)
 20 KOG3805|consensus               46.4     9.8 0.00021   30.9   0.9   18   52-69    329-346 (361)
 21 smart00225 BTB Broad-Complex,   46.1     9.6 0.00021   21.4   0.7   22   49-70     47-68  (90)
 22 PLN02559 chalcone--flavonone i  45.2      47   0.001   25.5   4.4   44   18-62    148-192 (230)
 23 PTZ00415 transmission-blocking  43.6      14 0.00031   36.3   1.7   37   29-65   1930-1968(2849)
 24 PF03201 HMD:  H2-forming N5,N1  42.2     7.2 0.00016   26.4  -0.3   23   48-70     14-38  (98)
 25 KOG3148|consensus               39.8      26 0.00056   27.1   2.3   28   35-66     35-62  (273)
 26 PF14289 DUF4369:  Domain of un  37.6      29 0.00063   21.1   1.9   16   28-43     11-26  (106)
 27 PF08896 DUF1842:  Domain of un  35.6      62  0.0013   22.1   3.4   12   14-25     32-43  (114)
 28 smart00695 DUSP Domain in ubiq  33.1      33 0.00073   20.9   1.7   26   38-63     50-75  (86)
 29 cd00525 AE_Prim_S_like AE_Prim  31.5      42  0.0009   21.7   2.0   27   43-74     98-127 (136)
 30 KOG1332|consensus               30.1      29 0.00064   27.5   1.3   27   47-73      9-35  (299)
 31 PF00791 ZU5:  ZU5 domain;  Int  28.8      41 0.00088   21.8   1.6   21   60-80     11-34  (103)
 32 COG1993 PII-like signaling pro  26.6      15 0.00032   25.3  -0.8   18   49-66     39-56  (109)
 33 PF00339 Arrestin_N:  Arrestin   25.6 1.3E+02  0.0028   19.0   3.6   31    8-38     11-41  (149)
 34 cd04487 RecJ_OBF2_like RecJ_OB  25.2      88  0.0019   19.1   2.6   16   30-45      1-16  (73)
 35 KOG1545|consensus               24.4      16 0.00034   30.7  -1.2   24   49-72    109-133 (507)
 36 PF04775 Bile_Hydr_Trans:  Acyl  23.3      52  0.0011   22.1   1.4   12   32-43      5-16  (126)
 37 PF02399 Herpes_ori_bp:  Origin  23.1      38 0.00083   30.3   0.9   19   47-65    582-600 (824)
 38 COG5485 Predicted ester cyclas  23.0 1.3E+02  0.0029   21.3   3.4   25   12-43     72-96  (131)
 39 PF01599 Ribosomal_S27:  Riboso  22.9      22 0.00047   21.0  -0.5    7   55-61      1-7   (47)
 40 PF06337 DUSP:  DUSP domain;  I  21.8      64  0.0014   19.8   1.5   26   38-63     65-90  (99)
 41 PF08462 Carmo_coat_C:  Carmovi  21.2 2.7E+02  0.0059   18.8   4.5   29    9-40     49-77  (99)
 42 PF13742 tRNA_anti_2:  OB-fold   20.6 1.1E+02  0.0023   19.6   2.4   32   28-59     22-63  (99)
 43 PF12816 Vps8:  Golgi CORVET co  20.4      32 0.00068   24.9  -0.2   24   31-63     12-35  (196)

No 1  
>KOG3840|consensus
Probab=99.24  E-value=1.7e-12  Score=103.17  Aligned_cols=32  Identities=44%  Similarity=0.734  Sum_probs=29.3

Q ss_pred             CCceeeehhhHHhhhhhhcceeeCCCCceecc
Q psy967           44 GLNLMNFTVFRAILDYYKGQVIKCPPSVSERA   75 (82)
Q Consensus        44 gfHih~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (82)
                      -...++.+||||||||||+|+|+||++||||+
T Consensus       143 VAdGi~s~vFRAILdYYksG~iRCP~~vSvpE  174 (438)
T KOG3840|consen  143 VADGMTSSCFRAILDYYQSGTMRCPSSVSVSE  174 (438)
T ss_pred             hhcchhHHHHHHHHHHHhcCceeCCCCCchHH
Confidence            45568899999999999999999999999987


No 2  
>KOG0441|consensus
Probab=99.12  E-value=1.4e-10  Score=83.17  Aligned_cols=47  Identities=36%  Similarity=0.633  Sum_probs=43.3

Q ss_pred             eeEEEEecCC--CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeee
Q psy967            4 IKAVCVLNNE--PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNF   50 (82)
Q Consensus         4 ~kAVcVL~G~--~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~   50 (82)
                      ++|+++|.|+  +|.|+|+|+|..++.+++|+++|+||+||. |||+|.+
T Consensus         2 ~~~~avl~g~~~~V~G~i~F~Q~~~~~~~~v~~~i~GL~pg~hgfHvHqf   51 (154)
T KOG0441|consen    2 AQAVAVLEGDEIQVIGVITFEQFLPGEPLRVSGEVTGLPPGKHGFHVHQF   51 (154)
T ss_pred             cceEEEEecCCCCceeEEEEEEcCCCCcEEEEEEEecCCCceeeEEEEec
Confidence            5899999996  799999999987777999999999999995 9999986


No 3  
>PLN02386 superoxide dismutase [Cu-Zn]
Probab=99.04  E-value=5.3e-10  Score=78.88  Aligned_cols=47  Identities=51%  Similarity=0.786  Sum_probs=41.8

Q ss_pred             eeEEEEecCC-CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeeeh
Q psy967            4 IKAVCVLNNE-PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNFT   51 (82)
Q Consensus         4 ~kAVcVL~G~-~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~~   51 (82)
                      ++|+|+|+++ .|.|+|+|+|.. .+++.|+++|+||+||. |||||..-
T Consensus         2 ~~a~a~~~~~~~v~G~v~f~q~~-~g~v~i~~~~~GL~pG~hg~HIHe~G   50 (152)
T PLN02386          2 VKAVAVLNSSEGVKGTIFFTQEG-DGPTTVTGSLSGLKPGLHGFHVHALG   50 (152)
T ss_pred             ceEEEEEcCCCCCEEEEEEEEcC-CCCEEEEEEEeCCCCCceeEEEeCCC
Confidence            6899999987 799999999985 45799999999999995 99999654


No 4  
>PLN02642 copper, zinc superoxide dismutase
Probab=99.00  E-value=8.4e-10  Score=79.29  Aligned_cols=47  Identities=30%  Similarity=0.574  Sum_probs=41.7

