Query         psy9695
Match_columns 159
No_of_seqs    120 out of 1154
Neff          11.0
Searched_HMMs 46136
Date          Fri Aug 16 17:15:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9695.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9695hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 4.1E-32 8.8E-37  179.1   2.2  133   13-157   125-260 (279)
  2 KOG2462|consensus               99.9 1.3E-23 2.8E-28  139.1   3.5  105   44-157   128-232 (279)
  3 KOG1074|consensus               99.8 5.5E-20 1.2E-24  137.1   5.1   77   78-157   606-685 (958)
  4 KOG1074|consensus               99.7 3.8E-18 8.3E-23  127.5   1.6   45  106-157   880-924 (958)
  5 KOG3576|consensus               99.7 1.2E-18 2.6E-23  110.8  -3.0  104   44-150   115-222 (267)
  6 KOG3608|consensus               99.7 3.7E-18   8E-23  116.8  -1.4  146    4-156   193-368 (467)
  7 KOG3608|consensus               99.6 1.8E-16 3.9E-21  108.7   2.9  132   17-153   262-399 (467)
  8 KOG3623|consensus               99.6 1.9E-16 4.2E-21  117.2   1.9  112   16-127   208-331 (1007)
  9 KOG3576|consensus               99.6 1.3E-16 2.9E-21  101.6   0.4  119    9-130   108-237 (267)
 10 KOG3623|consensus               99.6 2.6E-16 5.7E-21  116.5   1.0   76   72-154   889-964 (1007)
 11 PHA00733 hypothetical protein   99.3 5.6E-13 1.2E-17   81.4   1.4   97   32-130    26-124 (128)
 12 PHA02768 hypothetical protein;  99.2   2E-11 4.4E-16   62.3   3.0   46   77-124     5-50  (55)
 13 PLN03086 PRLI-interacting fact  99.1 7.3E-11 1.6E-15   87.5   5.2   92   47-154   454-555 (567)
 14 PLN03086 PRLI-interacting fact  99.1 1.6E-11 3.5E-16   90.9   0.8   62   78-151   454-515 (567)
 15 PHA02768 hypothetical protein;  99.0 2.8E-11   6E-16   61.8  -0.8   43  105-156     5-47  (55)
 16 PHA00733 hypothetical protein   99.0   2E-11 4.4E-16   74.6  -2.0   76   73-157    36-116 (128)
 17 PF13465 zf-H2C2_2:  Zinc-finge  99.0 3.2E-10   7E-15   49.7   1.8   26   92-117     1-26  (26)
 18 PHA00616 hypothetical protein   98.5 4.9E-08 1.1E-12   47.6   1.6   34   77-110     1-34  (44)
 19 KOG3993|consensus               98.5 9.4E-08   2E-12   67.9   3.6   77   75-158   354-476 (500)
 20 PHA00616 hypothetical protein   98.5 6.7E-08 1.4E-12   47.1   1.8   34   18-51      1-34  (44)
 21 PHA00732 hypothetical protein   98.5 1.2E-07 2.7E-12   52.9   2.8   47   77-130     1-48  (79)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.4 1.8E-07   4E-12   40.8   2.3   25   33-57      1-25  (26)
 23 PHA00732 hypothetical protein   98.3 7.5E-08 1.6E-12   53.7  -0.6   39  105-153     1-40  (79)
 24 KOG3993|consensus               98.3 5.2E-08 1.1E-12   69.2  -1.9   81   47-131   268-381 (500)
 25 COG5189 SFP1 Putative transcri  98.1 1.2E-06 2.5E-11   60.4   1.7   55  103-157   347-415 (423)
 26 PF05605 zf-Di19:  Drought indu  98.1 2.8E-06   6E-11   44.1   2.3   49   77-128     2-52  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  97.9 8.8E-06 1.9E-10   34.3   1.5   22   78-99      1-22  (23)
 28 COG5189 SFP1 Putative transcri  97.8 1.3E-05 2.8E-10   55.4   2.4   53   75-127   347-420 (423)
 29 PF00096 zf-C2H2:  Zinc finger,  97.8 1.5E-05 3.4E-10   33.5   1.7   23   19-41      1-23  (23)
 30 PF05605 zf-Di19:  Drought indu  97.7 5.9E-06 1.3E-10   42.8  -0.1   41  105-151     2-42  (54)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.7 3.1E-06 6.8E-11   37.3  -1.5   22   78-99      2-23  (27)
 32 PF09237 GAGA:  GAGA factor;  I  97.6 9.5E-05   2E-09   37.0   3.2   42    5-46     11-52  (54)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.5 9.2E-05   2E-09   31.2   2.0   23   19-41      1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.5 6.1E-05 1.3E-09   33.0   1.4   26  105-131     1-26  (27)
 35 PF13894 zf-C2H2_4:  C2H2-type   97.5  0.0001 2.2E-09   31.1   1.9   23   78-100     1-23  (24)
 36 PF12756 zf-C2H2_2:  C2H2 type   97.4 2.3E-05   5E-10   45.8  -0.8   76   48-131     1-76  (100)
 37 PRK04860 hypothetical protein;  97.3 0.00014 3.1E-09   46.2   2.2   39   77-119   119-157 (160)
 38 PF12756 zf-C2H2_2:  C2H2 type   97.1 0.00041 8.9E-09   40.4   2.5   74   20-101     1-74  (100)
 39 PF09237 GAGA:  GAGA factor;  I  97.0   0.001 2.2E-08   33.3   2.6   34   72-105    19-52  (54)
 40 smart00355 ZnF_C2H2 zinc finge  96.9  0.0011 2.4E-08   28.2   2.5   22   79-100     2-23  (26)
 41 PRK04860 hypothetical protein;  96.9 0.00016 3.5E-09   46.0  -0.6   40  105-155   119-158 (160)
 42 smart00355 ZnF_C2H2 zinc finge  96.9  0.0011 2.4E-08   28.1   2.3   24   19-42      1-24  (26)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00047   1E-08   30.1  -0.5   20  106-125     2-21  (27)
 44 PF12874 zf-met:  Zinc-finger o  96.2  0.0032 6.9E-08   26.8   1.3   22   19-40      1-22  (25)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0047   1E-07   26.0   1.7   23   19-42      1-23  (24)
 46 PF13909 zf-H2C2_5:  C2H2-type   95.9  0.0063 1.4E-07   25.6   1.6   22   78-100     1-22  (24)
 47 PF12874 zf-met:  Zinc-finger o  95.9  0.0043 9.2E-08   26.4   0.9   20   79-98      2-21  (25)
 48 COG4049 Uncharacterized protei  95.6   0.008 1.7E-07   30.7   1.4   37    5-41      4-40  (65)
 49 cd00350 rubredoxin_like Rubred  95.5  0.0081 1.8E-07   27.6   1.1   10  104-113    16-25  (33)
 50 KOG1146|consensus               95.1   0.029 6.2E-07   46.5   3.9  128   15-154   462-632 (1406)
 51 KOG2231|consensus               95.1   0.012 2.5E-07   45.6   1.6   45   78-126   183-233 (669)
 52 PHA00626 hypothetical protein   94.7   0.012 2.6E-07   30.0   0.5   15  104-118    22-36  (59)
 53 TIGR00622 ssl1 transcription f  94.3   0.044 9.4E-07   32.7   2.4   45   79-125    57-101 (112)
 54 PF13913 zf-C2HC_2:  zinc-finge  94.3   0.052 1.1E-06   23.1   2.0   20   19-39      3-22  (25)
 55 KOG2893|consensus               93.9   0.043 9.4E-07   37.0   2.0   48   79-130    12-59  (341)
 56 PF09986 DUF2225:  Uncharacteri  93.4   0.033 7.1E-07   37.5   0.7   50  104-153     4-61  (214)
 57 COG4049 Uncharacterized protei  93.4   0.011 2.3E-07   30.2  -1.2   29  102-130    14-42  (65)
 58 smart00451 ZnF_U1 U1-like zinc  92.7    0.11 2.3E-06   23.8   1.8   22   18-39      3-24  (35)
 59 PF09986 DUF2225:  Uncharacteri  92.6     0.1 2.2E-06   35.2   2.2   10   78-87     49-58  (214)
 60 COG5048 FOG: Zn-finger [Genera  92.4   0.062 1.3E-06   39.5   1.2   56   76-132   288-349 (467)
 61 cd00729 rubredoxin_SM Rubredox  92.0   0.088 1.9E-06   24.3   1.0   10   78-87      3-12  (34)
 62 KOG2186|consensus               92.0   0.069 1.5E-06   36.3   0.9   45   78-125     4-48  (276)
 63 PF09723 Zn-ribbon_8:  Zinc rib  92.0   0.055 1.2E-06   26.3   0.3   12   78-89      6-17  (42)
 64 PRK14890 putative Zn-ribbon RN  91.8   0.054 1.2E-06   28.2   0.2   32   77-113    25-56  (59)
 65 COG5048 FOG: Zn-finger [Genera  91.4    0.14 3.1E-06   37.6   2.1  121   17-147   288-453 (467)
 66 smart00834 CxxC_CXXC_SSSS Puta  90.9   0.093   2E-06   25.1   0.5   11   78-88      6-16  (41)
 67 KOG2893|consensus               90.9   0.054 1.2E-06   36.6  -0.5   42  103-156     9-50  (341)
 68 KOG2482|consensus               90.2    0.33 7.3E-06   34.7   2.8  109   18-126   195-355 (423)
 69 PF13719 zinc_ribbon_5:  zinc-r  90.1    0.23 5.1E-06   23.3   1.5   32   79-115     4-35  (37)
 70 TIGR02098 MJ0042_CXXC MJ0042 f  90.1     0.2 4.3E-06   23.6   1.2   13   78-90      3-15  (38)
 71 TIGR00622 ssl1 transcription f  89.6     1.3 2.7E-05   26.6   4.5   86   16-112    13-110 (112)
 72 PRK00398 rpoP DNA-directed RNA  89.5    0.12 2.5E-06   25.6   0.2   30   77-116     3-32  (46)
 73 COG2888 Predicted Zn-ribbon RN  88.9    0.13 2.7E-06   26.8   0.0   32   77-113    27-58  (61)
 74 PF13717 zinc_ribbon_4:  zinc-r  88.9    0.32   7E-06   22.7   1.4   32   79-115     4-35  (36)
 75 TIGR02605 CxxC_CxxC_SSSS putat  88.8    0.17 3.6E-06   25.7   0.4   29   78-113     6-34  (52)
 76 COG1592 Rubrerythrin [Energy p  88.6    0.22 4.9E-06   32.0   1.0   24  105-148   134-157 (166)
 77 KOG1146|consensus               88.1    0.18 3.9E-06   42.2   0.4   53   76-128   464-541 (1406)
 78 smart00440 ZnF_C2C2 C2C2 Zinc   87.7    0.13 2.8E-06   24.7  -0.4   12  139-150    27-38  (40)
 79 PF12013 DUF3505:  Protein of u  87.6       1 2.2E-05   26.8   3.4   26   15-41      8-33  (109)
 80 PF01096 TFIIS_C:  Transcriptio  87.1   0.069 1.5E-06   25.5  -1.5   12  139-150    27-38  (39)
 81 PF14446 Prok-RING_1:  Prokaryo  87.1    0.19 4.2E-06   25.7   0.1   19  141-159     6-24  (54)
 82 PF09538 FYDLN_acid:  Protein o  86.2     0.5 1.1E-05   28.1   1.5   11   77-87     26-36  (108)
 83 KOG4173|consensus               86.2   0.098 2.1E-06   34.5  -1.6   80   45-130    78-171 (253)
 84 PRK00464 nrdR transcriptional   85.6    0.13 2.9E-06   32.6  -1.2   16  106-121    29-44  (154)
 85 TIGR00373 conserved hypothetic  84.8    0.41 8.9E-06   30.6   0.7   19  103-121   107-125 (158)
 86 TIGR00373 conserved hypothetic  84.7    0.76 1.7E-05   29.4   1.9   19   44-62    107-125 (158)
 87 KOG4173|consensus               84.6    0.23 4.9E-06   32.9  -0.5   76   76-154    78-160 (253)
 88 PF00301 Rubredoxin:  Rubredoxi  84.0    0.64 1.4E-05   23.2   1.1    8  140-147    34-41  (47)
 89 cd00730 rubredoxin Rubredoxin;  83.6     1.1 2.3E-05   22.7   1.8   11   78-88      2-12  (50)
 90 PRK06266 transcription initiat  83.2    0.51 1.1E-05   30.8   0.7   33  104-152   116-148 (178)
 91 PF14353 CpXC:  CpXC protein     83.1     2.2 4.7E-05   26.2   3.4   22  104-125    37-58  (128)
 92 COG1996 RPC10 DNA-directed RNA  82.5    0.66 1.4E-05   23.3   0.7   10   78-87      7-16  (49)
 93 PRK06266 transcription initiat  81.0     1.3 2.8E-05   29.0   1.9   31   45-87    116-146 (178)
 94 COG1773 Rubredoxin [Energy pro  80.0     1.4 3.1E-05   22.7   1.5   13   77-89      3-15  (55)
 95 COG3677 Transposase and inacti  79.8       1 2.3E-05   27.8   1.1   12  105-116    53-64  (129)
 96 smart00659 RPOLCX RNA polymera  79.6     1.1 2.3E-05   22.0   0.9   30   19-59      3-32  (44)
 97 smart00531 TFIIE Transcription  79.5     1.4 2.9E-05   27.9   1.6   12   46-57     99-110 (147)
 98 COG5236 Uncharacterized conser  78.6     2.1 4.5E-05   30.9   2.4  104   19-125   152-271 (493)
 99 PF03811 Zn_Tnp_IS1:  InsA N-te  78.6     1.6 3.4E-05   20.4   1.3   29  107-146     7-35  (36)
100 PRK09678 DNA-binding transcrip  78.3    0.75 1.6E-05   25.2   0.2   43   19-63      2-46  (72)
101 KOG2907|consensus               78.0       1 2.2E-05   26.8   0.7   14  139-152   101-114 (116)
102 PF01780 Ribosomal_L37ae:  Ribo  78.0     0.5 1.1E-05   27.0  -0.6   10  141-150    54-63  (90)
103 TIGR01206 lysW lysine biosynth  77.9    0.95 2.1E-05   23.3   0.5   30   78-115     3-32  (54)
104 PF08274 PhnA_Zn_Ribbon:  PhnA   77.6     1.1 2.3E-05   20.0   0.5   11  107-117     4-14  (30)
105 PF07754 DUF1610:  Domain of un  77.3       1 2.2E-05   19.0   0.4    8  105-112    16-23  (24)
106 KOG4124|consensus               77.3     2.6 5.7E-05   30.5   2.6   54  103-156   347-414 (442)
107 smart00614 ZnF_BED BED zinc fi  76.4     0.6 1.3E-05   23.5  -0.5   21   78-98     19-44  (50)
108 PF02892 zf-BED:  BED zinc fing  76.2    0.34 7.5E-06   23.6  -1.4   22   76-97     15-40  (45)
109 COG0068 HypF Hydrogenase matur  75.5     0.9   2E-05   35.9   0.0   81   19-115   102-183 (750)
110 PHA02998 RNA polymerase subuni  73.1     1.2 2.6E-05   28.8   0.2   40  106-152   144-183 (195)
111 PF13451 zf-trcl:  Probable zin  72.7     1.1 2.5E-05   22.5  -0.0   14   77-90      4-17  (49)
112 TIGR02300 FYDLN_acid conserved  72.6     2.7 5.8E-05   25.8   1.5   11   77-87     26-36  (129)
113 PRK03824 hypA hydrogenase nick  72.6     1.2 2.6E-05   27.7   0.1   13   77-89     70-82  (135)
114 KOG2785|consensus               72.5     2.5 5.5E-05   30.9   1.6   52   77-128   166-243 (390)
115 PF05191 ADK_lid:  Adenylate ki  72.2    0.92   2E-05   21.2  -0.4    8  107-114    23-30  (36)
116 KOG3214|consensus               72.0     2.3   5E-05   24.7   1.1   13  140-152    47-59  (109)
117 PF05129 Elf1:  Transcription e  71.9     1.2 2.6E-05   25.1  -0.1   13  140-152    46-58  (81)
118 KOG2785|consensus               71.7     3.1 6.6E-05   30.5   1.9   82   17-98      2-89  (390)
119 PF06524 NOA36:  NOA36 protein;  71.4     4.8  0.0001   28.0   2.6   28  102-130   206-233 (314)
120 PF08790 zf-LYAR:  LYAR-type C2  71.4     1.1 2.3E-05   19.7  -0.3   19  106-125     1-19  (28)
121 PF10571 UPF0547:  Uncharacteri  71.2     1.9 4.2E-05   18.5   0.5    9  107-115    16-24  (26)
122 PF12907 zf-met2:  Zinc-binding  71.2    0.58 1.3E-05   22.4  -1.2   26  106-131     2-30  (40)
123 PF01927 Mut7-C:  Mut7-C RNAse   70.7     1.3 2.8E-05   28.0  -0.1   18  139-156   123-140 (147)
124 COG1997 RPL43A Ribosomal prote  69.7     3.1 6.8E-05   23.6   1.3   31   45-88     34-64  (89)
125 PF14803 Nudix_N_2:  Nudix N-te  69.0     1.6 3.4E-05   20.1   0.0    9  139-147    21-29  (34)
126 PF04959 ARS2:  Arsenite-resist  67.6    0.73 1.6E-05   31.0  -1.8   27  104-130    76-102 (214)
127 PF01286 XPA_N:  XPA protein N-  67.3     3.3 7.2E-05   19.1   0.9   16  107-122     5-20  (34)
128 KOG4602|consensus               67.3     1.9 4.1E-05   29.7   0.1   43  107-149   235-277 (318)
129 TIGR03831 YgiT_finger YgiT-typ  66.7     1.4 3.1E-05   21.3  -0.4   13  139-151    31-43  (46)
130 KOG2593|consensus               66.5     3.8 8.2E-05   30.5   1.5   17   46-62    128-144 (436)
131 PRK03564 formate dehydrogenase  66.5     1.8 3.9E-05   30.9  -0.1   37   17-56    186-222 (309)
132 KOG2186|consensus               65.9     3.6 7.7E-05   28.4   1.2   39   18-58      3-41  (276)
133 PRK05978 hypothetical protein;  65.9     2.8 6.2E-05   26.5   0.7   12  107-118    54-65  (148)
134 PF05290 Baculo_IE-1:  Baculovi  65.3     3.5 7.7E-05   25.5   1.0   20   43-62     77-96  (140)
135 PF06397 Desulfoferrod_N:  Desu  65.1     2.2 4.7E-05   20.0   0.1   12  138-149     4-15  (36)
136 COG5151 SSL1 RNA polymerase II  65.1      12 0.00027   26.8   3.7   25   76-100   387-411 (421)
137 PF03604 DNA_RNApol_7kD:  DNA d  65.0     2.8 6.1E-05   19.0   0.4    9   46-54     17-25  (32)
138 PF15269 zf-C2H2_7:  Zinc-finge  64.8      13 0.00028   18.2   2.7   22   19-40     21-42  (54)
139 PF01844 HNH:  HNH endonuclease  64.5       5 0.00011   19.4   1.4   42  108-149     1-43  (47)
140 PF12013 DUF3505:  Protein of u  64.4     6.9 0.00015   23.2   2.1   26   17-42     79-108 (109)
141 PRK04023 DNA polymerase II lar  64.0     7.5 0.00016   32.5   2.8    9  106-114   664-672 (1121)
142 KOG2482|consensus               63.8     2.2 4.8E-05   30.7  -0.1   55   78-132   145-222 (423)
143 PF10276 zf-CHCC:  Zinc-finger   63.3     2.1 4.7E-05   20.5  -0.1   11  140-150    29-39  (40)
