BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9670
         (103 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RZP|A Chain A, Crystal Structure Of The C194a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq1
 pdb|3RZP|B Chain B, Crystal Structure Of The C194a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq1
 pdb|3RZP|C Chain C, Crystal Structure Of The C194a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq1
 pdb|3RZP|D Chain D, Crystal Structure Of The C194a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq1
 pdb|3RJ4|A Chain A, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae
 pdb|3RJ4|B Chain B, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae
 pdb|3UXV|A Chain A, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq
 pdb|3UXV|B Chain B, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq
 pdb|3UXV|C Chain C, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq
 pdb|3UXV|D Chain D, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq
          Length = 290

 Score = 28.1 bits (61), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 32  GALSGFGVSLAKWTFIVRTSTEVTSHENDWLWWLIMAFGCLICIRAFLQYVTIKRSWNTL 91
           GA  G  VS    + +++++  +T+ + DW    I   G      A L+Y+   R  N  
Sbjct: 177 GAAQGEEVSEVLHSHLLKSNALITN-QPDWGSVEIAYHGAKXNREALLRYLVSFREHNEF 235

Query: 92  SEQAQERFF 100
            EQ  ER F
Sbjct: 236 HEQCVERIF 244


>pdb|3RZQ|A Chain A, Crystal Structure Of The H233a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|3RZQ|B Chain B, Crystal Structure Of The H233a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|4GHM|A Chain A, Crystal Structure Of The H233a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|4GHM|B Chain B, Crystal Structure Of The H233a Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
          Length = 290

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 32  GALSGFGVSLAKWTFIVRTSTEVTSHENDWLWWLIMAFGCLICIRAFLQYVTIKRSWNTL 91
           GA  G  VS    + +++++  +T+   DW    I   G      A L+Y+   R  N  
Sbjct: 177 GAAQGEEVSEVLHSHLLKSNCLITNQP-DWGSVEIAYHGAKXNREALLRYLVSFREHNEF 235

Query: 92  SEQAQERFF 100
           +EQ  ER F
Sbjct: 236 AEQCVERIF 244


>pdb|3S19|A Chain A, Crystal Structure Of The R262l Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|3S19|B Chain B, Crystal Structure Of The R262l Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|3S19|C Chain C, Crystal Structure Of The R262l Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|3S19|D Chain D, Crystal Structure Of The R262l Mutant Of
           7-Cyano-7-Deazaguanine Reductase, Quef From Vibrio
           Cholerae Complexed With Preq0
 pdb|3UXJ|A Chain A, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq0
 pdb|3UXJ|B Chain B, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq0
 pdb|3UXJ|C Chain C, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq0
 pdb|3UXJ|D Chain D, Crystal Structure Of 7-Cyano-7-Deazaguanine Reductase,
           Quef From Vibrio Cholerae Complexed With Nadp And Preq0
          Length = 290

 Score = 26.9 bits (58), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 32  GALSGFGVSLAKWTFIVRTSTEVTSHENDWLWWLIMAFGCLICIRAFLQYVTIKRSWNTL 91
           GA  G  VS    + +++++  +T+ + DW    I   G      A L+Y+   R  N  
Sbjct: 177 GAAQGEEVSEVLHSHLLKSNCLITN-QPDWGSVEIAYHGAKXNREALLRYLVSFREHNEF 235

Query: 92  SEQAQERFF 100
            EQ  ER F
Sbjct: 236 HEQCVERIF 244


>pdb|3BP1|A Chain A, Crystal Structure Of Putative 7-Cyano-7-Deazaguanine
           Reductase Quef From Vibrio Cholerae O1 Biovar Eltor
 pdb|3BP1|B Chain B, Crystal Structure Of Putative 7-Cyano-7-Deazaguanine
           Reductase Quef From Vibrio Cholerae O1 Biovar Eltor
 pdb|3BP1|C Chain C, Crystal Structure Of Putative 7-Cyano-7-Deazaguanine
           Reductase Quef From Vibrio Cholerae O1 Biovar Eltor
 pdb|3BP1|D Chain D, Crystal Structure Of Putative 7-Cyano-7-Deazaguanine
           Reductase Quef From Vibrio Cholerae O1 Biovar Eltor
 pdb|4IQI|A Chain A, Crystal Structure Of 7-cyano-7-deazaguanine Reductase,
           Quef From Vibrio Cholerae O1 Biovar El Tor Complexed
           With Cytosine
 pdb|4IQI|B Chain B, Crystal Structure Of 7-cyano-7-deazaguanine Reductase,
           Quef From Vibrio Cholerae O1 Biovar El Tor Complexed
           With Cytosine
          Length = 290

 Score = 26.9 bits (58), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 32  GALSGFGVSLAKWTFIVRTSTEVTSHENDWLWWLIMAFGCLICIRAFLQYVTIKRSWNTL 91
           GA  G  VS    + +++++  +T+ + DW    I   G      A L+Y+   R  N  
Sbjct: 177 GAAQGEEVSEVLHSHLLKSNCLITN-QPDWGSVEIAYHGAKXNREALLRYLVSFREHNEF 235

Query: 92  SEQAQERFF 100
            EQ  ER F
Sbjct: 236 HEQCVERIF 244


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.337    0.143    0.523 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,840,212
Number of Sequences: 62578
Number of extensions: 89766
Number of successful extensions: 302
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 301
Number of HSP's gapped (non-prelim): 5
length of query: 103
length of database: 14,973,337
effective HSP length: 68
effective length of query: 35
effective length of database: 10,718,033
effective search space: 375131155
effective search space used: 375131155
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.8 bits)
S2: 45 (21.9 bits)