Q ss_pred             eeEEEEecCC-CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeeeh
Q psy967            4 IKAVCVLNNE-PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNFT   51 (82)
Q Consensus         4 ~kAVcVL~G~-~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~~   51 (82)
                      .+|+|+|+++ .|.|+|+|+|..+ +.|.|+++|+||+||. |||||..-
T Consensus         8 ~~A~a~~~g~~~v~G~v~f~q~~~-g~v~I~~~v~GL~pG~HG~HIHe~G   56 (164)
T PLN02642          8 LRAVALIAGDNNVRGCLQFVQDIF-GTTHVTGKISGLSPGFHGFHIHSFG   56 (164)
T ss_pred             eeEEEEEcCCCCcEEEEEEEECCC-CcEEEEEEEcCCCCCceeEEEcCCC
Confidence            5899999987 7999999999864 4699999999999995 99999865


No 5  
>PLN02957 copper, zinc superoxide dismutase
Probab=98.79  E-value=1.3e-08  Score=75.33  Aligned_cols=47  Identities=17%  Similarity=0.321  Sum_probs=41.4

Q ss_pred             eeEEEEecCCCeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeeeh
Q psy967            4 IKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNFT   51 (82)
Q Consensus         4 ~kAVcVL~G~~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~~   51 (82)
                      .+|+|.++|+.|+|+|+|+|..+ +.+.|+++|+||+||. |||||..-
T Consensus        81 ~~av~~~~g~~v~G~v~~~~~~~-~~v~i~~~~~GL~pg~hg~hiHe~G  128 (238)
T PLN02957         81 SAAVAEFKGPDIFGVVRFAQVSM-ELARIEAAFSGLSPGTHGWSINEYG  128 (238)
T ss_pred             ceEEEEecCCceEEEEEEEEcCC-CCEEEEEEEcCCCCCcEEEEEcCCC
Confidence            46899999989999999999864 4699999999999994 99999764


No 6  
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD). superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene causes familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Cytoplasmic and periplasmic SODs exist as dimers, whereas chloroplastic and extracellular enzymes exist as tetramers. Structure supports independent functional evolution in prokaryotes (P-class) and eukaryotes (E-class) [PMID:.8176730].
Probab=98.71  E-value=4.3e-08  Score=67.72  Aligned_cols=45  Identities=40%  Similarity=0.625  Sum_probs=40.4

Q ss_pred             eEEEEecCC--CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeeeh
Q psy967            5 KAVCVLNNE--PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNFT   51 (82)
Q Consensus         5 kAVcVL~G~--~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~~   51 (82)
                      +|+|.|++.  ++.|+|+|+|...  .+.|+++++||+||. |||||..-
T Consensus         2 ~a~~~l~~~~g~v~G~v~f~q~~~--~v~v~~~l~GL~pG~hg~HIHe~G   49 (144)
T cd00305           2 SAVAVLKGPDGKVVGTVTFTQQSG--GVTITGELSGLTPGLHGFHIHEFG   49 (144)
T ss_pred             cEEEEEECCCCceEEEEEEEECCC--CEEEEEEEECCCCCceeEEEEecC
Confidence            689999976  6999999999875  699999999999995 99999874


No 7  
>PF00080 Sod_Cu:  Copper/zinc superoxide dismutase (SODC);  InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide []. Superoxide is a normal by-product of aerobic respiration and is produced by a number of reactions, including oxidative phosphorylation and photosynthesis. The dismutase enzymes have a very high catalytic efficiency due to the attraction of superoxide to the ions bound at the active site [, ]. There are three forms of superoxide dismutase, depending on the metal cofactor: Cu/Zn (which binds both copper and zinc), Fe and Mn types. The Fe and Mn forms are similar in their primary, secondary and tertiary structures, but are distinct from the Cu/Zn form []. Prokaryotes and protists contain Mn, Fe or both types, while most eukaryotic organisms utilise the Cu/Zn type.; GO: 0046872 metal ion binding, 0006801 superoxide metabolic process, 0055114 oxidation-reduction process; PDB: 2K4W_A 2APS_B 2WWN_B 2WWO_B 1ESO_A 2AQM_A 3F7L_A 3F7K_A 2E47_A 2E46_A ....
Probab=98.66  E-value=4.7e-08  Score=66.29  Aligned_cols=47  Identities=36%  Similarity=0.446  Sum_probs=41.7

Q ss_pred             EEEEecCC--CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeeehh
Q psy967            6 AVCVLNNE--PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNFTV   52 (82)
Q Consensus         6 AVcVL~G~--~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~~~   52 (82)
                      |+|+|++.  .|+|+|+|+|..++..+.|+.++.||+||. ++|||..-+
T Consensus         1 a~a~l~~~~~~v~G~v~f~q~~~~~~~~v~~~~~GL~~g~~~~hIH~~g~   50 (142)
T PF00080_consen    1 AVAVLKGAGGKVKGTVTFTQVSDGDGVQVTVSLNGLPPGQHGYHIHENGD   50 (142)
T ss_dssp             EEEEEBETSSSEEEEEEEEEETTTTEEEEEEEEESSSSEEEEEEEESSST
T ss_pred             CEEEEeCCCCCeEEEEEEEEeCCCCCEEEEEEEECCCCCCceEEEEeccc
Confidence            79999953  899999999999776799999999999985 999998654


No 8  
>PRK15388 Cu/Zn superoxide dismutase; Provisional
Probab=98.47  E-value=4.3e-07  Score=66.11  Aligned_cols=36  Identities=17%  Similarity=0.227  Sum_probs=31.9

Q ss_pred             CeEEEEEEEEcCCCCCeEEEEEEecCCCC-cCCceeeeh
Q psy967           14 PVKGTIFFTQEHADSPVKVTGEIQGLEED-GGLNLMNFT   51 (82)
Q Consensus        14 ~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg-~gfHih~~~   51 (82)
                      ++.|+|+|+|.. ++ ++|+++++||+|| +|||||..-
T Consensus        38 ~~~G~v~f~~~~-~g-v~I~~~l~GL~pG~HGfHIHe~G   74 (177)
T PRK15388         38 ENIGEITVSETP-YG-LLFTPHLNGLTPGIHGFHVHTNP   74 (177)
T ss_pred             ceEEEEEEEEcC-Cc-EEEEEEEcCCCCcceEEEEccCC
Confidence            899999999986 33 9999999999999 499999864


No 9  
>PRK10290 superoxide dismutase; Provisional
Probab=98.35  E-value=1.1e-06  Score=63.55  Aligned_cols=36  Identities=11%  Similarity=0.261  Sum_probs=32.0