144 PF04810 zf-Sec23_Sec24:  Sec23  62.0     3.2 6.9E-05   19.8   0.3    9  104-112    23-31  (40)
145 PF07975 C1_4:  TFIIH C1-like d  61.6     1.4   3E-05   22.4  -1.0   22  104-125    20-41  (51)
146 smart00734 ZnF_Rad18 Rad18-lik  61.1     8.6 0.00019   16.4   1.6   19   20-39      3-21  (26)
147 PF07503 zf-HYPF:  HypF finger;  61.0     1.4   3E-05   20.5  -1.0    8  107-114    23-30  (35)
148 COG1594 RPB9 DNA-directed RNA   60.7     2.5 5.5E-05   25.4  -0.2   12  139-150    99-110 (113)
149 COG4338 Uncharacterized protei  60.4     1.2 2.7E-05   22.1  -1.3   14  142-155    14-27  (54)
150 PF09416 UPF1_Zn_bind:  RNA hel  59.1     2.7 5.9E-05   26.7  -0.3    7  106-112    61-67  (152)
151 PF04641 Rtf2:  Rtf2 RING-finge  58.8     5.4 0.00012   27.8   1.1   50  103-155   111-165 (260)
152 TIGR01384 TFS_arch transcripti  57.4     2.8 6.1E-05   24.6  -0.4   40  106-152    63-102 (104)
153 PF14445 Prok-RING_2:  Prokaryo  57.3     1.7 3.7E-05   21.8  -1.1   11  140-150     7-17  (57)
154 KOG2593|consensus               57.0     7.5 0.00016   29.1   1.6   19  104-122   127-145 (436)
155 smart00154 ZnF_AN1 AN1-like Zi  56.9     5.2 0.00011   19.0   0.6   14  105-118    12-25  (39)
156 PF07282 OrfB_Zn_ribbon:  Putat  56.1     6.9 0.00015   20.9   1.1   10  105-114    46-55  (69)
157 PF05741 zf-nanos:  Nanos RNA b  55.9     2.1 4.6E-05   22.1  -0.9   13  139-151    32-44  (55)
158 cd00924 Cyt_c_Oxidase_Vb Cytoc  55.5     6.4 0.00014   23.0   0.9   18   99-117    74-91  (97)
159 PF13824 zf-Mss51:  Zinc-finger  55.3      10 0.00022   19.6   1.5   11   77-87     14-24  (55)
160 PF08394 Arc_trans_TRASH:  Arch  55.1     5.2 0.00011   18.8   0.4   14  139-152    22-35  (37)
161 PF13878 zf-C2H2_3:  zinc-finge  55.0      16 0.00034   17.5   2.1   24   78-101    14-39  (41)
162 COG1198 PriA Primosomal protei  53.5      11 0.00024   30.5   2.1    8  105-112   475-482 (730)
163 PTZ00255 60S ribosomal protein  53.3     8.5 0.00019   22.1   1.1   31   45-88     35-65  (90)
164 PF05443 ROS_MUCR:  ROS/MUCR tr  53.1     9.8 0.00021   23.6   1.5   26   77-105    72-97  (132)
165 PRK12380 hydrogenase nickel in  53.1     6.6 0.00014   23.6   0.7   24   78-113    71-94  (113)
166 COG3357 Predicted transcriptio  53.0     9.1  0.0002   22.0   1.2   14   45-58     57-70  (97)
167 TIGR00100 hypA hydrogenase nic  52.9     5.9 0.00013   23.9   0.5   26   77-114    70-95  (115)
168 KOG1280|consensus               52.6     6.1 0.00013   28.6   0.6   26  105-130    79-104 (381)
169 KOG3408|consensus               52.6       9 0.00019   23.3   1.2   26   74-99     54-79  (129)
170 PF04423 Rad50_zn_hook:  Rad50   52.6     5.3 0.00011   20.3   0.2   12  107-118    22-33  (54)
171 PF08271 TF_Zn_Ribbon:  TFIIB z  51.9       6 0.00013   19.1   0.3   10   78-87     20-29  (43)
172 PF04780 DUF629:  Protein of un  51.7     2.9 6.3E-05   31.7  -1.1   28  105-132    57-84  (466)
173 smart00661 RPOL9 RNA polymeras  51.6       7 0.00015   19.5   0.6   16  105-120    20-35  (52)
174 KOG0696|consensus               51.2       8 0.00017   29.2   1.0   61   73-148    69-129 (683)
175 PRK14714 DNA polymerase II lar  51.2      14  0.0003   31.8   2.4    8   47-54    668-675 (1337)
176 TIGR00280 L37a ribosomal prote  51.1     8.2 0.00018   22.2   0.9   30   45-87     34-63  (91)
177 PRK00432 30S ribosomal protein  50.8     6.2 0.00014   19.9   0.3   12  104-115    36-47  (50)
178 PLN02294 cytochrome c oxidase   50.7     8.5 0.00018   25.0   1.0   17  102-118   138-154 (174)
179 PF10013 DUF2256:  Uncharacteri  50.3     3.1 6.7E-05   20.1  -0.8   11  142-152    10-20  (42)
180 PTZ00303 phosphatidylinositol   49.5      17 0.00036   29.8   2.5   69   78-154   461-533 (1374)
181 COG4888 Uncharacterized Zn rib  49.1     8.8 0.00019   22.5   0.8    9   47-55     23-31  (104)
182 PF15135 UPF0515:  Uncharacteri  48.5      16 0.00034   25.4   2.0   12   17-28    111-122 (278)
183 PF02176 zf-TRAF:  TRAF-type zi  48.3     3.6 7.8E-05   21.2  -0.8   39   77-116     9-53  (60)
184 COG5236 Uncharacterized conser  48.2      29 0.00062   25.4   3.3   72   19-101   221-305 (493)
185 PF01363 FYVE:  FYVE zinc finge  47.5      11 0.00024   20.1   1.0   57   78-150    10-67  (69)
186 PF01428 zf-AN1:  AN1-like Zinc  47.3     4.4 9.6E-05   19.6  -0.5   16  139-154    12-27  (43)
187 smart00132 LIM Zinc-binding do  47.2      11 0.00024   17.0   0.9   12  139-150    26-37  (39)
188 COG4530 Uncharacterized protei  47.1      11 0.00025   22.4   1.1   14   76-89     25-38  (129)
189 smart00507 HNHc HNH nucleases.  46.6      19 0.00041   17.3   1.8   12  106-117    11-22  (52)
190 PRK03976 rpl37ae 50S ribosomal  46.1      11 0.00024   21.7   0.8   30   45-87     35-64  (90)
191 PRK00762 hypA hydrogenase nick  46.0     9.7 0.00021   23.3   0.7   11   78-89     71-81  (124)
192 PF10621 FpoO:  F420H2 dehydrog  45.8     9.2  0.0002   22.8   0.5   65   48-114     3-69  (119)
193 PF10263 SprT-like:  SprT-like   45.6       7 0.00015   24.7   0.0   10  106-115   124-133 (157)
194 KOG2807|consensus               45.6      67  0.0015   23.4   4.7   25  105-130   345-369 (378)
195 PF14311 DUF4379:  Domain of un  45.3      17 0.00037   18.5   1.5   12   78-89     29-40  (55)
196 PRK00564 hypA hydrogenase nick  45.2     9.3  0.0002   23.1   0.5   13   77-89     71-83  (117)
197 COG3364 Zn-ribbon containing p  45.1      15 0.00032   21.6   1.3   16   18-33      2-17  (112)
198 COG1198 PriA Primosomal protei  44.9      16 0.00036   29.6   1.9   11  139-149   474-484 (730)
199 COG0068 HypF Hydrogenase matur  44.7       5 0.00011   32.0  -0.8   60   78-151   124-184 (750)
200 COG1675 TFA1 Transcription ini  44.2      19 0.00042   23.6   1.9   33   42-86    109-141 (176)
201 smart00401 ZnF_GATA zinc finge  44.1      31 0.00068   17.4   2.3   14  141-154    26-39  (52)
202 COG3091 SprT Zn-dependent meta  43.7      11 0.00023   24.0   0.6   33   77-114   117-149 (156)
203 COG1779 C4-type Zn-finger prot  42.9     5.9 0.00013   26.3  -0.6   12  106-117    44-55  (201)
204 PF09332 Mcm10:  Mcm10 replicat  42.8     2.7 5.9E-05   30.5  -2.3   11  139-149   284-294 (344)
205 COG4391 Uncharacterized protei  41.8     6.3 0.00014   20.8  -0.5   11  141-151    49-59  (62)
206 KOG1729|consensus               41.2      21 0.00046   25.4   1.8   58   78-152   169-226 (288)
207 PF10122 Mu-like_Com:  Mu-like   39.9      15 0.00033   18.6   0.7    6  107-112    26-31  (51)
208 PF14787 zf-CCHC_5:  GAG-polypr  39.5     9.4  0.0002   17.8  -0.1   12  108-119     5-16  (36)
209 PRK14892 putative transcriptio  39.3      12 0.00025   22.1   0.3   35   76-117    20-54  (99)
210 KOG4167|consensus               39.2     6.4 0.00014   31.5  -1.0   25   77-101   792-816 (907)
211 PF02891 zf-MIZ:  MIZ/SP-RING z  39.2      11 0.00024   18.9   0.2    9  105-113    41-49  (50)
212 PF09963 DUF2197:  Uncharacteri  38.9     8.4 0.00018   20.0  -0.3    8  105-112    31-38  (56)
213 PF01155 HypA:  Hydrogenase exp  38.4      10 0.00022   22.8  -0.1   25   78-114    71-95  (113)
214 COG1655 Uncharacterized protei  37.9      14 0.00031   25.3   0.5   16  106-121    20-35  (267)
215 cd00085 HNHc HNH nucleases; HN  37.7      20 0.00044   17.6   1.1   10  106-115    12-21  (57)
216 PRK04351 hypothetical protein;  37.5      16 0.00035   23.2   0.7   13  139-151   131-143 (149)
217 TIGR03830 CxxCG_CxxCG_HTH puta  37.4      35 0.00075   20.5   2.2   20   76-95     30-49  (127)
218 COG1571 Predicted DNA-binding   37.4      18 0.00039   27.2   1.0   14  105-118   367-380 (421)
219 PF14255 Cys_rich_CPXG:  Cystei  37.2      16 0.00034   18.7   0.5   11  106-116     1-11  (52)
220 TIGR01562 FdhE formate dehydro  36.4      24 0.00051   25.4   1.5   16  138-153   250-265 (305)
221 cd00065 FYVE FYVE domain; Zinc  36.3      29 0.00063   17.5   1.5   13  105-117    18-30  (57)
222 TIGR01385 TFSII transcription   36.2      11 0.00025   26.9  -0.1   40  105-151   258-297 (299)
223 PF00412 LIM:  LIM domain;  Int  35.4      24 0.00051   17.8   1.1   12  140-151    26-37  (58)
224 PF02701 zf-Dof:  Dof domain, z  35.2      32  0.0007   18.2   1.5   17  106-122    31-47  (63)
225 TIGR00686 phnA alkylphosphonat  34.8      20 0.00043   21.4   0.7    8   78-85     20-27  (109)
226 PF11672 DUF3268:  Protein of u  34.5      24 0.00053   20.9   1.1    9   77-85      2-10  (102)
227 PF06220 zf-U1:  U1 zinc finger  34.2      22 0.00048   16.7   0.7   15  105-119     3-17  (38)
228 COG1998 RPS31 Ribosomal protei  32.6      18  0.0004   18.2   0.3   10  105-114    37-46  (51)
229 PRK03681 hypA hydrogenase nick  32.4      26 0.00055   21.1   1.0   11   78-88     71-81  (114)
230 KOG0978|consensus               32.4      21 0.00046   28.7   0.8   22  104-125   677-698 (698)
231 smart00064 FYVE Protein presen  32.1      29 0.00062   18.4   1.1   15  104-118    25-39  (68)
232 KOG2071|consensus               31.6      35 0.00075   26.9   1.8   28   15-42    415-442 (579)
233 PF05766 NinG:  Bacteriophage L  31.5      31 0.00067   22.9   1.3   31   76-116     5-35  (189)
234 PRK05452 anaerobic nitric oxid  31.4      34 0.00073   26.4   1.7   46  104-151   424-469 (479)
235 KOG4167|consensus               31.3      13 0.00028   30.0  -0.5   24   19-42    793-816 (907)
236 KOG2231|consensus               31.3      49  0.0011   26.7   2.5   21   20-40    184-204 (669)
237 PF12773 DZR:  Double zinc ribb  31.2      41  0.0009   16.5   1.5    9  105-113    29-37  (50)
238 PRK10220 hypothetical protein;  31.2      32  0.0007   20.6   1.2   11   47-57     21-31  (111)
239 PF14447 Prok-RING_4:  Prokaryo  31.2      16 0.00034   18.9  -0.0   10  107-116    41-50  (55)
240 COG4896 Uncharacterized protei  31.0      32 0.00069   18.2   1.1    8  105-112    31-38  (68)
241 PF04606 Ogr_Delta:  Ogr/Delta-  30.9       6 0.00013   19.5  -1.6   15  104-118    24-40  (47)
242 PF10537 WAC_Acf1_DNA_bd:  ATP-  30.1      66  0.0014   19.0   2.4   18   46-63      3-20  (102)
243 PF12662 cEGF:  Complement Clr-  30.1      20 0.00044   15.0   0.2    6  146-151     6-11  (24)
244 PF07295 DUF1451:  Protein of u  30.0      24 0.00053   22.3   0.7    7  106-112   113-119 (146)
245 PF01215 COX5B:  Cytochrome c o  29.9      16 0.00035   22.8  -0.1   15  103-117   110-124 (136)
246 PF02748 PyrI_C:  Aspartate car  29.8      13 0.00029   18.9  -0.4   15  139-153    34-48  (52)
247 PF04438 zf-HIT:  HIT zinc fing  29.3      21 0.00046   15.8   0.2    9  106-114    14-22  (30)
248 PF06467 zf-FCS:  MYM-type Zinc  28.2      39 0.00085   15.9   1.1   16  105-120     6-21  (43)
249 cd00974 DSRD Desulforedoxin (D  27.3      22 0.00048   16.0   0.1   12  139-150     3-14  (34)
250 smart00731 SprT SprT homologue  26.9      23  0.0005   22.2   0.2   12  139-150   132-143 (146)
251 PF02591 DUF164:  Putative zinc  26.7      56  0.0012   16.6   1.6   11   44-54     44-54  (56)
252 PF10083 DUF2321:  Uncharacteri  26.7      77  0.0017   20.4   2.4   43   47-92     40-83  (158)
253 PF14369 zf-RING_3:  zinc-finge  26.6      49  0.0011   15.2   1.2   10   48-57     23-32  (35)
254 PTZ00043 cytochrome c oxidase   26.5      36 0.00077   23.3   1.0   27  102-132   178-204 (268)
255 KOG1842|consensus               26.5      13 0.00027   28.1  -1.2   27  106-132    16-42  (505)
256 KOG2906|consensus               26.5      20 0.00044   20.9  -0.1   36  107-149    67-102 (105)
257 PF12760 Zn_Tnp_IS1595:  Transp  26.0      92   0.002   15.1   3.3    9   47-55     19-27  (46)
258 PRK01343 zinc-binding protein;  25.9      33 0.00072   17.9   0.6   12  105-116     9-20  (57)
259 TIGR00319 desulf_FeS4 desulfof  25.7      22 0.00048   16.0  -0.1   12  139-150     6-17  (34)
260 PF13453 zf-TFIIB:  Transcripti  25.5      69  0.0015   15.1   1.7   23   15-37     16-38  (41)
261 PF04216 FdhE:  Protein involve  25.3      15 0.00032   26.1  -1.0   77   18-115   172-248 (290)
262 PF04032 Rpr2:  RNAse P Rpr2/Rp  25.1      59  0.0013   18.0   1.6   42  102-147    43-84  (85)
263 KOG3507|consensus               24.9      41 0.00089   17.6   0.8   10  105-114    37-46  (62)
264 COG4957 Predicted transcriptio  24.6      40 0.00086   21.1   0.9   26   77-105    76-101 (148)
265 KOG0402|consensus               24.6      28  0.0006   19.7   0.2   29   46-87     36-64  (92)
266 COG5216 Uncharacterized conser  24.1      23 0.00049   18.5  -0.2   12  139-151    21-32  (67)
267 KOG3352|consensus               24.0      19 0.00042   22.8  -0.6   14  139-152   132-145 (153)
268 COG5112 UFD2 U1-like Zn-finger  24.0      33 0.00071   20.4   0.4   25   75-99     53-77  (126)
269 PF04780 DUF629:  Protein of un  24.0      59  0.0013   25.0   1.8   29   74-102    54-83  (466)
270 PRK12860 transcriptional activ  23.9      44 0.00095   22.2   1.0   11  106-116   135-145 (189)
271 KOG2857|consensus               23.8      34 0.00073   21.5   0.5   21  105-125    17-37  (157)
272 PF14279 HNH_5:  HNH endonuclea  23.7      71  0.0015   17.4   1.7   10  142-151    32-41  (71)
273 PF08792 A2L_zn_ribbon:  A2L zi  23.6      34 0.00074   15.5   0.4    9   78-86     22-30  (33)
274 COG1326 Uncharacterized archae  23.5      74  0.0016   21.3   2.0   38   17-58      5-42  (201)
275 PTZ00448 hypothetical protein;  23.1      63  0.0014   24.0   1.8   23   18-40    314-336 (373)
276 PRK11823 DNA repair protein Ra  23.0      50  0.0011   25.2   1.3   11   46-56      7-17  (446)
277 COG0675 Transposase and inacti  22.9      42 0.00092   23.9   0.9    7  106-112   323-329 (364)
278 PF11023 DUF2614:  Protein of u  22.7      36 0.00079   20.5   0.5   33  103-154    67-99  (114)
279 PF05180 zf-DNL:  DNL zinc fing  22.3      11 0.00025   20.3  -1.5   34   78-114     5-38  (66)
280 PF03107 C1_2:  C1 domain;  Int  22.3      32  0.0007   15.0   0.1   10  141-150     1-10  (30)
281 KOG4118|consensus               22.2      69  0.0015   17.2   1.4   25   19-43     39-63  (74)
282 TIGR03829 YokU_near_AblA uncha  21.5      65  0.0014   18.6   1.3   21   16-36     33-53  (89)
283 COG4332 Uncharacterized protei  21.3      30 0.00064   22.8  -0.1    8  106-113    50-57  (203)
284 PF10071 DUF2310:  Zn-ribbon-co  21.2      48   0.001   23.3   0.9   30  106-149   221-250 (258)
285 PF14690 zf-ISL3:  zinc-finger   21.0      49  0.0011   15.9   0.7   11  105-115     2-12  (47)
286 PRK11295 hypothetical protein;  20.7      45 0.00097   20.2   0.6   47  104-150    23-72  (113)
287 TIGR00627 tfb4 transcription f  20.6      72  0.0016   22.7   1.6   13  104-116   254-266 (279)
288 PF06170 DUF983:  Protein of un  20.3      49  0.0011   18.9   0.6   12  107-118    10-21  (86)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=4.1e-32  Score=179.09  Aligned_cols=133  Identities=36%  Similarity=0.617  Sum_probs=120.5