Q ss_pred             CeEEEEEEEEcCCCCCeEEEEEEecCCCC-cCCceeeeh
Q psy967           14 PVKGTIFFTQEHADSPVKVTGEIQGLEED-GGLNLMNFT   51 (82)
Q Consensus        14 ~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg-~gfHih~~~   51 (82)
                      ++.|+++|+|...  .|+|+++++||+|| +|||||..-
T Consensus        36 ~~~G~v~f~~~~~--gv~i~~~l~GL~pG~HGfHIHe~G   72 (173)
T PRK10290         36 QSIGSVTITETDK--GLEFSPDLKALPPGEHGFHIHAKG   72 (173)
T ss_pred             ceEEEEEEEEcCC--cEEEEEEEcCCCCCceEEEEeCCC
Confidence            8999999999863  39999999999999 499999864


No 10 
>KOG4656|consensus
Probab=97.52  E-value=6.4e-05  Score=57.27  Aligned_cols=41  Identities=22%  Similarity=0.450  Sum_probs=35.0

Q ss_pred             EEecCC-CeEEEEEEEEcCCCCCeEEEEEEecCCCC-cCCceee
Q psy967            8 CVLNNE-PVKGTIFFTQEHADSPVKVTGEIQGLEED-GGLNLMN   49 (82)
Q Consensus         8 cVL~G~-~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg-~gfHih~   49 (82)
                      +.+.|+ .|.|.|+|.|-.++ .+.|.|.+.||+|| +|.|||.
T Consensus        86 a~~~~~~~v~GvvRf~qvt~e-k~lid~tvdGlspG~h~~~Ihe  128 (247)
T KOG4656|consen   86 AKYTGPQAVQGVVRFVQVTEE-KTLIDGTVDGLSPGLHGLHIHE  128 (247)
T ss_pred             HHhcCCccceeEEEEEEeccc-cEEEEEEecCCCCcccceeEee
Confidence            444566 89999999999976 69999999999999 4899985


No 11 
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism]
Probab=97.03  E-value=0.001  Score=48.90  Aligned_cols=44  Identities=25%  Similarity=0.289  Sum_probs=35.5

Q ss_pred             eEEEEecC-C-CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeee
Q psy967            5 KAVCVLNN-E-PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNF   50 (82)
Q Consensus         5 kAVcVL~G-~-~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~   50 (82)
                      ++.+++.. + ++-|+|+++|...+  +.++-.+.||+||. |||||..
T Consensus        30 ~~~~~~~~~~G~~vG~vt~~e~~~g--~~~~~~~~~L~pg~hGfHIHe~   76 (179)
T COG2032          30 KANAVLVDGTGKDVGTVTITETGYG--LLFTPALGGLPPGEHGFHIHEK   76 (179)
T ss_pred             cceeeccCCCCceeEEEEEeecCCc--eEEeecccCCCCcceeEEeccc
Confidence            55556653 2 77899999998743  99999999999995 9999964


No 12 
>PF02214 BTB_2:  BTB/POZ domain;  InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. The Kv family can be divided into several subfamilies on the basis of sequence similarity and function. Four of these subfamilies, Kv1 (Shaker), Kv2 (Shab), Kv3 (Shaw) and Kv4 (Shal), consist of pore-forming alpha subunits that associate with different types of beta subunit. Each alpha subunit comprises six hydrophobic TM domains with a P-domain between the fifth and sixth, which partially resides in the membrane. The fourth TM domain has positively charged residues at every third residue and acts as a voltage sensor, which triggers the conformational change that opens the channel pore in response to a displacement in membrane potential []. More recently, 4 new electrically-silent alpha subunits have been cloned: Kv5 (KCNF), Kv6 (KCNG), Kv8 and Kv9 (KCNS). These subunits do not themselves possess any functional activity, but appear to form heteromeric channels with Kv2 subunits, and thus modulate Shab channel activity []. When highly expressed, they inhibit channel activity, but at lower levels show more specific modulatory actions. The N-terminal, cytoplasmic tetramerization domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels []. This domain is found in a subset of a larger group of proteins that contain the BTB/POZ domain.; GO: 0005249 voltage-gated potassium channel activity, 0006813 potassium ion transport, 0008076 voltage-gated potassium channel complex, 0016020 membrane; PDB: 1NN7_A 3KVT_A 1EXB_E 1QDV_A 1DSX_E 1QDW_F 3LUT_B 3LNM_B 2A79_B 3DRY_C ....
Probab=88.16  E-value=0.16  Score=31.65  Aligned_cols=24  Identities=21%  Similarity=0.468  Sum_probs=16.2

Q ss_pred             eehhhHHhhhhhhc-ceeeCCCCce
Q psy967           49 NFTVFRAILDYYKG-QVIKCPPSVS   72 (82)
Q Consensus        49 ~~~~~~~~~~~~~~-~~~~~~~~~~   72 (82)
                      +...|+.||+||++ +.+..|+.+.
T Consensus        49 dp~~F~~IL~ylr~~~~l~~~~~~~   73 (94)
T PF02214_consen   49 DPELFEYILNYLRTGGKLPIPDEIC   73 (94)
T ss_dssp             -HHHHHHHHHHHHHTSSB---TTS-
T ss_pred             ChhhhhHHHHHHhhcCccCCCCchh
Confidence            45799999999999 7777776554


No 13 
>KOG3713|consensus
Probab=83.84  E-value=0.59  Score=38.94  Aligned_cols=25  Identities=20%  Similarity=0.487  Sum_probs=21.7

Q ss_pred             eehhhHHhhhhhhcceeeCCCCcee
Q psy967           49 NFTVFRAILDYYKGQVIKCPPSVSE   73 (82)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~~~~~~~~   73 (82)
                      +..+|+.||+||.+|.+.||..+-.
T Consensus        88 ~P~~F~~Vl~fYrtGkLH~p~~vC~  112 (477)
T KOG3713|consen   88 HPGAFAYVLNFYRTGKLHVPADVCP  112 (477)
T ss_pred             ChHHHHHHHHHHhcCeeccccccch
Confidence            4578999999999999999987643


No 14 
>PLN02804 chalcone isomerase
Probab=79.76  E-value=4  Score=30.56  Aligned_cols=45  Identities=22%  Similarity=0.353  Sum_probs=35.5

Q ss_pred             EEEEEEcCCCCCeEEEEEEecCCCCcCCceeeehhhHHhhhhhhcc
Q psy967           18 TIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQ   63 (82)
Q Consensus        18 tV~FtQ~~~~~~V~ItG~I~GL~Pg~gfHih~~~~~~~~~~~~~~~   63 (82)
                      .|.|+|....+.+.|.....| +.-...-|.|..+-+|+||.|=+|
T Consensus       142 ~I~ft~~~~~g~l~Isfs~dg-~e~~~~~Ienk~l~~avl~~yi~G  186 (206)
T PLN02804        142 IITYHFPATSGIVEISFSTEG-KEESKLTVENANVVEMIQKWYLGG  186 (206)
T ss_pred             EEEEEecCCCCeEEEEEecCC-cccceeEEecHHHHHHHHHHHhcC
Confidence            579999753456889999888 433455699999999999999866


No 15 
>PF07452 CHRD:  CHRD domain;  InterPro: IPR010895 CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins. This family includes bacterial homologues. It is anticipated to have an immunoglobulin-like beta-barrel structure based on limited similarity to superoxide dismutases but, as yet, no clear functional prediction can be made [].
Probab=77.27  E-value=9.8  Score=24.46  Aligned_cols=38  Identities=16%  Similarity=0.289  Sum_probs=28.9

Q ss_pred             CeEEEEEEEEcCCCCCeEEEEEEecCCCC-cCCceeeeh
Q psy967           14 PVKGTIFFTQEHADSPVKVTGEIQGLEED-GGLNLMNFT   51 (82)
Q Consensus        14 ~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg-~gfHih~~~   51 (82)
                      ..+|...|+=+.+...+..+..+.||+.. ...|||.+.
T Consensus        19 ~a~G~a~~~l~~~~~~l~y~i~~~gl~~~~~~~hih~~~   57 (119)
T PF07452_consen   19 SASGTAWFTLDDDGNTLHYSITLSGLSSPPTAAHIHQGA   57 (119)
T ss_pred             CCEEEEEEEEECCCCEEEEEEEEeCCCCCcEEEEEEcCC
Confidence            46799988888765578889999999333 479998643


No 16 
>smart00754 CHRD A domain in the BMP inhibitor chordin and in microbial proteins.
Probab=69.93  E-value=18  Score=23.46  Aligned_cols=36  Identities=17%  Similarity=0.267  Sum_probs=28.6

Q ss_pred             CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeee
Q psy967           14 PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNF   50 (82)
Q Consensus        14 ~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~   50 (82)
                      +..|...|+-+. +..+..+..+.||+.-. ..|||.+
T Consensus        19 ~a~G~a~~~l~~-~~~l~y~i~~~gl~~~~~~~hih~~   55 (118)
T smart00754       19 GAVGGAWFTLDD-DGSLHYQVTLSGLSGPETAAHIHEG   55 (118)
T ss_pred             CcEEEEEEEECC-CCEEEEEEEEcccCCCceeeeEecc
Confidence            668999998885 45788889999998754 7899863


No 17 
>KOG4390|consensus
Probab=59.45  E-value=4.7  Score=34.10  Aligned_cols=21  Identities=24%  Similarity=0.646  Sum_probs=18.5

Q ss_pred             ehhhHHhhhhhhcceeeCCCC
Q psy967           50 FTVFRAILDYYKGQVIKCPPS   70 (82)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~~~   70 (82)
                      -.+||-||.||.+|-+.||--
T Consensus        88 PdiFRhvLnFYRTGkLHyPR~  108 (632)
T KOG4390|consen   88 PDIFRHVLNFYRTGKLHYPRH  108 (632)
T ss_pred             hHHHHHHHHHhhcCcccCchH
Confidence            358999999999999999953


No 18 
>PF07830 PP2C_C:  Protein serine/threonine phosphatase 2C, C-terminal domain;  InterPro: IPR012911 Protein phosphatase 2C (PP2C) is involved in regulating cellular responses to stress in various eukaryotes. It consists of two domains: an N-terminal catalytic domain and a C-terminal domain characteristic of mammalian PP2Cs. This domain consists of three antiparallel alpha helices, one of which packs against two corresponding alpha-helices of the N-terminal domain. The C-terminal domain does not seem to play a role in catalysis, but it may provide protein substrate specificity due to the cleft that is created between it and the catalytic domain []. ; GO: 0000287 magnesium ion binding, 0004721 phosphoprotein phosphatase activity, 0030145 manganese ion binding; PDB: 2P8E_A 3FXL_A 3FXO_A 1A6Q_A 3FXK_A 3FXM_A 3FXJ_A.
Probab=52.26  E-value=6.2  Score=25.61  Aligned_cols=11  Identities=55%  Similarity=0.921  Sum_probs=6.7

Q ss_pred             EecCCCCcCCc
Q psy967           36 IQGLEEDGGLN   46 (82)
Q Consensus        36 I~GL~Pg~gfH   46 (82)
                      |-|||||+|+|
T Consensus        59 ip~LPPGGGl~   69 (81)
T PF07830_consen   59 IPGLPPGGGLA   69 (81)
T ss_dssp             -SS--TTTTCG
T ss_pred             CCCCcCCcCHH
Confidence            77999998775


No 19 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=49.10  E-value=11  Score=22.47  Aligned_cols=16  Identities=38%  Similarity=0.787  Sum_probs=11.6

Q ss_pred             HHhhhhh-hcceeeCCC
Q psy967           54 RAILDYY-KGQVIKCPP   69 (82)
Q Consensus        54 ~~~~~~~-~~~~~~~~~   69 (82)
                      .+|++|+ +.+..+||-
T Consensus        37 ~aI~~~i~~~~~~~CPv   53 (57)
T PF11789_consen   37 EAILQYIQRNGSKRCPV   53 (57)
T ss_dssp             HHHHHHCTTTS-EE-SC
T ss_pred             HHHHHHHHhcCCCCCCC
Confidence            5889999 778999995


No 20 
>KOG3805|consensus
Probab=46.40  E-value=9.8  Score=30.85  Aligned_cols=18  Identities=39%  Similarity=0.696  Sum_probs=15.0

Q ss_pred             hhHHhhhhhhcceeeCCC
Q psy967           52 VFRAILDYYKGQVIKCPP   69 (82)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~   69 (82)
                      .=|+|-.|||.|+|+=|.
T Consensus       329 lsRslRqYyKkGiikK~e  346 (361)
T KOG3805|consen  329 LSRSLRQYYKKGIIKKPE  346 (361)
T ss_pred             HHHHHHHHhhcCccccch
Confidence            348999999999998654


No 21 
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac. Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.
Probab=46.05  E-value=9.6  Score=21.42  Aligned_cols=22  Identities=23%  Similarity=0.395  Sum_probs=18.9