Q ss_pred             cCCCCcccCcccccccCChHHHHHHHHhhc---CCCccccccccccccCccccccccccccccCCCCCccCcccccccCC
Q psy9695          13 VAGMPKHLCHVCHKNFSSSSALQIHMRTHT---GDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSS   89 (159)
Q Consensus        13 ~~~~~~~~C~~C~~~f~~~~~~~~h~~~~~---~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~   89 (159)
                      ......|+|+.|++.+.+.++|..|...|.   ..+.+.|+.|++.+..-..|.+   +++.|+  .+.+|..||+.|..
T Consensus       125 ~~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkM---HirTH~--l~c~C~iCGKaFSR  199 (279)
T KOG2462|consen  125 AAKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKM---HIRTHT--LPCECGICGKAFSR  199 (279)
T ss_pred             cccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhh---HhhccC--CCcccccccccccc
Confidence            334556999999999999999999999885   4677999999999999999987   444444  67999999999999


Q ss_pred             hHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhccccc
Q psy9695          90 SSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKHKTE  157 (159)
Q Consensus        90 ~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~  157 (159)
                      +.-|+.|+++|+|||||.|+.|+++|..+++|+.|| ++|.+.      +.|+|+.|+|+|...+.|.
T Consensus       200 PWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm-QTHS~~------K~~qC~~C~KsFsl~SyLn  260 (279)
T KOG2462|consen  200 PWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM-QTHSDV------KKHQCPRCGKSFALKSYLN  260 (279)
T ss_pred             hHHhhcccccccCCCCccCCcccchhcchHHHHHHH-HhhcCC------ccccCcchhhHHHHHHHHH
Confidence            999999999999999999999999999999999999 999999      9999999999999988764


No 2  
>KOG2462|consensus
Probab=99.88  E-value=1.3e-23  Score=139.06  Aligned_cols=105  Identities=28%  Similarity=0.494  Sum_probs=98.7

Q ss_pred             CCccccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCcee
Q psy9695          44 DKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKV  123 (159)
Q Consensus        44 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  123 (159)
                      ...|.|.+||+.+.+.+.|.+|.+.++.....+.+.|+.|++.|.+...|..|+++|+  -+.+|++|||+|.+.+.|+.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            4469999999999999999998888777777889999999999999999999999996  58999999999999999999


Q ss_pred             eehhhccCCCCCcccccccchhhchhhhhccccc
Q psy9695         124 REIEINIGSQLPKKAQQHIGAVEGKSFQAKHKTE  157 (159)
Q Consensus       124 H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~  157 (159)
                      |+ ++|+|+      +||.|+.|+++|..+++|+
T Consensus       206 Hi-RTHTGE------KPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  206 HI-RTHTGE------KPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             cc-ccccCC------CCccCCcccchhcchHHHH
Confidence            99 999999      9999999999999999986


No 3  
>KOG1074|consensus
Probab=99.80  E-value=5.5e-20  Score=137.13  Aligned_cols=77  Identities=40%  Similarity=0.724  Sum_probs=67.9

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccch---hhchhhhhcc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGA---VEGKSFQAKH  154 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~---~C~~~f~~~~  154 (159)
                      -.|..|.+++.-.+.|+-|.+.|+|||||+|.+||++|+.+.+|+.|| .+|-.. .+.+ -+|.|+   +|-+.|...-
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~-p~~R-~q~ScP~~~ic~~kftn~V  682 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAK-PPAR-VQFSCPSTFICQKKFTNAV  682 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc-cccccC-cccc-ccccCCchhhhcccccccc
Confidence            559999999999999999999999999999999999999999999999 998765 2222 789999   9999998766


Q ss_pred             ccc
Q psy9695         155 KTE  157 (159)
Q Consensus       155 ~l~  157 (159)
                      .|.
T Consensus       683 ~lp  685 (958)
T KOG1074|consen  683 TLP  685 (958)
T ss_pred             ccc
Confidence            553


No 4  
>KOG1074|consensus
Probab=99.70  E-value=3.8e-18  Score=127.47  Aligned_cols=45  Identities=16%  Similarity=0.436  Sum_probs=32.6

Q ss_pred             ccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhccccc
Q psy9695         106 FRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKHKTE  157 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~  157 (159)
                      ..|.+||+.|...+.|..|+ ++|.++      ++|.|..|++.|.++.+|+
T Consensus       880 h~C~vCgk~FsSSsALqiH~-rTHtg~------KPF~C~fC~~aFttrgnLK  924 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHM-RTHTGP------KPFFCHFCEEAFTTRGNLK  924 (958)
T ss_pred             hhhccchhcccchHHHHHhh-hcCCCC------CCccchhhhhhhhhhhhhh
Confidence            45777777777777777777 777777      6777777777777776653


No 5  
>KOG3576|consensus
Probab=99.67  E-value=1.2e-18  Score=110.83  Aligned_cols=104  Identities=28%  Similarity=0.560  Sum_probs=83.7

Q ss_pred             CCccccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCcee
Q psy9695          44 DKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKV  123 (159)
Q Consensus        44 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  123 (159)
                      ...|.|.+|++.|.-..-|.+   ++.-|...+.+.|..||+.|....+|.+|.++|+|.+||+|..|+++|+++.+|..
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnr---h~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNR---HLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHH---HhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHH
Confidence            345889999998887777766   45557777789999999999998999999999999999999999999999999999


Q ss_pred             eehhhccCCC----CCcccccccchhhchhh
Q psy9695         124 REIEINIGSQ----LPKKAQQHIGAVEGKSF  150 (159)
Q Consensus       124 H~~~~h~~~~----~~~~~~~~~C~~C~~~f  150 (159)
                      |.+++|.-..    ...+.+.|.|..||..-
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedcg~t~  222 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDCGYTS  222 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeecccCCCC
Confidence            9967665321    11344789999998653


No 6  
>KOG3608|consensus
Probab=99.67  E-value=3.7e-18  Score=116.81  Aligned_cols=146  Identities=15%  Similarity=0.315  Sum_probs=93.1

Q ss_pred             ccCCccccccCCCCcccCcccccccCChHHHHHHHHhhc--CCCc--------------------------ccccccccc
Q psy9695           4 KLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHT--GDKP--------------------------FRCTICQKA   55 (159)
Q Consensus         4 ~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~~~~h~~~~~--~~~~--------------------------~~c~~c~~~   55 (159)
                      ..+.++.+.|++++...|+.||..|++...|-.|++..+  ...+                          |+|+.|..+
T Consensus       193 ~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmt  272 (467)
T KOG3608|consen  193 YRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMT  272 (467)
T ss_pred             HHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccC
Confidence            345667788888888888888888888888888875433  2334                          444555544


Q ss_pred             ccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCc--ccccccccCCceeeehhhccCCC
Q psy9695          56 FTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTI--CQKAFTTKGNLKVREIEINIGSQ  133 (159)
Q Consensus        56 ~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~  133 (159)
                      ....++|..|+  +-.|...+||+|+.|+..+.+.+.|..|...|. +..|+|..  |..+|.+..++.+|++..|.|..
T Consensus       273 c~~~ssL~~H~--r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~n  349 (467)
T KOG3608|consen  273 CSSASSLTTHI--RYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNN  349 (467)
T ss_pred             CCChHHHHHHH--HhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCC
Confidence            44444444432  123444566777777766666666777766665 55566655  77777777777777755555542


Q ss_pred             CCcccccccchhhchhhhhcccc
Q psy9695         134 LPKKAQQHIGAVEGKSFQAKHKT  156 (159)
Q Consensus       134 ~~~~~~~~~C~~C~~~f~~~~~l  156 (159)
                      .    -+|.|-.|++.|.+-..|
T Consensus       350 p----~~Y~CH~Cdr~ft~G~~L  368 (467)
T KOG3608|consen  350 P----ILYACHCCDRFFTSGKSL  368 (467)
T ss_pred             C----CceeeecchhhhccchhH
Confidence            2    577788887777765544


No 7  
>KOG3608|consensus
Probab=99.62  E-value=1.8e-16  Score=108.67  Aligned_cols=132  Identities=23%  Similarity=0.432  Sum_probs=114.5