Q ss_pred             eehhhHHhhhhhhcceeeCCCC
Q psy967           49 NFTVFRAILDYYKGQVIKCPPS   70 (82)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~~~~~   70 (82)
                      +...|+.+|+|..++.+..|++
T Consensus        47 ~~~~f~~~l~~ly~~~~~~~~~   68 (90)
T smart00225       47 SPEDFRALLEFLYTGKLDLPEE   68 (90)
T ss_pred             CHHHHHHHHHeecCceeecCHH
Confidence            5678999999999998887765


No 22 
>PLN02559 chalcone--flavonone isomerase
Probab=45.18  E-value=47  Score=25.46  Aligned_cols=44  Identities=23%  Similarity=0.299  Sum_probs=33.2

Q ss_pred             EEEEEEcCCCCCeEEEEEEec-CCCCcCCceeeehhhHHhhhhhhc
Q psy967           18 TIFFTQEHADSPVKVTGEIQG-LEEDGGLNLMNFTVFRAILDYYKG   62 (82)
Q Consensus        18 tV~FtQ~~~~~~V~ItG~I~G-L~Pg~gfHih~~~~~~~~~~~~~~   62 (82)
                      .|.|+|.. .+...|+-.=.| +|.....-|-|..+-+|+||.|=|
T Consensus       148 ~I~ft~sp-~g~L~isfs~dg~ipe~~~~~Ienk~l~eAv~e~~IG  192 (230)
T PLN02559        148 SILFTHSP-TGSLTVAFSKDSSVPEVGNAVIENKLLCEAVLESIIG  192 (230)
T ss_pred             EEEEEECC-CCcEEEEEecCCCCCccceEEEechHHHHHHHHHHcc
Confidence            57999985 456766655444 455567789999999999999974


No 23 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=43.63  E-value=14  Score=36.30  Aligned_cols=37  Identities=35%  Similarity=0.711  Sum_probs=30.5

Q ss_pred             CeEE-EEEEecCCCCcCCceeeehhhHHh-hhhhhccee
Q psy967           29 PVKV-TGEIQGLEEDGGLNLMNFTVFRAI-LDYYKGQVI   65 (82)
Q Consensus        29 ~V~I-tG~I~GL~Pg~gfHih~~~~~~~~-~~~~~~~~~   65 (82)
                      .|+| .|.|-|++=--||-+.+-.||..+ |||||+.+-
T Consensus      1930 ~v~i~kgd~fg~~cpkgf~~~p~~cfs~v~l~yyk~~~~ 1968 (2849)
T PTZ00415       1930 SVKIAKGDIFGIKCPKGFAIFPEACFSNVLLDYYKGDLE 1968 (2849)
T ss_pred             EEEeecCceeeeecCCccEECchHhhhhhhHHHhccchh
Confidence            3566 789999887679999999999875 799998653


No 24 
>PF03201 HMD:  H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase;  InterPro: IPR004889  This entry represents the C-terminal domain of H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenases. The N(5),N(10)-methylenetetrahydromethanopterin dehydrogenase system of methanogenic archaea is composed of H2-forming methylenetetrahydromethanopterin dehydrogenase (Hmd, represented by this entry) and F420-dependent methylenetetrahydromethanopterin dehydrogenase (IPR002844 from INTERPRO) [, ]. Hmd is an iron-sulphur-cluster-free enzyme that contains an intrinsic CO ligand bound to iron []. This domain is found at the C terminus of two distinct subgroups: one has been experimentally characterised as H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase (Hmd or HmdI), and the other one contains isozymes that have not been experimentally characterised (HmdII and HmdIII). Because all three isozyme forms are present in each of the corresponding sequenced genomes, it has been suggested that HmdII and HmdIII may not exhibit Hmd activity and may have a different biological function [].; GO: 0018537 coenzyme F420-dependent N5,N10-methenyltetrahydromethanopterin reductase activity, 0047068 N5,N10-methenyltetrahydromethanopterin hydrogenase activity, 0015948 methanogenesis, 0055114 oxidation-reduction process; PDB: 3F46_A 2B0J_A 3DAG_A 3DAF_A 3H65_A 3F47_A.
Probab=42.17  E-value=7.2  Score=26.41  Aligned_cols=23  Identities=26%  Similarity=0.660  Sum_probs=15.7

Q ss_pred             eeehhhHHhhhhhhc--ceeeCCCC
Q psy967           48 MNFTVFRAILDYYKG--QVIKCPPS   70 (82)
Q Consensus        48 h~~~~~~~~~~~~~~--~~~~~~~~   70 (82)
                      .+|.+|-.|||||..  .+++-|..
T Consensus        14 vTAv~~agiL~Y~~v~t~il~AP~~   38 (98)
T PF03201_consen   14 VTAVTYAGILDYYDVGTKILGAPAD   38 (98)
T ss_dssp             HHHHHHHHHHHHHHHHHHTS---HH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcChHH
Confidence            367889999999998  46666643


No 25 
>KOG3148|consensus
Probab=39.77  E-value=26  Score=27.11  Aligned_cols=28  Identities=18%  Similarity=0.555  Sum_probs=21.6

Q ss_pred             EEecCCCCcCCceeeehhhHHhhhhhhcceee
Q psy967           35 EIQGLEEDGGLNLMNFTVFRAILDYYKGQVIK   66 (82)
Q Consensus        35 ~I~GL~Pg~gfHih~~~~~~~~~~~~~~~~~~   66 (82)
                      -+.|||-|+    -+--+|..+++|||.|.+.
T Consensus        35 f~lglptgs----tplg~ykklie~~k~g~~s   62 (273)
T KOG3148|consen   35 FVLGLPTGS----TPLGMYKKLIEFYKNGVLS   62 (273)
T ss_pred             EEEecCCCC----CchhHHHHHHHHHhcCceE
Confidence            446888875    2456999999999999864


No 26 
>PF14289 DUF4369:  Domain of unknown function (DUF4369)
Probab=37.60  E-value=29  Score=21.11  Aligned_cols=16  Identities=25%  Similarity=0.613  Sum_probs=13.1

Q ss_pred             CCeEEEEEEecCCCCc
Q psy967           28 SPVKVTGEIQGLEEDG   43 (82)
Q Consensus        28 ~~V~ItG~I~GL~Pg~   43 (82)
                      ...+|+|+|.|++.|.
T Consensus        11 ~~~~I~G~i~~~~~~~   26 (106)
T PF14289_consen   11 KQFTIEGKIKGLPDGD   26 (106)
T ss_pred             CcEEEEEEEcCCCCCC
Confidence            4689999999997764