Q ss_pred             CcccCcccccccCChHHHHHHHHh-hcCCCccccccccccccCccccccccccccccCCCCCccCcc--cccccCChHHH
Q psy9695          17 PKHLCHVCHKNFSSSSALQIHMRT-HTGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHV--CHKNFSSSSAL   93 (159)
Q Consensus        17 ~~~~C~~C~~~f~~~~~~~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~--C~~~~~~~~~l   93 (159)
                      ..|+|+.|+++....++|..|++. |..++||+|..|...+...++|..|..   .|. +..|.|..  |..++.+...+
T Consensus       262 n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~---~HS-~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  262 NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ---VHS-KTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH---hcc-ccceecCCCCCcHHHHHHHHH
Confidence            458999999999999999999965 778999999999999999999988543   344 56799998  99999999999


Q ss_pred             HHHHHHcc-C--CCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhc
Q psy9695          94 QIHMRTHT-G--DKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAK  153 (159)
Q Consensus        94 ~~H~~~h~-~--~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~  153 (159)
                      .+|.+.++ +  +.+|.|..|++.|++..+|.+|+ ...++.++|.+...|....|...|...
T Consensus       338 ~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL-~kkH~f~~PsGh~RFtYk~~edG~mRL  399 (467)
T KOG3608|consen  338 RRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHL-MKKHGFRLPSGHKRFTYKVDEDGFMRL  399 (467)
T ss_pred             HHHHHHhccCCCCCceeeecchhhhccchhHHHHH-HHhhcccCCCCCCceeeeeccCceeee
Confidence            99999765 4  45699999999999999999999 767777899999999999998888654


No 8  
>KOG3623|consensus
Probab=99.61  E-value=1.9e-16  Score=117.17  Aligned_cols=112  Identities=24%  Similarity=0.525  Sum_probs=94.5

Q ss_pred             CCcccCcccccccCChHHHHHHHHhh--cCCCccccccccccccCccccccccccccccC----------CCCCccCccc
Q psy9695          16 MPKHLCHVCHKNFSSSSALQIHMRTH--TGDKPFRCTICQKAFTTKGNLKLIPNAVFNVA----------GMPKHLCHVC   83 (159)
Q Consensus        16 ~~~~~C~~C~~~f~~~~~~~~h~~~~--~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~----------~~~~~~C~~C   83 (159)
                      ....+|+.|++.+.....+..|+...  ..+..|.|..|..+|.+..-|.+|+..+....          .-+.|+|.+|
T Consensus       208 sqlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtEC  287 (1007)
T KOG3623|consen  208 SQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTEC  287 (1007)
T ss_pred             hhhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcccccccc
Confidence            34489999999999999999998653  35667999999999999998887664332211          1246999999


Q ss_pred             ccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehh
Q psy9695          84 HKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIE  127 (159)
Q Consensus        84 ~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  127 (159)
                      ++.|.....|..|.++|.||+||.|+.|+|.|...+++..||-.
T Consensus       288 gKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  288 GKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             chhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999999999999999933


No 9  
>KOG3576|consensus
Probab=99.60  E-value=1.3e-16  Score=101.63  Aligned_cols=119  Identities=23%  Similarity=0.408  Sum_probs=102.6

Q ss_pred             cccccCCCCcccCcccccccCChHHHHHHHHhhcCCCccccccccccccCccccccccccccccCCCCCccCcccccccC
Q psy9695           9 AVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFS   88 (159)
Q Consensus         9 ~~~~~~~~~~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~   88 (159)
                      ..-+..+...|.|.+|++.|.-.-.|..|+.-|...+.+.|..||+.|...-+|++   +.+.|+|.+||.|..|+++|.
T Consensus       108 t~gsssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkr---h~rthtgvrpykc~~c~kaft  184 (267)
T KOG3576|consen  108 TIGSSSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKR---HTRTHTGVRPYKCSLCEKAFT  184 (267)
T ss_pred             cccCCCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhh---hhccccCccccchhhhhHHHH
Confidence            33444556779999999999999999999999999999999999999999999988   778899999999999999999


Q ss_pred             ChHHHHHHHHHccC-----------CCCccCCcccccccccCCceeeehhhcc
Q psy9695          89 SSSALQIHMRTHTG-----------DKPFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus        89 ~~~~l~~H~~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      ..-.|..|.+.-++           ++.|.|..||..-.....+..|.+..|.
T Consensus       185 qrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  185 QRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             hhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            99899999775443           4679999999988888888888844443


No 10 
>KOG3623|consensus
Probab=99.59  E-value=2.6e-16  Score=116.48  Aligned_cols=76  Identities=28%  Similarity=0.498  Sum_probs=67.6

Q ss_pred             cCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhh
Q psy9695          72 VAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQ  151 (159)
Q Consensus        72 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~  151 (159)
                      .+....|.|+.|+++|.-.+.|.+|+..|+|.+||+|.+|.|+|...-.|..|+ +.|.|+      +||.|+.|+|+|.
T Consensus       889 kte~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHk-RLHSGE------KPfQCdKClKRFS  961 (1007)
T KOG3623|consen  889 KTEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHK-RLHSGE------KPFQCDKCLKRFS  961 (1007)
T ss_pred             cCccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhh-hhccCC------Ccchhhhhhhhcc
Confidence            344557999999999988899999999999999999999999999999999999 999999      8999999999997


Q ss_pred             hcc
Q psy9695         152 AKH  154 (159)
Q Consensus       152 ~~~  154 (159)
                      ...
T Consensus       962 HSG  964 (1007)
T KOG3623|consen  962 HSG  964 (1007)
T ss_pred             ccc
Confidence            654


No 11 
>PHA00733 hypothetical protein
Probab=99.31  E-value=5.6e-13  Score=81.44  Aligned_cols=97  Identities=16%  Similarity=0.239  Sum_probs=73.2

Q ss_pred             HHHHHHHHhhcCCCccccccccccccCccccccc--cccccccCCCCCccCcccccccCChHHHHHHHHHccCCCCccCC
Q psy9695          32 SALQIHMRTHTGDKPFRCTICQKAFTTKGNLKLI--PNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCT  109 (159)
Q Consensus        32 ~~~~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~--~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~  109 (159)
                      .+|..+-.....++++.|.+|...+.....+..+  ........+..+|.|+.|++.|.+...|..|++.+  +.+|.|+
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            3344333333446779999999988887777653  11122344577899999999999999999999976  4579999


Q ss_pred             cccccccccCCceeeehhhcc
Q psy9695         110 ICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       110 ~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      +|+++|.....|..|+...|.
T Consensus       104 ~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        104 VCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCccCCHHHHHHHHHHhcC
Confidence            999999999999999955554


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.18  E-value=2e-11  Score=62.29  Aligned_cols=46  Identities=15%  Similarity=0.390  Sum_probs=41.7

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceee
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVR  124 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  124 (159)
                      .|.|+.||+.|...+.|..|++.|+  ++|+|..|++.|.+.+.|..-
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~~~   50 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYIEI   50 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeEEE
Confidence            5899999999999999999999998  799999999999988888643


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.14  E-value=7.3e-11  Score=87.50  Aligned_cols=92  Identities=18%  Similarity=0.334  Sum_probs=54.3

Q ss_pred             cccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccc---------
Q psy9695          47 FRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTT---------  117 (159)
Q Consensus        47 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~---------  117 (159)
                      +.|+.|+..|. ...+..|..   .++  .++.|+ |+..+ ....|..|...|..++++.|..|++.|..         
T Consensus       454 ~~C~~Cgk~f~-~s~LekH~~---~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        454 VHCEKCGQAFQ-QGEMEKHMK---VFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             ccCCCCCCccc-hHHHHHHHH---hcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhh
Confidence            46777776664 344444322   121  456777 77544 44667777777777777777777776642         


Q ss_pred             -cCCceeeehhhccCCCCCcccccccchhhchhhhhcc
Q psy9695         118 -KGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKH  154 (159)
Q Consensus       118 -~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~  154 (159)
                       .+.|..|. ... +.      +++.|..|++.+..++
T Consensus       526 ~~s~Lt~HE-~~C-G~------rt~~C~~Cgk~Vrlrd  555 (567)
T PLN03086        526 RLRGMSEHE-SIC-GS------RTAPCDSCGRSVMLKE  555 (567)
T ss_pred             hhhhHHHHH-Hhc-CC------cceEccccCCeeeehh
Confidence             23566666 443 44      5677777777665543


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.11  E-value=1.6e-11  Score=90.88  Aligned_cols=62  Identities=18%  Similarity=0.400  Sum_probs=39.0

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhh
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQ  151 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~  151 (159)
                      +.|+.|++.|. ...|..|+..++  +++.|+ ||+.+ ....|..|+ .+|...      +++.|+.|++.|.
T Consensus       454 ~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~-~thCp~------Kpi~C~fC~~~v~  515 (567)
T PLN03086        454 VHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQ-ASTCPL------RLITCRFCGDMVQ  515 (567)
T ss_pred             ccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhh-hccCCC------CceeCCCCCCccc
Confidence            46667766664 455666666653  566676 76543 446666666 666666      6677777766663


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.02  E-value=2.8e-11  Score=61.79  Aligned_cols=43  Identities=7%  Similarity=0.108  Sum_probs=39.0

Q ss_pred             CccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhcccc
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKHKT  156 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l  156 (159)
                      .|.|+.||+.|+..+.|..|+ ++|.        ++|+|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~-r~H~--------k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHL-RKHN--------TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHH-HhcC--------CcccCCcccceeccccee
Confidence            489999999999999999999 8888        368999999999987765


No 16 
>PHA00733 hypothetical protein
Probab=99.00  E-value=2e-11  Score=74.59  Aligned_cols=76  Identities=18%  Similarity=0.277  Sum_probs=59.9

Q ss_pred             CCCCCccCcccccccCChHHHHHHHH-----HccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhc
Q psy9695          73 AGMPKHLCHVCHKNFSSSSALQIHMR-----THTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEG  147 (159)
Q Consensus        73 ~~~~~~~C~~C~~~~~~~~~l~~H~~-----~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~  147 (159)
                      ..++++.|..|...|..+..|..+..     .+.+++||.|+.||+.|...+.|..|+ +.|.        .+|.|+.|+
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~-r~h~--------~~~~C~~Cg  106 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHI-RYTE--------HSKVCPVCG  106 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHH-hcCC--------cCccCCCCC
Confidence            34567899999988777666555411     234588999999999999999999999 6652        469999999


Q ss_pred             hhhhhccccc
Q psy9695         148 KSFQAKHKTE  157 (159)
Q Consensus       148 ~~f~~~~~l~  157 (159)
                      ++|...+.|.
T Consensus       107 K~F~~~~sL~  116 (128)
T PHA00733        107 KEFRNTDSTL  116 (128)
T ss_pred             CccCCHHHHH
Confidence            9999887764


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.97  E-value=3.2e-10  Score=49.71  Aligned_cols=26  Identities=54%  Similarity=1.170  Sum_probs=22.0

Q ss_pred             HHHHHHHHccCCCCccCCcccccccc
Q psy9695          92 ALQIHMRTHTGDKPFRCTICQKAFTT  117 (159)
Q Consensus        92 ~l~~H~~~h~~~~~~~C~~C~~~f~~  117 (159)
                      +|..|++.|++++||.|++|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47789999999999999999998863


No 18 
>PHA00616 hypothetical protein
Probab=98.52  E-value=4.9e-08  Score=47.58  Aligned_cols=34  Identities=12%  Similarity=0.180  Sum_probs=23.2

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTI  110 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~  110 (159)
                      ||.|+.||+.|...+.|..|.+.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4667777777777777777777777776666654


No 19 
>KOG3993|consensus
Probab=98.52  E-value=9.4e-08  Score=67.90  Aligned_cols=77  Identities=17%  Similarity=0.138  Sum_probs=51.2

Q ss_pred             CCCccCcccccccCChHHHHHHHHHccCC----------------------------------------------CCccC
Q psy9695          75 MPKHLCHVCHKNFSSSSALQIHMRTHTGD----------------------------------------------KPFRC  108 (159)
Q Consensus        75 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~----------------------------------------------~~~~C  108 (159)
                      ...|.|..|++.|.+...|+.|+.+|...                                              ....+
T Consensus       354 ~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~p  433 (500)
T KOG3993|consen  354 SGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELP  433 (500)
T ss_pred             CceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCC
Confidence            34689999999999999999997765521                                              01235


Q ss_pred             CcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhcccccC
Q psy9695         109 TICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKHKTET  158 (159)
Q Consensus       109 ~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~  158 (159)
                      ++||..+..+..-..+. +.-..+      +.|.|.+|.-.|-+.-+|+|
T Consensus       434 p~~~~ppsss~~sgg~~-rlg~~~------q~f~~ky~~atfyss~~ltr  476 (500)
T KOG3993|consen  434 PYDGSPPSSSGSSGGYG-RLGIAE------QGFTCKYCPATFYSSPGLTR  476 (500)
T ss_pred             CCCCCCcccCCCCCccc-cccchh------hccccccchHhhhcCcchHh
Confidence            55665555544444444 333333      67888899888888887764


No 20 
>PHA00616 hypothetical protein
Probab=98.50  E-value=6.7e-08  Score=47.09  Aligned_cols=34  Identities=12%  Similarity=0.180  Sum_probs=31.7

Q ss_pred             cccCcccccccCChHHHHHHHHhhcCCCcccccc
Q psy9695          18 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTI   51 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~   51 (159)
                      ||+|+.||+.|....++..|++.+++++++.+..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999988865


No 21 
>PHA00732 hypothetical protein
Probab=98.49  E-value=1.2e-07  Score=52.88  Aligned_cols=47  Identities=26%  Similarity=0.462  Sum_probs=37.9

Q ss_pred             CccCcccccccCChHHHHHHHHH-ccCCCCccCCcccccccccCCceeeehhhcc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRT-HTGDKPFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      ||.|..|++.|.+...|..|++. |.   ++.|+.|++.|.   .|..|. +++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~-~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHF-YSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhh-cccC
Confidence            57899999999999999999885 54   468999999997   577787 4443


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.45  E-value=1.8e-07  Score=40.85  Aligned_cols=25  Identities=56%  Similarity=1.210  Sum_probs=20.4

Q ss_pred             HHHHHHHhhcCCCcccccccccccc
Q psy9695          33 ALQIHMRTHTGDKPFRCTICQKAFT   57 (159)
Q Consensus        33 ~~~~h~~~~~~~~~~~c~~c~~~~~   57 (159)
                      +|..|+++|++++||.|++|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4678888888888888888888875


No 23 
>PHA00732 hypothetical protein
Probab=98.32  E-value=7.5e-08  Score=53.75  Aligned_cols=39  Identities=26%  Similarity=0.254  Sum_probs=33.3

Q ss_pred             CccCCcccccccccCCceeeehh-hccCCCCCcccccccchhhchhhhhc
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIE-INIGSQLPKKAQQHIGAVEGKSFQAK  153 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~-~h~~~~~~~~~~~~~C~~C~~~f~~~  153 (159)
                      ||.|+.|++.|...+.|..|+ + .|.+         +.|+.|+++|...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~-r~~H~~---------~~C~~CgKsF~~l   40 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHA-RRNHTL---------TKCPVCNKSYRRL   40 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHh-hcccCC---------CccCCCCCEeCCh
Confidence            689999999999999999999 5 4542         4799999999853


No 24 
>KOG3993|consensus
Probab=98.30  E-value=5.2e-08  Score=69.16  Aligned_cols=81  Identities=22%  Similarity=0.395  Sum_probs=55.6