No 27 
>PF08896 DUF1842:  Domain of unknown function (DUF1842);  InterPro: IPR014992 This domain is found at the N terminus of proteins that are functionally uncharacterised. 
Probab=35.56  E-value=62  Score=22.09  Aligned_cols=12  Identities=33%  Similarity=0.340  Sum_probs=7.2

Q ss_pred             CeEEEEEEEEcC
Q psy967           14 PVKGTIFFTQEH   25 (82)
Q Consensus        14 ~VsGtV~FtQ~~   25 (82)
                      .|+|....+|..
T Consensus        32 ~VsG~a~ItQat   43 (114)
T PF08896_consen   32 SVSGRARITQAT   43 (114)
T ss_pred             EEEeEEEEEEec
Confidence            566666666643


No 28 
>smart00695 DUSP Domain in ubiquitin-specific proteases.
Probab=33.12  E-value=33  Score=20.88  Aligned_cols=26  Identities=19%  Similarity=0.385  Sum_probs=22.4

Q ss_pred             cCCCCcCCceeeehhhHHhhhhhhcc
Q psy967           38 GLEEDGGLNLMNFTVFRAILDYYKGQ   63 (82)
Q Consensus        38 GL~Pg~gfHih~~~~~~~~~~~~~~~   63 (82)
                      +|..+..|-+.+..+|+.+..+|.+|
T Consensus        50 ~l~~~~dy~~V~~~vW~~l~~~YGgg   75 (86)
T smart00695       50 HLVEGEDYVLIPEELWNKLVSWYGGG   75 (86)
T ss_pred             ccccCCCEEEeCHHHHHHHHHHHCCC
Confidence            45555689999999999999999998


No 29 
>cd00525 AE_Prim_S_like AE_Prim_S_like: primase domain similar to that found in the small subunit of archaeal and eukaryotic (A/E) DNA primases. The replication machineries of A/Es are distinct from that of bacteria. Primases are DNA-dependent RNA polymerases which synthesis the short RNA primers required for DNA replication. In eukaryotes, this small catalytically active primase subunit (p50) and a larger primase subunit (p60), referred to jointly as the core primase, associate with the B subunit and the DNA polymerase alpha subunit in a complex, called Pol alpha-pri. In addition to its catalytic role in replication, eukaryotic DNA primase may play a role in coupling replication to DNA damage repair and in checkpoint control during S phase. Pfu41 and Pfu46 comprise the primase complex of the archaea Pyrococcus furiosus; these proteins have sequence identity to the eukaryotic p50 and p60 primase proteins respectively. Pfu41 preferentially uses dNTPs as substrate. Pfu46 regulates the pri
Probab=31.48  E-value=42  Score=21.66  Aligned_cols=27  Identities=33%  Similarity=0.560  Sum_probs=21.2

Q ss_pred             cCCceeeehhhHHhhhhhh---cceeeCCCCceec
Q psy967           43 GGLNLMNFTVFRAILDYYK---GQVIKCPPSVSER   74 (82)
Q Consensus        43 ~gfHih~~~~~~~~~~~~~---~~~~~~~~~~~~~   74 (82)
                      .|+|+.-.-     +|+-.   ++.+.+|+|+--.
T Consensus        98 ~G~H~~~~~-----iDi~~~~~~~~~v~p~S~~~~  127 (136)
T cd00525          98 RGLHVYVRL-----IDIRVNARGRLLVAPPSVHPR  127 (136)
T ss_pred             CEEEEEEEe-----cceeccCCCCeEEcCCCcCCC
Confidence            578876544     99988   4999999998774


No 30 
>KOG1332|consensus
Probab=30.09  E-value=29  Score=27.54  Aligned_cols=27  Identities=22%  Similarity=0.370  Sum_probs=22.7

Q ss_pred             eeeehhhHHhhhhhhcceeeCCCCcee
Q psy967           47 LMNFTVFRAILDYYKGQVIKCPPSVSE   73 (82)
Q Consensus        47 ih~~~~~~~~~~~~~~~~~~~~~~~~~   73 (82)
                      .|.-++-.+.||||..-+-.|-+.=+|
T Consensus         9 ~H~D~IHda~lDyygkrlATcsSD~tV   35 (299)
T KOG1332|consen    9 QHEDMIHDAQLDYYGKRLATCSSDGTV   35 (299)
T ss_pred             hhhhhhhHhhhhhhcceeeeecCCccE
Confidence            578889999999999999999875444


No 31 
>PF00791 ZU5:  ZU5 domain;  InterPro: IPR000906 This is a domain of unknown function, present in ZO-1 and Unc5-like netrin receptors. It is also found in different variants of ankyrin, which are responsible for attaching integral membrane proteins to cytoskeletal elements.; PDB: 4D8O_A 3G5B_A 3UD2_C 3KBT_D 3UD1_A 3KBU_D 3F59_A 2KXS_A 2KXR_A.
Probab=28.77  E-value=41  Score=21.83  Aligned_cols=21  Identities=29%  Similarity=0.450  Sum_probs=15.2

Q ss_pred             hhcceeeCCC---CceeccCcccC
Q psy967           60 YKGQVIKCPP---SVSERAGALSD   80 (82)
Q Consensus        60 ~~~~~~~~~~---~~~~~~~~~~~   80 (82)
                      ..||.+++|.   ++.+|+||+..
T Consensus        11 ~~GG~L~l~~~gv~L~IPpGAv~~   34 (103)
T PF00791_consen   11 HEGGRLRLPESGVSLSIPPGAVPK   34 (103)
T ss_dssp             TT-EEEESTTTTEEEEE-TTSSST
T ss_pred             CCCcEEEeCCCCEEEEECCCcCCC
Confidence            3688899888   68899999864


No 32 
>COG1993 PII-like signaling protein [Signal transduction mechanisms]
Probab=26.57  E-value=15  Score=25.30  Aligned_cols=18  Identities=33%  Similarity=0.379  Sum_probs=15.5

Q ss_pred             eehhhHHhhhhhhcceee
Q psy967           49 NFTVFRAILDYYKGQVIK   66 (82)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~   66 (82)
                      -|||||.|.-|++++.+.
T Consensus        39 GATVlRGI~GfG~~~~~h   56 (109)
T COG1993          39 GATVLRGIAGFGKDGKIH   56 (109)
T ss_pred             ceeeeeeeeccCCCCccc
Confidence            489999999999998653


No 33 
>PF00339 Arrestin_N:  Arrestin (or S-antigen), N-terminal domain;  InterPro: IPR011021 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The N-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=25.62  E-value=1.3e+02  Score=19.00  Aligned_cols=31  Identities=10%  Similarity=0.217  Sum_probs=17.8