Q ss_pred             cccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHccC------------------------
Q psy9695          47 FRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTG------------------------  102 (159)
Q Consensus        47 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~------------------------  102 (159)
                      |.|.+|...|-..-.|..|.-..   ...--|.|++|+++|.-+.+|-+|.++|.-                        
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~R---IV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPR---IVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCe---eEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            77777777665554444322111   111248888888888888888888887751                        


Q ss_pred             ---------CCCccCCcccccccccCCceeeehhhccC
Q psy9695         103 ---------DKPFRCTICQKAFTTKGNLKVREIEINIG  131 (159)
Q Consensus       103 ---------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  131 (159)
                               +..|.|..|+|.|.+..-|++|+ .+|..
T Consensus       345 a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq-lthq~  381 (500)
T KOG3993|consen  345 AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ-LTHQR  381 (500)
T ss_pred             ccccCCcccCceeecHHhhhhhHHHHHHHHhH-Hhhhc
Confidence                     12388999999999999999998 55553


No 25 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.13  E-value=1.2e-06  Score=60.37  Aligned_cols=55  Identities=18%  Similarity=0.416  Sum_probs=44.7

Q ss_pred             CCCccCCc--ccccccccCCceeeehhhccCCC------------CCcccccccchhhchhhhhccccc
Q psy9695         103 DKPFRCTI--CQKAFTTKGNLKVREIEINIGSQ------------LPKKAQQHIGAVEGKSFQAKHKTE  157 (159)
Q Consensus       103 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~------------~~~~~~~~~C~~C~~~f~~~~~l~  157 (159)
                      ++||+|++  |+|+|.....|.-|++-=|....            ...+.+||.|.+|+|+++...+|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLK  415 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLK  415 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccce
Confidence            59999987  99999999999999966663322            224558999999999999988875


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.08  E-value=2.8e-06  Score=44.07  Aligned_cols=49  Identities=31%  Similarity=0.448  Sum_probs=35.1

Q ss_pred             CccCcccccccCChHHHHHHHHH-ccCC-CCccCCcccccccccCCceeeehhh
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRT-HTGD-KPFRCTICQKAFTTKGNLKVREIEI  128 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~-h~~~-~~~~C~~C~~~f~~~~~l~~H~~~~  128 (159)
                      .|.|+.|++. .+...|..|... |..+ +.+.||+|...+.  .+|..|+...
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            3789999994 556788888765 4443 4688999998655  4888888433


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.87  E-value=8.8e-06  Score=34.32  Aligned_cols=22  Identities=50%  Similarity=0.828  Sum_probs=12.5

Q ss_pred             ccCcccccccCChHHHHHHHHH
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRT   99 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~   99 (159)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455556556555555555554


No 28 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.82  E-value=1.3e-05  Score=55.41  Aligned_cols=53  Identities=30%  Similarity=0.652  Sum_probs=43.3

Q ss_pred             CCCccCcc--cccccCChHHHHHHHHHcc-------------------CCCCccCCcccccccccCCceeeehh
Q psy9695          75 MPKHLCHV--CHKNFSSSSALQIHMRTHT-------------------GDKPFRCTICQKAFTTKGNLKVREIE  127 (159)
Q Consensus        75 ~~~~~C~~--C~~~~~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  127 (159)
                      .+||+|+.  |++.+.....|.-|+...+                   .++||+|++|+|.|.....|.-|..-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            47899987  8888888888888876322                   25899999999999999999988743


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.80  E-value=1.5e-05  Score=33.53  Aligned_cols=23  Identities=52%  Similarity=0.879  Sum_probs=20.4

Q ss_pred             ccCcccccccCChHHHHHHHHhh
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTH   41 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~   41 (159)
                      |+|+.|++.|.+...|..|+..|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998764


No 30 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.75  E-value=5.9e-06  Score=42.84  Aligned_cols=41  Identities=12%  Similarity=0.254  Sum_probs=32.3

Q ss_pred             CccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhh
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQ  151 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~  151 (159)
                      .|.||+|++. .....|..|....|..+.     +.+.||+|...+.
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~-----~~v~CPiC~~~~~   42 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSES-----KNVVCPICSSRVT   42 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCC-----CCccCCCchhhhh
Confidence            4899999995 455778889977777652     5799999998655


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.68  E-value=3.1e-06  Score=37.25  Aligned_cols=22  Identities=50%  Similarity=0.733  Sum_probs=10.9

Q ss_pred             ccCcccccccCChHHHHHHHHH
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRT   99 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~   99 (159)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCT
T ss_pred             CCCCccCCccCChhHHHHHhHH
Confidence            4455555555555555555443


No 32 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.63  E-value=9.5e-05  Score=36.96  Aligned_cols=42  Identities=17%  Similarity=0.241  Sum_probs=26.0

Q ss_pred             cCCccccccCCCCcccCcccccccCChHHHHHHHHhhcCCCc
Q psy9695           5 LIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKP   46 (159)
Q Consensus         5 ~~~~~~~~~~~~~~~~C~~C~~~f~~~~~~~~h~~~~~~~~~   46 (159)
                      +..+.......+.|.+|++|+..++...+|..|+.+.++.+|
T Consensus        11 ~~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   11 STKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             -----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            344455556678889999999999999999999988776654


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.50  E-value=9.2e-05  Score=31.20  Aligned_cols=23  Identities=52%  Similarity=0.933  Sum_probs=18.8

Q ss_pred             ccCcccccccCChHHHHHHHHhh
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTH   41 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~   41 (159)
                      |.|+.|+..|.+...+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            67999999999999999999765


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.49  E-value=6.1e-05  Score=33.00  Aligned_cols=26  Identities=27%  Similarity=0.664  Sum_probs=22.2

Q ss_pred             CccCCcccccccccCCceeeehhhccC
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIG  131 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~  131 (159)
                      ||.|..|++.|.....|..|+ +.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~-~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHK-RSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHH-CTTTT
T ss_pred             CCCCCccCCccCChhHHHHHh-HHhcC
Confidence            588999999999999999999 76653


No 35 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.47  E-value=0.0001  Score=31.08  Aligned_cols=23  Identities=52%  Similarity=0.933  Sum_probs=11.6

Q ss_pred             ccCcccccccCChHHHHHHHHHc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTH  100 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h  100 (159)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34555555555555555555543


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.41  E-value=2.3e-05  Score=45.81  Aligned_cols=76  Identities=18%  Similarity=0.355  Sum_probs=22.1

Q ss_pred             ccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehh
Q psy9695          48 RCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIE  127 (159)
Q Consensus        48 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  127 (159)
                      .|..|+..|.+...+..|+...+   +   +.-+... .+.....+..+...-. ...+.|.+|++.|.....|..|+..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H---~---~~~~~~~-~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKH---G---FDIPDQK-YLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             --------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             Ccccccccccccccccccccccc---c---ccccccc-cccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcC
Confidence            48889999888888876543211   1   1111111 1112233333333221 2369999999999999999999944


Q ss_pred             hccC
Q psy9695         128 INIG  131 (159)
Q Consensus       128 ~h~~  131 (159)
                      .++.
T Consensus        73 ~~H~   76 (100)
T PF12756_consen   73 KHHK   76 (100)
T ss_dssp             TTTT
T ss_pred             ccCC
Confidence            4443


No 37 
>PRK04860 hypothetical protein; Provisional
Probab=97.34  E-value=0.00014  Score=46.22  Aligned_cols=39  Identities=26%  Similarity=0.636  Sum_probs=27.1

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccC
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKG  119 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  119 (159)
                      +|.|. |+.   ....+..|.+++.++++|.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            57776 776   4455677777777777777777777766543


No 38 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.12  E-value=0.00041  Score=40.44  Aligned_cols=74  Identities=31%  Similarity=0.405  Sum_probs=22.1

Q ss_pred             cCcccccccCChHHHHHHHHhhcCCCccccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHH
Q psy9695          20 LCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRT   99 (159)
Q Consensus        20 ~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~   99 (159)
                      +|..|+..|.+...+..|+...++...-   . .........+..   ..... -...+.|..|++.|.+...|..|++.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~---~-~~~l~~~~~~~~---~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP---D-QKYLVDPNRLLN---YLRKK-VKESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             --------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccc---c-cccccccccccc---ccccc-cCCCCCCCccCCCCcCHHHHHHHHcC
Confidence            5899999999999999999654432111   1 011111111111   11111 11259999999999999999999997


Q ss_pred             cc
Q psy9695         100 HT  101 (159)
Q Consensus       100 h~  101 (159)
                      +.
T Consensus        73 ~~   74 (100)
T PF12756_consen   73 KH   74 (100)
T ss_dssp             TT
T ss_pred             cc
Confidence            53


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.97  E-value=0.001  Score=33.32  Aligned_cols=34  Identities=21%  Similarity=0.355  Sum_probs=20.7

Q ss_pred             cCCCCCccCcccccccCChHHHHHHHHHccCCCC
Q psy9695          72 VAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKP  105 (159)
Q Consensus        72 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~  105 (159)
                      .....|-.|+.|+..+....+|..|+...++.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3455677888888888888888888877666554


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.94  E-value=0.0011  Score=28.17  Aligned_cols=22  Identities=59%  Similarity=0.874  Sum_probs=12.6

Q ss_pred             cCcccccccCChHHHHHHHHHc
Q psy9695          79 LCHVCHKNFSSSSALQIHMRTH  100 (159)
Q Consensus        79 ~C~~C~~~~~~~~~l~~H~~~h  100 (159)
                      .|..|++.|.....|..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4555666666655666665543


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=96.92  E-value=0.00016  Score=46.04  Aligned_cols=40  Identities=20%  Similarity=0.401  Sum_probs=35.3

Q ss_pred             CccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhccc
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKHK  155 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~  155 (159)
                      +|.|. |+.   ....++.|. ++|.++      ++|.|..|+..|.....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~-ri~~g~------~~YrC~~C~~~l~~~~~  158 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHN-RVVRGE------AVYRCRRCGETLVFKGE  158 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHH-HHhcCC------ccEECCCCCceeEEecc
Confidence            69998 997   788889999 999999      89999999999986654


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.90  E-value=0.0011  Score=28.14  Aligned_cols=24  Identities=54%  Similarity=0.721  Sum_probs=20.7

Q ss_pred             ccCcccccccCChHHHHHHHHhhc
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHT   42 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~   42 (159)
                      |.|+.|++.|.....+..|+..|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988654


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.50  E-value=0.00047  Score=30.14  Aligned_cols=20  Identities=35%  Similarity=0.765  Sum_probs=16.1

Q ss_pred             ccCCcccccccccCCceeee
Q psy9695         106 FRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~  125 (159)
                      |.|..|++.|.....|..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            67888888888888888887


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.20  E-value=0.0032  Score=26.77  Aligned_cols=22  Identities=41%  Similarity=0.967  Sum_probs=18.6

Q ss_pred             ccCcccccccCChHHHHHHHHh
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRT   40 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~   40 (159)
                      |.|..|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5688999999999999988864


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.16  E-value=0.0047  Score=26.01  Aligned_cols=23  Identities=30%  Similarity=0.527  Sum_probs=17.3

Q ss_pred             ccCcccccccCChHHHHHHHHhhc
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHT   42 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~   42 (159)
                      |+|+.|+.... ...|..|+..++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            68999998887 888999987754


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.93  E-value=0.0063  Score=25.58  Aligned_cols=22  Identities=32%  Similarity=0.555  Sum_probs=11.6

Q ss_pred             ccCcccccccCChHHHHHHHHHc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTH  100 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h  100 (159)
                      |.|+.|+.... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666665555 55666666554


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.86  E-value=0.0043  Score=26.36  Aligned_cols=20  Identities=45%  Similarity=1.041  Sum_probs=9.7

Q ss_pred             cCcccccccCChHHHHHHHH
Q psy9695          79 LCHVCHKNFSSSSALQIHMR   98 (159)
Q Consensus        79 ~C~~C~~~~~~~~~l~~H~~   98 (159)
                      .|..|+..|.+...+..|.+
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            34455555555555544443


No 48 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.60  E-value=0.008  Score=30.65  Aligned_cols=37  Identities=19%  Similarity=0.180  Sum_probs=30.7

Q ss_pred             cCCccccccCCCCcccCcccccccCChHHHHHHHHhh
Q psy9695           5 LIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTH   41 (159)
Q Consensus         5 ~~~~~~~~~~~~~~~~C~~C~~~f~~~~~~~~h~~~~   41 (159)
                      +.+..+.+-+||.-+.|+-|+..|+.......|+...
T Consensus         4 ~KA~Kv~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049           4 LKAIKVRDRDGEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             ceeeEeeccCCceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            3445567778999999999999999999999998653


No 49 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.48  E-value=0.0081  Score=27.56  Aligned_cols=10  Identities=30%  Similarity=1.119  Sum_probs=5.8

Q ss_pred             CCccCCcccc
Q psy9695         104 KPFRCTICQK  113 (159)
Q Consensus       104 ~~~~C~~C~~  113 (159)
                      .++.|++||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4566666653


No 50 
>KOG1146|consensus
Probab=95.15  E-value=0.029  Score=46.49  Aligned_cols=128  Identities=16%  Similarity=0.285  Sum_probs=76.7

Q ss_pred             CCCcccCcccccccCChHHHHHHHHhhcCCCccccccccccccCccccccccccccccCCCCCccCcccccccCChHHHH
Q psy9695          15 GMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQ   94 (159)
Q Consensus        15 ~~~~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~   94 (159)
                      -.+-++|+.|+..++....|..|++..+.+...  ..|- .+.....+.+   -..-..+..+|.|..|...+.....|.
T Consensus       462 ~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~-~gq~~~~~ar---g~~~~~~~~p~~C~~C~~stttng~Ls  535 (1406)
T KOG1146|consen  462 FFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCK-AGQNHPRLAR---GEVYRCPGKPYPCRACNYSTTTNGNLS  535 (1406)
T ss_pred             ccccccCCccchhhhhHHHhhhcccccccccch--hHhH-hccccccccc---cccccCCCCcccceeeeeeeecchHHH
Confidence            346689999999999999999998763322111  1111 0101100100   001122345677888887777777777


Q ss_pred             HHHHHcc------------------------------------------C-CCCccCCcccccccccCCceeeehhhccC
Q psy9695          95 IHMRTHT------------------------------------------G-DKPFRCTICQKAFTTKGNLKVREIEINIG  131 (159)
Q Consensus        95 ~H~~~h~------------------------------------------~-~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  131 (159)
                      .|+....                                          . .-+|.|.+|+..-.-..+|+.|+...++.
T Consensus       536 ihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmtss~~s  615 (1406)
T KOG1146|consen  536 IHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTASPSS  615 (1406)
T ss_pred             HHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhccccccccCCCC
Confidence            7766211                                          0 12489999999888889999999666665


Q ss_pred             CCCCcccccccchhhchhhhhcc
Q psy9695         132 SQLPKKAQQHIGAVEGKSFQAKH  154 (159)
Q Consensus       132 ~~~~~~~~~~~C~~C~~~f~~~~  154 (159)
                      .      .+--+..+...+...+
T Consensus       616 ~------~p~~~Lq~~it~~l~~  632 (1406)
T KOG1146|consen  616 S------PPSLVLQQNITSSLAS  632 (1406)
T ss_pred             C------ChHHHhhhcchhhccc
Confidence            5      4455555555554433


No 51 
>KOG2231|consensus
Probab=95.12  E-value=0.012  Score=45.62  Aligned_cols=45  Identities=24%  Similarity=0.530  Sum_probs=34.4

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcc------cccccccCCceeeeh
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTIC------QKAFTTKGNLKVREI  126 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~  126 (159)
                      -.|..|..-|.....|..|++.++    |.|..|      +.-|.....|..|..
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR  233 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFR  233 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhh
Confidence            568889999988889999988654    556555      456677788888883