Q ss_pred             EEecCCCeEEEEEEEEcCCCCCeEEEEEEec
Q psy967            8 CVLNNEPVKGTIFFTQEHADSPVKVTGEIQG   38 (82)
Q Consensus         8 cVL~G~~VsGtV~FtQ~~~~~~V~ItG~I~G   38 (82)
                      ....|+.|+|.|.+.-..+-.--.|.-.+.|
T Consensus        11 ~y~~Ge~I~G~V~l~~~~~~~i~~i~v~l~G   41 (149)
T PF00339_consen   11 VYFPGEVISGKVVLELSKPIKIKSIKVRLKG   41 (149)
T ss_dssp             EEESS--EEEEEEECTTT-TTTSEEEEEEEE
T ss_pred             EECCCCEEEEEEEEEECCccceeEEEEEEEE
Confidence            4556789999999966554343445555555


No 34 
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.
Probab=25.24  E-value=88  Score=19.12  Aligned_cols=16  Identities=25%  Similarity=0.588  Sum_probs=10.2

Q ss_pred             eEEEEEEecCCCCcCC
Q psy967           30 VKVTGEIQGLEEDGGL   45 (82)
Q Consensus        30 V~ItG~I~GL~Pg~gf   45 (82)
                      +.|+|+|.+++..+|+
T Consensus         1 v~v~GeVs~~~~~~GH   16 (73)
T cd04487           1 VHIEGEVVQIKQTSGP   16 (73)
T ss_pred             CEEEEEEeccccCCCC
Confidence            3577888887763344


No 35 
>KOG1545|consensus
Probab=24.41  E-value=16  Score=30.66  Aligned_cols=24  Identities=38%  Similarity=0.588  Sum_probs=18.1

Q ss_pred             eehhhHHhhhhhhcc-eeeCCCCce
Q psy967           49 NFTVFRAILDYYKGQ-VIKCPPSVS   72 (82)
Q Consensus        49 ~~~~~~~~~~~~~~~-~~~~~~~~~   72 (82)
                      +-.-|.+||-|||+| -+|=|-.|.
T Consensus       109 nRpSFdaILYyYQSGGRlrRPvnVP  133 (507)
T KOG1545|consen  109 NRPSFDAILYYYQSGGRLRRPVNVP  133 (507)
T ss_pred             CCCccceEEEEeecCceecCCcccc
Confidence            456799999999964 677776553


No 36 
>PF04775 Bile_Hydr_Trans:  Acyl-CoA thioester hydrolase/BAAT N-terminal region;  InterPro: IPR006862 This entry presents the N-termini of acyl-CoA thioester hydrolase and bile acid-CoA:amino acid N-acetyltransferase (BAAT) []. This region is not thought to contain the active site of either enzyme. Thioesterase isoforms have been identified in peroxisomes, cytoplasm and mitochondria, where they are thought to have distinct functions in lipid metabolism []. For example, in peroxisomes, the hydrolase acts on bile-CoA esters [].; GO: 0016290 palmitoyl-CoA hydrolase activity, 0006629 lipid metabolic process; PDB: 3HLK_B 3K2I_B.
Probab=23.31  E-value=52  Score=22.09  Aligned_cols=12  Identities=25%  Similarity=0.315  Sum_probs=5.7

Q ss_pred             EEEEEecCCCCc
Q psy967           32 VTGEIQGLEEDG   43 (82)
Q Consensus        32 ItG~I~GL~Pg~   43 (82)
                      +.-.|+||+||.
T Consensus         5 ~~I~v~GL~p~~   16 (126)
T PF04775_consen    5 VDIRVSGLPPGQ   16 (126)
T ss_dssp             -EEEEES--TT-
T ss_pred             eEEEEeCCCCCC
Confidence            345567999986


No 37 
>PF02399 Herpes_ori_bp:  Origin of replication binding protein;  InterPro: IPR003450 This entry represents replication origin binding protein. It functions as a docking protein to recruit essential components of the viral replication machinery to viral DNA origins. In the presence of the major DNA-binding protein, it opens dsDNA which leads to a conformational change in the origin that facilitates DNA unwinding and subsequent replication [].; GO: 0003688 DNA replication origin binding, 0005524 ATP binding, 0006260 DNA replication
Probab=23.13  E-value=38  Score=30.30  Aligned_cols=19  Identities=42%  Similarity=0.583  Sum_probs=16.7

Q ss_pred             eeeehhhHHhhhhhhccee
Q psy967           47 LMNFTVFRAILDYYKGQVI   65 (82)
Q Consensus        47 ih~~~~~~~~~~~~~~~~~   65 (82)
                      +++..+|+.+.|||++|.+
T Consensus       582 ~~s~~vf~~~y~~y~sg~v  600 (824)
T PF02399_consen  582 LESEEVFRRIYDHYASGVV  600 (824)
T ss_pred             cccHHHHHHHHHHHhcCCc
Confidence            3678999999999999966


No 38 
>COG5485 Predicted ester cyclase [General function prediction only]
Probab=23.02  E-value=1.3e+02  Score=21.30  Aligned_cols=25  Identities=28%  Similarity=0.553  Sum_probs=19.6

Q ss_pred             CCCeEEEEEEEEcCCCCCeEEEEEEecCCCCc
Q psy967           12 NEPVKGTIFFTQEHADSPVKVTGEIQGLEEDG   43 (82)
Q Consensus        12 G~~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~   43 (82)
                      |+.|.-.++|.-..       +|+|-|||||+
T Consensus        72 ~~~vaarl~Fdctp-------~G~i~Gip~nG   96 (131)
T COG5485          72 GDRVAARLTFDCTP-------SGEIMGIPPNG   96 (131)
T ss_pred             CCceEEEEEEccCc-------CceEeccCCCC
Confidence            55888888997332       68999999987


No 39 
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=22.88  E-value=22  Score=21.00  Aligned_cols=7  Identities=71%  Similarity=1.369  Sum_probs=2.3

Q ss_pred             Hhhhhhh
Q psy967           55 AILDYYK   61 (82)
Q Consensus        55 ~~~~~~~   61 (82)
                      |+|.|||
T Consensus         1 AvlkyYk    7 (47)
T PF01599_consen    1 AVLKYYK    7 (47)
T ss_dssp             S----CE
T ss_pred             CcceEEE
Confidence            6889997


No 40 
>PF06337 DUSP:  DUSP domain;  InterPro: IPR006615 Deubiquitinating enzymes (DUB) form a large family of cysteine protease that can deconjugate ubiquitin or ubiquitin-like proteins (see PDOC00271 from PROSITEDOC) from ubiquitin-conjugated proteins. All DUBs contain a catalytic domain surrounded by one or more subdomains, some of which contribute to target recognition. The ~120-residue DUSP (domain present in ubiquitin-specific proteases) domain is one of these specific subdomains. Single or tandem DUSP domains are located both N- and C-terminal to the ubiquitin carboxyl-terminal hydrolase catalytic core domain (see PDOC00750 from PROSITEDOC) [].  The DUSP domain displays a tripod-like AB3 fold with a three-helix bundle and a three-stranded anti-parallel beta-sheet resembling the legs and seat of the tripod. Conserved residues are predominantly involved in hydrophobic packing interactions within the three alpha-helices. The most conserved DUSP residues, forming the PGPI motif, are flanked by two long loops that vary both in length and sequence. The PGPI motif packs against the three-helix bundle and is highly ordered [].  The function of the DUSP domain is unknown but it may play a role in protein/protein interaction or substrate recognition. This domain is associated with ubiquitin carboxyl-terminal hydrolase family 2 (IPR001394 from INTERPRO, MEROPS peptidase family C19). They are a family 100 to 200 kDa peptides which includes the Ubp1 ubiquitin peptidase from yeast; others include:   Mammalian ubiquitin carboxyl-terminal hydrolase 4 (USP4), Mammalian ubiquitin carboxyl-terminal hydrolase 11 (USP11),  Mammalian ubiquitin carboxyl-terminal hydrolase 15 (USP15),  Mammalian ubiquitin carboxyl-terminal hydrolase 20 (USP20),  Mammalian ubiquitin carboxyl-terminal hydrolase 32 (USP32),  Vertebrate ubiquitin carboxyl-terminal hydrolase 33 (USP33),  Vertebrate ubiquitin carboxyl-terminal hydrolase 48 (USP48).  ; GO: 0004221 ubiquitin thiolesterase activity; PDB: 4A3O_B 3PPA_A 3LMN_A 1W6V_A 3T9L_A 4A3P_A 3PV1_A 3JYU_B.
Probab=21.84  E-value=64  Score=19.84  Aligned_cols=26  Identities=23%  Similarity=0.392  Sum_probs=20.0

Q ss_pred             cCCCCcCCceeeehhhHHhhhhhhcc
Q psy967           38 GLEEDGGLNLMNFTVFRAILDYYKGQ   63 (82)
Q Consensus        38 GL~Pg~gfHih~~~~~~~~~~~~~~~   63 (82)
                      +|..+..|=+.+..+++.+.++|.+|
T Consensus        65 ~l~~~~Dy~~v~~~~W~~l~~~Yggg   90 (99)
T PF06337_consen   65 NLQEGVDYELVPEEVWDYLHSWYGGG   90 (99)
T ss_dssp             S--CTTTEEEEEHHHHHHHHHHH-T-
T ss_pred             cccCCCCEEEECHHHHHHHHHHcCCC
Confidence            67777789999999999999999754


No 41 
>PF08462 Carmo_coat_C:  Carmovirus coat protein;  InterPro: IPR013669 This domain is found to the C terminus of the IPR000937 from INTERPRO domain in Carmoviruses. The coat protein of the Turnip crinkle virus (TCV; Tombusviridae) is a suppressor of RNA silencing and is required for cell to cell movement in its host []. The plant cellular trafficking machinery could hijack functional viral proteins to permit cell-to-cell movement of RNA silencing []. The 3'-proximal coat protein is coded by ORF4 [].; PDB: 1OPO_B.
Probab=21.22  E-value=2.7e+02  Score=18.83  Aligned_cols=29  Identities=14%  Similarity=0.311  Sum_probs=22.0

Q ss_pred             EecCCCeEEEEEEEEcCCCCCeEEEEEEecCC
Q psy967            9 VLNNEPVKGTIFFTQEHADSPVKVTGEIQGLE   40 (82)
Q Consensus         9 VL~G~~VsGtV~FtQ~~~~~~V~ItG~I~GL~   40 (82)
                      +|.|.+.+|.|...-.   .++.+.-.|+.|+
T Consensus        49 ti~GsGaSG~V~y~S~---~~~aV~~vvtnlp   77 (99)
T PF08462_consen   49 TIIGSGASGDVDYESA---RPIAVCEVVTNLP   77 (99)
T ss_dssp             EEESTTEEEEEEEETT---TTEEEEEEEESST
T ss_pred             eeecCCccceEEEeeC---CceEeeeeeccCC
Confidence            3456689999998654   4788888888774


No 42 
>PF13742 tRNA_anti_2:  OB-fold nucleic acid binding domain
Probab=20.60  E-value=1.1e+02  Score=19.59  Aligned_cols=32  Identities=28%  Similarity=0.401  Sum_probs=22.0

Q ss_pred             CCeEEEEEEecCCC-CcCCcee---------eehhhHHhhhh
Q psy967           28 SPVKVTGEIQGLEE-DGGLNLM---------NFTVFRAILDY   59 (82)
Q Consensus        28 ~~V~ItG~I~GL~P-g~gfHih---------~~~~~~~~~~~   59 (82)
                      ..+-|.|+|+++.. +.|+-.+         ++++|+.-+..
T Consensus        22 ~~vwV~GEIs~~~~~~~gh~YftLkD~~a~i~~~~~~~~~~~   63 (99)
T PF13742_consen   22 PNVWVEGEISNLKRHSSGHVYFTLKDEEASISCVIFRSRARR   63 (99)
T ss_pred             CCEEEEEEEeecEECCCceEEEEEEcCCcEEEEEEEHHHHhh
Confidence            46899999999998 4444443         46667665543


No 43 
>PF12816 Vps8:  Golgi CORVET complex core vacuolar protein 8
Probab=20.38  E-value=32  Score=24.90  Aligned_cols=24  Identities=29%  Similarity=0.663  Sum_probs=18.9

Q ss_pred             EEEEEEecCCCCcCCceeeehhhHHhhhhhhcc
Q psy967           31 KVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQ   63 (82)
Q Consensus        31 ~ItG~I~GL~Pg~gfHih~~~~~~~~~~~~~~~   63 (82)
                      ...|+|+.|||         ++|.++++||+..
T Consensus        12 Il~~~i~~lpp---------~v~k~lv~~y~~~   35 (196)
T PF12816_consen   12 ILSGKIKSLPP---------EVFKALVEHYASK   35 (196)
T ss_pred             HHcCCCCCCCH---------HHHHHHHHHHHHC
Confidence            35677888866         8999999999753


Done!