No 52 
>PHA00626 hypothetical protein
Probab=94.66  E-value=0.012  Score=30.05  Aligned_cols=15  Identities=13%  Similarity=0.352  Sum_probs=8.8

Q ss_pred             CCccCCccccccccc
Q psy9695         104 KPFRCTICQKAFTTK  118 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~  118 (159)
                      ..|.|+.||..|+-.
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            446666666666543


No 53 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.33  E-value=0.044  Score=32.67  Aligned_cols=45  Identities=18%  Similarity=0.535  Sum_probs=29.6

Q ss_pred             cCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeee
Q psy9695          79 LCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus        79 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      .|-.|...|.......  ...-.....|+|+.|...|-..-+.-.|.
T Consensus        57 ~C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~FC~dCD~fiHe  101 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNVFCVDCDVFVHE  101 (112)
T ss_pred             cccCcCCCCCCccccc--ccccccccceeCCCCCCccccccchhhhh
Confidence            4788888776543111  00012244689999999999888888888


No 54 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.33  E-value=0.052  Score=23.14  Aligned_cols=20  Identities=25%  Similarity=0.688  Sum_probs=14.2

Q ss_pred             ccCcccccccCChHHHHHHHH
Q psy9695          19 HLCHVCHKNFSSSSALQIHMR   39 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~   39 (159)
                      ..|+.|++.| ....+..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4688888888 5666777754


No 55 
>KOG2893|consensus
Probab=93.90  E-value=0.043  Score=36.98  Aligned_cols=48  Identities=25%  Similarity=0.652  Sum_probs=40.1

Q ss_pred             cCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhcc
Q psy9695          79 LCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus        79 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      .|=+|++.|.....|+.|+++    +-|+|.+|.|..-+...|..|--++|.
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            477899999999999988874    458999999999888899888756653


No 56 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.37  E-value=0.033  Score=37.49  Aligned_cols=50  Identities=20%  Similarity=0.175  Sum_probs=23.9

Q ss_pred             CCccCCcccccccccCCceeeehhhcc--------CCCCCcccccccchhhchhhhhc
Q psy9695         104 KPFRCTICQKAFTTKGNLKVREIEINI--------GSQLPKKAQQHIGAVEGKSFQAK  153 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~~~~h~--------~~~~~~~~~~~~C~~C~~~f~~~  153 (159)
                      +...||+|++.|....-.....+....        ++..|.-=....||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            445677777776655444433311111        11111111355677777776544


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.36  E-value=0.011  Score=30.19  Aligned_cols=29  Identities=17%  Similarity=0.359  Sum_probs=19.6

Q ss_pred             CCCCccCCcccccccccCCceeeehhhcc
Q psy9695         102 GDKPFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       102 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      ||..++||-||..|...-+...|..+.|.
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            45556777777777777777777755553


No 58 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.67  E-value=0.11  Score=23.82  Aligned_cols=22  Identities=18%  Similarity=0.711  Sum_probs=18.5

Q ss_pred             cccCcccccccCChHHHHHHHH
Q psy9695          18 KHLCHVCHKNFSSSSALQIHMR   39 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~~~~h~~   39 (159)
                      +|.|..|+..|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5789999999998888888874


No 59 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.58  E-value=0.1  Score=35.17  Aligned_cols=10  Identities=20%  Similarity=0.494  Sum_probs=6.6

Q ss_pred             ccCccccccc
Q psy9695          78 HLCHVCHKNF   87 (159)
Q Consensus        78 ~~C~~C~~~~   87 (159)
                      ++|+.||.++
T Consensus        49 ~vCP~CgyA~   58 (214)
T PF09986_consen   49 WVCPHCGYAA   58 (214)
T ss_pred             EECCCCCCcc
Confidence            5677777654


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.44  E-value=0.062  Score=39.51  Aligned_cols=56  Identities=34%  Similarity=0.627  Sum_probs=49.4

Q ss_pred             CCccCcccccccCChHHHHHHHH--HccCC--CCccCC--cccccccccCCceeeehhhccCC
Q psy9695          76 PKHLCHVCHKNFSSSSALQIHMR--THTGD--KPFRCT--ICQKAFTTKGNLKVREIEINIGS  132 (159)
Q Consensus        76 ~~~~C~~C~~~~~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~  132 (159)
                      .++.|..|...|.....+..|..  .|.++  +++.|+  .|++.|.+...+..|. ..|.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~~  349 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI-LLHTSI  349 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc-ccccCC
Confidence            35888999999999999999999  79999  899999  7999999999999999 888766


No 61 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.02  E-value=0.088  Score=24.29  Aligned_cols=10  Identities=30%  Similarity=0.664  Sum_probs=5.3

Q ss_pred             ccCccccccc
Q psy9695          78 HLCHVCHKNF   87 (159)
Q Consensus        78 ~~C~~C~~~~   87 (159)
                      |.|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            4555555543


No 62 
>KOG2186|consensus
Probab=91.99  E-value=0.069  Score=36.32  Aligned_cols=45  Identities=24%  Similarity=0.505  Sum_probs=32.0

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeee
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      |.|..||....-+ .+..|+...++ .-|.|..|++.|.. .+...|.
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            6788888776555 35567777766 55788888888877 6666666


No 63 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=91.96  E-value=0.055  Score=26.29  Aligned_cols=12  Identities=25%  Similarity=0.650  Sum_probs=6.5

Q ss_pred             ccCcccccccCC
Q psy9695          78 HLCHVCHKNFSS   89 (159)
Q Consensus        78 ~~C~~C~~~~~~   89 (159)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            555555555543


No 64 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=91.84  E-value=0.054  Score=28.19  Aligned_cols=32  Identities=25%  Similarity=0.580  Sum_probs=16.4

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCcccc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQK  113 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  113 (159)
                      .|.|+.||+.....-.   .-+  ....+|.|+.||.
T Consensus        25 ~F~CPnCG~~~I~RC~---~CR--k~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCE---KCR--KQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeech---hHH--hcCCceECCCCCC
Confidence            4777777765322211   011  1235677777774


No 65 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.36  E-value=0.14  Score=37.57  Aligned_cols=121  Identities=27%  Similarity=0.492  Sum_probs=70.4

Q ss_pred             CcccCcccccccCChHHHHHHHH--hhcCC--Cccccc--cccccccCccccccccccccccCCCCCccCcc--------
Q psy9695          17 PKHLCHVCHKNFSSSSALQIHMR--THTGD--KPFRCT--ICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHV--------   82 (159)
Q Consensus        17 ~~~~C~~C~~~f~~~~~~~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~--------   82 (159)
                      .++.|..|...|.....+..|..  .|.++  +++.|+  .|+..|.....+..   +...+.+..++.+..        
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  364 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKR---HILLHTSISPAKEKLLNSSSKFS  364 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccC---CcccccCCCccccccccCccccc
Confidence            45777778888877777777777  67777  777777  67777777776655   223333333322222        


Q ss_pred             -----------------------------cccccCChHHHHHHHHHccCCC--CccCCcccccccccCCceeeehhhccC
Q psy9695          83 -----------------------------CHKNFSSSSALQIHMRTHTGDK--PFRCTICQKAFTTKGNLKVREIEINIG  131 (159)
Q Consensus        83 -----------------------------C~~~~~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~~h~~  131 (159)
                                                   |...+.....+..|...+....  .+.+..|.+.|.....+..|+ +.|..
T Consensus       365 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~  443 (467)
T COG5048         365 PLLNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHK-KIHTN  443 (467)
T ss_pred             cccCCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccc-ccccc
Confidence                                         1112222222222222222222  355677888888888888888 77766


Q ss_pred             CCCCcccccccchhhc
Q psy9695         132 SQLPKKAQQHIGAVEG  147 (159)
Q Consensus       132 ~~~~~~~~~~~C~~C~  147 (159)
                      .      .++.|..++
T Consensus       444 ~------~~~~~~~~~  453 (467)
T COG5048         444 H------APLLCSILK  453 (467)
T ss_pred             C------Cceeecccc
Confidence            5      455554443


No 66 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.94  E-value=0.093  Score=25.09  Aligned_cols=11  Identities=27%  Similarity=0.697  Sum_probs=5.9

Q ss_pred             ccCcccccccC
Q psy9695          78 HLCHVCHKNFS   88 (159)
Q Consensus        78 ~~C~~C~~~~~   88 (159)
                      |.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            45555555553


No 67 
>KOG2893|consensus
Probab=90.92  E-value=0.054  Score=36.55  Aligned_cols=42  Identities=19%  Similarity=0.333  Sum_probs=32.5

Q ss_pred             CCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhcccc
Q psy9695         103 DKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKHKT  156 (159)
Q Consensus       103 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l  156 (159)
                      +++| |.+|++.|-..-.|..|++.           +-|+|-+|.+++-+--.|
T Consensus         9 ~kpw-cwycnrefddekiliqhqka-----------khfkchichkkl~sgpgl   50 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKA-----------KHFKCHICHKKLFSGPGL   50 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhh-----------ccceeeeehhhhccCCCc
Confidence            4554 89999999999999888822           458999999987665443


No 68 
>KOG2482|consensus
Probab=90.15  E-value=0.33  Score=34.67  Aligned_cols=109  Identities=23%  Similarity=0.376  Sum_probs=65.6

Q ss_pred             cccCcccccccCChHHHHHHHHh--hcCCCc--------cc--cccccccccCccc-cccccc-ccc-c--------cCC
Q psy9695          18 KHLCHVCHKNFSSSSALQIHMRT--HTGDKP--------FR--CTICQKAFTTKGN-LKLIPN-AVF-N--------VAG   74 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~~~~h~~~--~~~~~~--------~~--c~~c~~~~~~~~~-l~~~~~-~~~-~--------~~~   74 (159)
                      .+.|-.|.+.|+.+..|..||+.  |....|        |.  ...-|++.+.... ..+... ... .        ..+
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            47899999999999999999975  322222        11  1112222111100 000000 000 0        001


Q ss_pred             CCC--ccCcccccccCChHHHHHHHHHccC-C--------------------------CCccCCcccccccccCCceeee
Q psy9695          75 MPK--HLCHVCHKNFSSSSALQIHMRTHTG-D--------------------------KPFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus        75 ~~~--~~C~~C~~~~~~~~~l~~H~~~h~~-~--------------------------~~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      ..+  .+|..|.....++..|..|++.-+. +                          ..-.|-.|.-.|.....|..||
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence            112  5899999999999999999986432 0                          1235888999999999999999


Q ss_pred             h
Q psy9695         126 I  126 (159)
Q Consensus       126 ~  126 (159)
                      .
T Consensus       355 ~  355 (423)
T KOG2482|consen  355 V  355 (423)
T ss_pred             c
Confidence            3


No 69 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.09  E-value=0.23  Score=23.31  Aligned_cols=32  Identities=25%  Similarity=0.715  Sum_probs=14.6

Q ss_pred             cCcccccccCChHHHHHHHHHccCCCCccCCcccccc
Q psy9695          79 LCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAF  115 (159)
Q Consensus        79 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  115 (159)
                      .|+.|+..|.-..+     ++..+.+..+|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            45555555544332     111223345566665544


No 70 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.09  E-value=0.2  Score=23.57  Aligned_cols=13  Identities=23%  Similarity=0.572  Sum_probs=6.7

Q ss_pred             ccCcccccccCCh
Q psy9695          78 HLCHVCHKNFSSS   90 (159)
Q Consensus        78 ~~C~~C~~~~~~~   90 (159)
                      +.|+.|+..|.-.
T Consensus         3 ~~CP~C~~~~~v~   15 (38)
T TIGR02098         3 IQCPNCKTSFRVV   15 (38)
T ss_pred             EECCCCCCEEEeC
Confidence            3455666555443


No 71 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.63  E-value=1.3  Score=26.60  Aligned_cols=86  Identities=20%  Similarity=0.298  Sum_probs=51.4

Q ss_pred             CCcccCcccccccCChHHHHHHHHhhcCCCc------------cccccccccccCccccccccccccccCCCCCccCccc
Q psy9695          16 MPKHLCHVCHKNFSSSSALQIHMRTHTGDKP------------FRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVC   83 (159)
Q Consensus        16 ~~~~~C~~C~~~f~~~~~~~~h~~~~~~~~~------------~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C   83 (159)
                      +-|..|+.|+-+.-....|.+.....-..++            ..|--|+..|........     ........|.|+.|
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~-----~~~~~~~~y~C~~C   87 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF-----DELKDSHRYVCAVC   87 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc-----cccccccceeCCCC
Confidence            4577899999887776666653221111111            236667777755432110     00123446999999


Q ss_pred             ccccCChHHHHHHHHHccCCCCccCCccc
Q psy9695          84 HKNFSSSSALQIHMRTHTGDKPFRCTICQ  112 (159)
Q Consensus        84 ~~~~~~~~~l~~H~~~h~~~~~~~C~~C~  112 (159)
                      ...|--.=+...|...|      .|+-|.
T Consensus        88 ~~~FC~dCD~fiHe~Lh------~CPGC~  110 (112)
T TIGR00622        88 KNVFCVDCDVFVHESLH------CCPGCI  110 (112)
T ss_pred             CCccccccchhhhhhcc------CCcCCC
Confidence            99997776777777666      466664


No 72 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=89.52  E-value=0.12  Score=25.63  Aligned_cols=30  Identities=17%  Similarity=0.421  Sum_probs=17.1

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCccccccc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFT  116 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  116 (159)
                      .|.|+.||..+.....          .....|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCceECCCCCCeEE
Confidence            4677777766543211          11567888875443


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=88.92  E-value=0.13  Score=26.82  Aligned_cols=32  Identities=25%  Similarity=0.483  Sum_probs=18.3

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCcccc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQK  113 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  113 (159)
                      .|.|+.||+.....-.     +--....+|+|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~-----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCA-----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhh-----hHHHcCCceECCCcCc
Confidence            4778888865444321     1111245788888874


No 74 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.86  E-value=0.32  Score=22.71  Aligned_cols=32  Identities=19%  Similarity=0.582  Sum_probs=14.6

Q ss_pred             cCcccccccCChHHHHHHHHHccCCCCccCCcccccc
Q psy9695          79 LCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAF  115 (159)
Q Consensus        79 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  115 (159)
                      .|+.|+..|.-....     +-...+..+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            455555555444331     11222334566665544


No 75 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=88.79  E-value=0.17  Score=25.71  Aligned_cols=29  Identities=21%  Similarity=0.484  Sum_probs=17.0

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQK  113 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  113 (159)
                      |.|..|+..|.....+      .. +.+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKM------SD-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEec------CC-CCCCCCCCCCC
Confidence            6788888777543221      11 34456888875


No 76 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.64  E-value=0.22  Score=31.98  Aligned_cols=24  Identities=17%  Similarity=0.508  Sum_probs=17.9

Q ss_pred             CccCCcccccccccCCceeeehhhccCCCCCcccccccchhhch
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGK  148 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~  148 (159)
                      .|.|++||..              +.++      .|-+||+||.
T Consensus       134 ~~vC~vCGy~--------------~~ge------~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT--------------HEGE------APEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc--------------ccCC------CCCcCCCCCC
Confidence            5999999843              3345      7889999984


No 77 
>KOG1146|consensus
Probab=88.15  E-value=0.18  Score=42.17  Aligned_cols=53  Identities=30%  Similarity=0.611  Sum_probs=39.6

Q ss_pred             CCccCcccccccCChHHHHHHHHH-cc------------------------CCCCccCCcccccccccCCceeeehhh
Q psy9695          76 PKHLCHVCHKNFSSSSALQIHMRT-HT------------------------GDKPFRCTICQKAFTTKGNLKVREIEI  128 (159)
Q Consensus        76 ~~~~C~~C~~~~~~~~~l~~H~~~-h~------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~~  128 (159)
                      +.+.|+.|+..|.....|..|++. |.                        +-++|.|..|..+++...+|..|+...
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS~  541 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQSD  541 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHHH
Confidence            567788888888888888888776 11                        126788888999988888888888443


No 78 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=87.73  E-value=0.13  Score=24.70  Aligned_cols=12  Identities=8%  Similarity=0.039  Sum_probs=7.7

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      ..|.|..|+..+
T Consensus        27 ~fy~C~~C~~~w   38 (40)
T smart00440       27 VFYVCTKCGHRW   38 (40)
T ss_pred             EEEEeCCCCCEe
Confidence            566776666554


No 79 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=87.58  E-value=1  Score=26.79  Aligned_cols=26  Identities=19%  Similarity=0.475  Sum_probs=19.2

Q ss_pred             CCCcccCcccccccCChHHHHHHHHhh
Q psy9695          15 GMPKHLCHVCHKNFSSSSALQIHMRTH   41 (159)
Q Consensus        15 ~~~~~~C~~C~~~f~~~~~~~~h~~~~   41 (159)
                      .-+-..|..|+.+..- .++..|++..
T Consensus         8 ~~~vlIC~~C~~av~~-~~v~~HL~~~   33 (109)
T PF12013_consen    8 EYRVLICRQCQYAVQP-SEVESHLRKR   33 (109)
T ss_pred             cCCEEEeCCCCcccCc-hHHHHHHHHh
Confidence            3445789999987655 7888898743


No 80 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=87.12  E-value=0.069  Score=25.49  Aligned_cols=12  Identities=8%  Similarity=0.019  Sum_probs=8.4

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      ..|.|..|+..|
T Consensus        27 ~fy~C~~C~~~w   38 (39)
T PF01096_consen   27 LFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEESSSTEEE
T ss_pred             EEEEeCCCCCee
Confidence            577777777654


No 81 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=87.06  E-value=0.19  Score=25.75  Aligned_cols=19  Identities=26%  Similarity=0.391  Sum_probs=11.4

Q ss_pred             ccchhhchhhhhcccccCC
Q psy9695         141 HIGAVEGKSFQAKHKTETC  159 (159)
Q Consensus       141 ~~C~~C~~~f~~~~~l~~~  159 (159)
                      .+|+.||+.|...+.++.|
T Consensus         6 ~~C~~Cg~~~~~~dDiVvC   24 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVC   24 (54)
T ss_pred             ccChhhCCcccCCCCEEEC
Confidence            4566666666666655544


No 82 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.20  E-value=0.5  Score=28.15  Aligned_cols=11  Identities=27%  Similarity=0.782  Sum_probs=5.6

Q ss_pred             CccCccccccc
Q psy9695          77 KHLCHVCHKNF   87 (159)
Q Consensus        77 ~~~C~~C~~~~   87 (159)
                      |.+|+.||..|
T Consensus        26 PivCP~CG~~~   36 (108)
T PF09538_consen   26 PIVCPKCGTEF   36 (108)
T ss_pred             CccCCCCCCcc
Confidence            44555555544


No 83 
>KOG4173|consensus
Probab=86.19  E-value=0.098  Score=34.51  Aligned_cols=80  Identities=20%  Similarity=0.492  Sum_probs=52.6

Q ss_pred             Ccccccc--ccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHHHHcc----------CCCCccCC--c
Q psy9695          45 KPFRCTI--CQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHMRTHT----------GDKPFRCT--I  110 (159)
Q Consensus        45 ~~~~c~~--c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~----------~~~~~~C~--~  110 (159)
                      ..+.|++  |...+........|.      .....-.|..|.+.|.+..-|..|+...+          |.-.|.|-  .
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY------~~~h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEg  151 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHY------HTLHGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEG  151 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhh------hhcccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHh
Confidence            3467776  555555544443221      11223579999999998888888877543          23358884  4


Q ss_pred             ccccccccCCceeeehhhcc
Q psy9695         111 CQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       111 C~~~f~~~~~l~~H~~~~h~  130 (159)
                      |+..|.....-..|+...|-
T Consensus       152 Ct~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  152 CTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhhhhhHHHHhcc
Confidence            99999988888888866664


No 84 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.56  E-value=0.13  Score=32.64  Aligned_cols=16  Identities=38%  Similarity=0.619  Sum_probs=10.0

Q ss_pred             ccCCcccccccccCCc
Q psy9695         106 FRCTICQKAFTTKGNL  121 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l  121 (159)
                      |+|+.||+.|...-.+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            6677777776655443


No 85 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.79  E-value=0.41  Score=30.63  Aligned_cols=19  Identities=21%  Similarity=0.258  Sum_probs=11.0

Q ss_pred             CCCccCCcccccccccCCc
Q psy9695         103 DKPFRCTICQKAFTTKGNL  121 (159)
Q Consensus       103 ~~~~~C~~C~~~f~~~~~l  121 (159)
                      ..-|.|+.|+..|+...-+
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CCeEECCCCCcEeeHHHHH
Confidence            3446677777666555444


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.69  E-value=0.76  Score=29.41  Aligned_cols=19  Identities=21%  Similarity=0.258  Sum_probs=10.1

Q ss_pred             CCccccccccccccCcccc
Q psy9695          44 DKPFRCTICQKAFTTKGNL   62 (159)
Q Consensus        44 ~~~~~c~~c~~~~~~~~~l   62 (159)
                      ..-|.|+.|+..|+....+
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CCeEECCCCCcEeeHHHHH
Confidence            3446666666555544433


No 87 
>KOG4173|consensus
Probab=84.56  E-value=0.23  Score=32.86  Aligned_cols=76  Identities=22%  Similarity=0.394  Sum_probs=53.2

Q ss_pred             CCccCcc--cccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCC-C--CCcccccccc--hhhch
Q psy9695          76 PKHLCHV--CHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGS-Q--LPKKAQQHIG--AVEGK  148 (159)
Q Consensus        76 ~~~~C~~--C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~-~--~~~~~~~~~C--~~C~~  148 (159)
                      ..+.|+.  |.+.|.+......|-.+-++   -.|.+|.+.|.....|..|+.-.|..- +  ...+.-.|.|  ..|+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            3477876  66778777766666655433   389999999999999999986666420 0  1112367999  67999


Q ss_pred             hhhhcc
Q psy9695         149 SFQAKH  154 (159)
Q Consensus       149 ~f~~~~  154 (159)
                      +|++..
T Consensus       155 KFkT~r  160 (253)
T KOG4173|consen  155 KFKTSR  160 (253)
T ss_pred             hhhhhh
Confidence            998754


No 88 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=84.02  E-value=0.64  Score=23.19  Aligned_cols=8  Identities=25%  Similarity=0.356  Sum_probs=2.8

Q ss_pred             cccchhhc
Q psy9695         140 QHIGAVEG  147 (159)
Q Consensus       140 ~~~C~~C~  147 (159)
                      -|.|++|+
T Consensus        34 ~w~CP~C~   41 (47)
T PF00301_consen   34 DWVCPVCG   41 (47)
T ss_dssp             T-B-TTTS
T ss_pred             CCcCcCCC
Confidence            34455544


No 89 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=83.65  E-value=1.1  Score=22.71  Aligned_cols=11  Identities=18%  Similarity=0.637  Sum_probs=5.3

Q ss_pred             ccCcccccccC
Q psy9695          78 HLCHVCHKNFS   88 (159)
Q Consensus        78 ~~C~~C~~~~~   88 (159)
                      |.|..||..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            44555554443


No 90 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=83.22  E-value=0.51  Score=30.84  Aligned_cols=33  Identities=18%  Similarity=0.272  Sum_probs=19.2

Q ss_pred             CCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhh
Q psy9695         104 KPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQA  152 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~  152 (159)
                      .-|.|+.|+..|+...-+.                ..|.|+.||..+..
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~----------------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME----------------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh----------------cCCcCCCCCCCCee
Confidence            3467777776666554321                24677777765443


No 91 
>PF14353 CpXC:  CpXC protein
Probab=83.11  E-value=2.2  Score=26.17  Aligned_cols=22  Identities=23%  Similarity=0.460  Sum_probs=16.4

Q ss_pred             CCccCCcccccccccCCceeee
Q psy9695         104 KPFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      ..|.|+.||..|.-...+.-|-
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D   58 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHD   58 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEc
Confidence            3478888888888777776666


No 92 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=82.45  E-value=0.66  Score=23.31  Aligned_cols=10  Identities=20%  Similarity=0.607  Sum_probs=6.1

Q ss_pred             ccCccccccc
Q psy9695          78 HLCHVCHKNF   87 (159)
Q Consensus        78 ~~C~~C~~~~   87 (159)
                      |.|..|+..|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5666666555


No 93 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.03  E-value=1.3  Score=28.99  Aligned_cols=31  Identities=23%  Similarity=0.448  Sum_probs=17.1

Q ss_pred             CccccccccccccCccccccccccccccCCCCCccCccccccc
Q psy9695          45 KPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNF   87 (159)
Q Consensus        45 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~   87 (159)
                      .-|.|+.|+..|+....+.            ..|.|+.||..+
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~------------~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME------------YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh------------cCCcCCCCCCCC
Confidence            4466666666665544331            146666666543


No 94 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=80.00  E-value=1.4  Score=22.71  Aligned_cols=13  Identities=23%  Similarity=0.672  Sum_probs=7.8

Q ss_pred             CccCcccccccCC
Q psy9695          77 KHLCHVCHKNFSS   89 (159)
Q Consensus        77 ~~~C~~C~~~~~~   89 (159)
                      .|.|..||..|..
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            3666666666643


No 95 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=79.79  E-value=1  Score=27.75  Aligned_cols=12  Identities=33%  Similarity=1.038  Sum_probs=5.8

Q ss_pred             CccCCccccccc
Q psy9695         105 PFRCTICQKAFT  116 (159)
Q Consensus       105 ~~~C~~C~~~f~  116 (159)
                      .|+|..|++.|.
T Consensus        53 RyrC~~C~~tf~   64 (129)
T COG3677          53 RYKCKSCGSTFT   64 (129)
T ss_pred             ccccCCcCccee
Confidence            345555554444


No 96 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=79.56  E-value=1.1  Score=22.01  Aligned_cols=30  Identities=20%  Similarity=0.442  Sum_probs=17.5

Q ss_pred             ccCcccccccCChHHHHHHHHhhcCCCccccccccccccCc
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTK   59 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~~   59 (159)
                      |.|..||..|...           ...+..|+.||.....+
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~rIlyK   32 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYRILYK   32 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCceEEEE
Confidence            6677777665432           23456777777655433


No 97 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.52  E-value=1.4  Score=27.87  Aligned_cols=12  Identities=33%  Similarity=0.971  Sum_probs=5.7

Q ss_pred             cccccccccccc
Q psy9695          46 PFRCTICQKAFT   57 (159)
Q Consensus        46 ~~~c~~c~~~~~   57 (159)
                      .|.|+.|+..|.
T Consensus        99 ~Y~Cp~C~~~y~  110 (147)
T smart00531       99 YYKCPNCQSKYT  110 (147)
T ss_pred             EEECcCCCCEee
Confidence            344555554444


No 98 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=78.62  E-value=2.1  Score=30.92  Aligned_cols=104  Identities=22%  Similarity=0.401  Sum_probs=53.2

Q ss_pred             ccCcc--cccccCChHHHHHHHHhhcCCCccccccccc---cccCccc------cccccccccccCC-CCCccCcccccc
Q psy9695          19 HLCHV--CHKNFSSSSALQIHMRTHTGDKPFRCTICQK---AFTTKGN------LKLIPNAVFNVAG-MPKHLCHVCHKN   86 (159)
Q Consensus        19 ~~C~~--C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~---~~~~~~~------l~~~~~~~~~~~~-~~~~~C~~C~~~   86 (159)
                      |.|+.  |.........+..|..+.++  .+.|.+|-.   .|.....      |..|...--...| ...-.|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            67764  55555556778888876543  255666532   2322222      2221110000111 112458889988


Q ss_pred             cCChHHHHHHHHHccCCCCccCCccc----ccccccCCceeee
Q psy9695          87 FSSSSALQIHMRTHTGDKPFRCTICQ----KAFTTKGNLKVRE  125 (159)
Q Consensus        87 ~~~~~~l~~H~~~h~~~~~~~C~~C~----~~f~~~~~l~~H~  125 (159)
                      |-....|..|.+.-+ |+=|.|+.-+    .-|....+|..|.
T Consensus       230 FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF  271 (493)
T COG5236         230 FYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHF  271 (493)
T ss_pred             ecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHh
Confidence            888899999988543 2223332211    2344455555555


No 99 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=78.61  E-value=1.6  Score=20.41  Aligned_cols=29  Identities=21%  Similarity=0.249  Sum_probs=16.9

Q ss_pred             cCCcccccccccCCceeeehhhccCCCCCcccccccchhh
Q psy9695         107 RCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVE  146 (159)
Q Consensus       107 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C  146 (159)
                      .|+.|+..    ..+.+|- +...|.      +.|.|..|
T Consensus         7 ~CP~C~s~----~~v~k~G-~~~~G~------qryrC~~C   35 (36)
T PF03811_consen    7 HCPRCQST----EGVKKNG-KSPSGH------QRYRCKDC   35 (36)
T ss_pred             eCCCCCCC----CcceeCC-CCCCCC------EeEecCcC
Confidence            56666632    2255555 444455      77888776


No 100
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=78.29  E-value=0.75  Score=25.23  Aligned_cols=43  Identities=19%  Similarity=0.464  Sum_probs=27.1

Q ss_pred             ccCcccccccCChHHHHHHHHhhcCCCccccc--cccccccCccccc
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCT--ICQKAFTTKGNLK   63 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~--~c~~~~~~~~~l~   63 (159)
                      +.|+.||.......+-..  .....+..+.|.  +||..|....++.
T Consensus         2 m~CP~Cg~~a~irtSr~~--s~~~~~~Y~qC~N~eCg~tF~t~es~s   46 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYI--TDTTKERYHQCQNVNCSATFITYESVQ   46 (72)
T ss_pred             ccCCCCCCccEEEEChhc--ChhhheeeeecCCCCCCCEEEEEEEEE
Confidence            468888876533333221  112445668887  8999998877765


No 101
>KOG2907|consensus
Probab=78.03  E-value=1  Score=26.84  Aligned_cols=14  Identities=7%  Similarity=-0.220  Sum_probs=8.2

Q ss_pred             ccccchhhchhhhh
Q psy9695         139 QQHIGAVEGKSFQA  152 (159)
Q Consensus       139 ~~~~C~~C~~~f~~  152 (159)
                      -.|.|+-|+.+|..
T Consensus       101 VFYTC~kC~~k~~e  114 (116)
T KOG2907|consen  101 VFYTCPKCKYKFTE  114 (116)
T ss_pred             EEEEcCccceeeec
Confidence            35666666666554


No 102
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=77.97  E-value=0.5  Score=27.03  Aligned_cols=10  Identities=30%  Similarity=0.232  Sum_probs=5.7

Q ss_pred             ccchhhchhh
Q psy9695         141 HIGAVEGKSF  150 (159)
Q Consensus       141 ~~C~~C~~~f  150 (159)
                      +.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            5555565554


No 103
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=77.88  E-value=0.95  Score=23.29  Aligned_cols=30  Identities=17%  Similarity=0.450  Sum_probs=15.2

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAF  115 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  115 (159)
                      ++|+.||..+.-...       ..++ ...|+.||..|
T Consensus         3 ~~CP~CG~~iev~~~-------~~Ge-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENP-------ELGE-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCC-------ccCC-EEeCCCCCCEE
Confidence            567777765533221       0122 34677777554


No 104
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=77.61  E-value=1.1  Score=20.04  Aligned_cols=11  Identities=27%  Similarity=1.011  Sum_probs=2.1

Q ss_pred             cCCcccccccc
Q psy9695         107 RCTICQKAFTT  117 (159)
Q Consensus       107 ~C~~C~~~f~~  117 (159)
                      +|+.|+..++.
T Consensus         4 ~Cp~C~se~~y   14 (30)
T PF08274_consen    4 KCPLCGSEYTY   14 (30)
T ss_dssp             --TTT-----E
T ss_pred             CCCCCCCccee
Confidence            35555554444


No 105
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=77.32  E-value=1  Score=18.95  Aligned_cols=8  Identities=50%  Similarity=1.373  Sum_probs=3.8

Q ss_pred             CccCCccc
Q psy9695         105 PFRCTICQ  112 (159)
Q Consensus       105 ~~~C~~C~  112 (159)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            34455444


No 106
>KOG4124|consensus
Probab=77.32  E-value=2.6  Score=30.47  Aligned_cols=54  Identities=20%  Similarity=0.447  Sum_probs=41.4

Q ss_pred             CCCccCCc--ccccccccCCceeeehhhccCC-----C-------CCcccccccchhhchhhhhcccc
Q psy9695         103 DKPFRCTI--CQKAFTTKGNLKVREIEINIGS-----Q-------LPKKAQQHIGAVEGKSFQAKHKT  156 (159)
Q Consensus       103 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~-----~-------~~~~~~~~~C~~C~~~f~~~~~l  156 (159)
                      +++|+|++  |.+.+.....|..|.+..|...     +       .-...++|.|++|.++++...+|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l  414 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGL  414 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCC
Confidence            47899965  9999999999998886666531     1       11445899999999999877665


No 107
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=76.44  E-value=0.6  Score=23.48  Aligned_cols=21  Identities=43%  Similarity=0.744  Sum_probs=11.9

Q ss_pred             ccCcccccccCCh-----HHHHHHHH
Q psy9695          78 HLCHVCHKNFSSS-----SALQIHMR   98 (159)
Q Consensus        78 ~~C~~C~~~~~~~-----~~l~~H~~   98 (159)
                      -.|..|++.+...     +.|..|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666655332     46666665


No 108
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=76.24  E-value=0.34  Score=23.62  Aligned_cols=22  Identities=32%  Similarity=0.551  Sum_probs=10.7

Q ss_pred             CCccCcccccccCC----hHHHHHHH
Q psy9695          76 PKHLCHVCHKNFSS----SSALQIHM   97 (159)
Q Consensus        76 ~~~~C~~C~~~~~~----~~~l~~H~   97 (159)
                      ....|..|++.+..    .+.|..|.
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            34566666665533    35566665


No 109
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=75.49  E-value=0.9  Score=35.89  Aligned_cols=81  Identities=21%  Similarity=0.436  Sum_probs=48.2

Q ss_pred             ccCcccccccCChHHHHHHHHhhcCCCccccccccccccCccccccccccccccCCCCC-ccCcccccccCChHHHHHHH
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPK-HLCHVCHKNFSSSSALQIHM   97 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~-~~C~~C~~~~~~~~~l~~H~   97 (159)
                      =.|+.|-+-+.+..+-.-+      -+-..|..||..|+-...+.-    -+..+.... -.|+.|.+.|..+.+-+   
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~------YPF~~CT~CGPRfTIi~alPY----DR~nTsM~~F~lC~~C~~EY~dP~nRR---  168 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYL------YPFINCTNCGPRFTIIEALPY----DRENTSMADFPLCPFCDKEYKDPLNRR---  168 (750)
T ss_pred             hhhHHHHHHhcCCCCccee------ccccccCCCCcceeeeccCCC----CcccCccccCcCCHHHHHHhcCccccc---
Confidence            3566666554444431111      112568889999987776642    222333333 35999999888776533   


Q ss_pred             HHccCCCCccCCcccccc
Q psy9695          98 RTHTGDKPFRCTICQKAF  115 (159)
Q Consensus        98 ~~h~~~~~~~C~~C~~~f  115 (159)
                       -|.  .|-.|+.||-..
T Consensus       169 -fHA--Qp~aCp~CGP~~  183 (750)
T COG0068         169 -FHA--QPIACPKCGPHL  183 (750)
T ss_pred             -ccc--ccccCcccCCCe
Confidence             342  367899999644


No 110
>PHA02998 RNA polymerase subunit; Provisional
Probab=73.08  E-value=1.2  Score=28.83  Aligned_cols=40  Identities=20%  Similarity=0.179  Sum_probs=22.8

Q ss_pred             ccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhh
Q psy9695         106 FRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQA  152 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~  152 (159)
                      -.|+.|+..=.....++..- ...+.-      ..|.|..||..|..
T Consensus       144 v~CPkCg~~~A~f~qlQTRS-ADEPmT------~FYkC~~CG~~wkp  183 (195)
T PHA02998        144 TPCPNCKSKNTTPMMIQTRA-ADEPPL------VRHACRDCKKHFKP  183 (195)
T ss_pred             CCCCCCCCCceEEEEEeecc-CCCCce------EEEEcCCCCCccCC
Confidence            47888885533333333222 222222      67889889887754


No 111
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=72.66  E-value=1.1  Score=22.48  Aligned_cols=14  Identities=21%  Similarity=0.510  Sum_probs=7.7

Q ss_pred             CccCcccccccCCh
Q psy9695          77 KHLCHVCHKNFSSS   90 (159)
Q Consensus        77 ~~~C~~C~~~~~~~   90 (159)
                      .+.|..||..|...
T Consensus         4 ~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    4 TLTCKDCGAEFVFT   17 (49)
T ss_pred             eEEcccCCCeEEEe
Confidence            45666666655433


No 112
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=72.65  E-value=2.7  Score=25.75  Aligned_cols=11  Identities=9%  Similarity=0.163  Sum_probs=5.7

Q ss_pred             CccCccccccc
Q psy9695          77 KHLCHVCHKNF   87 (159)
Q Consensus        77 ~~~C~~C~~~~   87 (159)
                      |..|+.||..|
T Consensus        26 p~vcP~cg~~~   36 (129)
T TIGR02300        26 PAVSPYTGEQF   36 (129)
T ss_pred             CccCCCcCCcc
Confidence            44555555544


No 113
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=72.55  E-value=1.2  Score=27.70  Aligned_cols=13  Identities=23%  Similarity=0.506  Sum_probs=9.0

Q ss_pred             CccCcccccccCC
Q psy9695          77 KHLCHVCHKNFSS   89 (159)
Q Consensus        77 ~~~C~~C~~~~~~   89 (159)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            4778888876644


No 114
>KOG2785|consensus
Probab=72.54  E-value=2.5  Score=30.86  Aligned_cols=52  Identities=21%  Similarity=0.363  Sum_probs=42.6

Q ss_pred             CccCcccccccCChHHHHHHHHHccCC-----------------------CCccCCccc---ccccccCCceeeehhh
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGD-----------------------KPFRCTICQ---KAFTTKGNLKVREIEI  128 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~~  128 (159)
                      |-.|..|+..+.+...-..|+..+++-                       ..+.|-+|+   +.|.+....++||..+
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            477999999999998888999987752                       346899999   8888888889999444


No 115
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=72.22  E-value=0.92  Score=21.18  Aligned_cols=8  Identities=25%  Similarity=0.671  Sum_probs=3.8

Q ss_pred             cCCccccc
Q psy9695         107 RCTICQKA  114 (159)
Q Consensus       107 ~C~~C~~~  114 (159)
                      .|+.||..
T Consensus        23 ~Cd~cg~~   30 (36)
T PF05191_consen   23 VCDNCGGE   30 (36)
T ss_dssp             BCTTTTEB
T ss_pred             ccCCCCCe
Confidence            45555543


No 116
>KOG3214|consensus
Probab=71.96  E-value=2.3  Score=24.73  Aligned_cols=13  Identities=23%  Similarity=0.240  Sum_probs=7.3

Q ss_pred             cccchhhchhhhh
Q psy9695         140 QHIGAVEGKSFQA  152 (159)
Q Consensus       140 ~~~C~~C~~~f~~  152 (159)
                      ..-|.+|+.+|++
T Consensus        47 ~~sC~iC~esFqt   59 (109)
T KOG3214|consen   47 KASCRICEESFQT   59 (109)
T ss_pred             eeeeeehhhhhcc
Confidence            3456666666653


No 117
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=71.90  E-value=1.2  Score=25.06  Aligned_cols=13  Identities=38%  Similarity=0.322  Sum_probs=5.7

Q ss_pred             cccchhhchhhhh
Q psy9695         140 QHIGAVEGKSFQA  152 (159)
Q Consensus       140 ~~~C~~C~~~f~~  152 (159)
                      ...|..|+..|..
T Consensus        46 ~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   46 ILSCRVCGESFQT   58 (81)
T ss_dssp             EEEESSS--EEEE
T ss_pred             EEEecCCCCeEEE
Confidence            4555555555543


No 118
>KOG2785|consensus
Probab=71.73  E-value=3.1  Score=30.45  Aligned_cols=82  Identities=18%  Similarity=0.304  Sum_probs=43.8

Q ss_pred             CcccCcccccccCChHHHHHHHHh--hc----CCCccccccccccccCccccccccccccccCCCCCccCcccccccCCh
Q psy9695          17 PKHLCHVCHKNFSSSSALQIHMRT--HT----GDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSS   90 (159)
Q Consensus        17 ~~~~C~~C~~~f~~~~~~~~h~~~--~~----~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~   90 (159)
                      ..|+|..|...|.+......|..+  |.    +...-.-++.-..|...-.............+..++.|..|.+.|.++
T Consensus         2 t~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~   81 (390)
T KOG2785|consen    2 TGFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASP   81 (390)
T ss_pred             CcceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccCh
Confidence            358999999999999988888764  32    000011111111222211111000011123345567788888888777


Q ss_pred             HHHHHHHH
Q psy9695          91 SALQIHMR   98 (159)
Q Consensus        91 ~~l~~H~~   98 (159)
                      .....|..
T Consensus        82 ~a~~~hl~   89 (390)
T KOG2785|consen   82 KAHENHLK   89 (390)
T ss_pred             hhHHHHHH
Confidence            66666655


No 119
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=71.37  E-value=4.8  Score=27.96  Aligned_cols=28  Identities=18%  Similarity=0.356  Sum_probs=22.6

Q ss_pred             CCCCccCCcccccccccCCceeeehhhcc
Q psy9695         102 GDKPFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       102 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      ..+++.||.||.....-.+|..-. ++|.
T Consensus       206 k~k~~PCPKCg~et~eTkdLSmSt-R~hk  233 (314)
T PF06524_consen  206 KGKPIPCPKCGYETQETKDLSMST-RSHK  233 (314)
T ss_pred             cCCCCCCCCCCCcccccccceeee-ecch
Confidence            357899999999888888888777 6665


No 120
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=71.36  E-value=1.1  Score=19.67  Aligned_cols=19  Identities=32%  Similarity=0.669  Sum_probs=11.2

Q ss_pred             ccCCcccccccccCCceeee
Q psy9695         106 FRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~  125 (159)
                      |.|..|++.| .......|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            4677888888 445555555


No 121
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=71.24  E-value=1.9  Score=18.47  Aligned_cols=9  Identities=33%  Similarity=0.789  Sum_probs=5.2

Q ss_pred             cCCcccccc
Q psy9695         107 RCTICQKAF  115 (159)
Q Consensus       107 ~C~~C~~~f  115 (159)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            455666555


No 122
>PF12907 zf-met2:  Zinc-binding
Probab=71.19  E-value=0.58  Score=22.43  Aligned_cols=26  Identities=23%  Similarity=0.442  Sum_probs=12.1

Q ss_pred             ccCCccccccccc---CCceeeehhhccC
Q psy9695         106 FRCTICQKAFTTK---GNLKVREIEINIG  131 (159)
Q Consensus       106 ~~C~~C~~~f~~~---~~l~~H~~~~h~~  131 (159)
                      +.|.+|..+|..-   ..|..|....|.+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            3455555444433   2355555444443


No 123
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=70.74  E-value=1.3  Score=27.97  Aligned_cols=18  Identities=11%  Similarity=-0.106  Sum_probs=13.6

Q ss_pred             ccccchhhchhhhhcccc
Q psy9695         139 QQHIGAVEGKSFQAKHKT  156 (159)
Q Consensus       139 ~~~~C~~C~~~f~~~~~l  156 (159)
                      ..+.|+.||+.|..-++.
T Consensus       123 ~f~~C~~C~kiyW~GsH~  140 (147)
T PF01927_consen  123 EFWRCPGCGKIYWEGSHW  140 (147)
T ss_pred             eEEECCCCCCEecccccH
Confidence            578888888888766554


No 124
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=69.68  E-value=3.1  Score=23.62  Aligned_cols=31  Identities=16%  Similarity=0.489  Sum_probs=18.4

Q ss_pred             CccccccccccccCccccccccccccccCCCCCccCcccccccC
Q psy9695          45 KPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFS   88 (159)
Q Consensus        45 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~   88 (159)
                      ..+.|+.|++.-.-.             .+...|.|..|+..|.
T Consensus        34 ~~~~Cp~C~~~~VkR-------------~a~GIW~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRTTVKR-------------IATGIWKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCcceee-------------eccCeEEcCCCCCeec
Confidence            457888887552111             1223478888887664


No 125
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=69.04  E-value=1.6  Score=20.12  Aligned_cols=9  Identities=11%  Similarity=0.239  Sum_probs=4.2

Q ss_pred             ccccchhhc
Q psy9695         139 QQHIGAVEG  147 (159)
Q Consensus       139 ~~~~C~~C~  147 (159)
                      ..+.|+.||
T Consensus        21 ~R~vC~~Cg   29 (34)
T PF14803_consen   21 ERLVCPACG   29 (34)
T ss_dssp             -EEEETTTT
T ss_pred             cceECCCCC
Confidence            445555554


No 126
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=67.60  E-value=0.73  Score=31.04  Aligned_cols=27  Identities=19%  Similarity=0.442  Sum_probs=16.9

Q ss_pred             CCccCCcccccccccCCceeeehhhcc
Q psy9695         104 KPFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      ..|.|+.|+|.|.-..-.++|+...|.
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCH
Confidence            347777777777777777777755554


No 127
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=67.27  E-value=3.3  Score=19.06  Aligned_cols=16  Identities=31%  Similarity=0.621  Sum_probs=7.4

Q ss_pred             cCCcccccccccCCce
Q psy9695         107 RCTICQKAFTTKGNLK  122 (159)
Q Consensus       107 ~C~~C~~~f~~~~~l~  122 (159)
                      .|..|++.|..+..+.
T Consensus         5 ~C~eC~~~f~dSyL~~   20 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLN   20 (34)
T ss_dssp             E-TTT--EES-SSCCC
T ss_pred             hHhHhCCHHHHHHHHH
Confidence            5777777776655443


No 128
>KOG4602|consensus
Probab=67.26  E-value=1.9  Score=29.70  Aligned_cols=43  Identities=14%  Similarity=0.223  Sum_probs=18.3

Q ss_pred             cCCcccccccccCCceeeehhhccCCCCCcccccccchhhchh
Q psy9695         107 RCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKS  149 (159)
Q Consensus       107 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~  149 (159)
                      .|..|.-.-.....+..|..+...|.++=..-+.|.|++||-+
T Consensus       235 ~CvFC~nN~E~~A~y~tH~lkd~dgRVLCPkLR~YVCPiCGAT  277 (318)
T KOG4602|consen  235 CCVFCFNNAEEFARYHTHPLKDKDGRVLCPKLRSYVCPICGAT  277 (318)
T ss_pred             eEEeecCCCchhhheecccccCCCCcEechhHhhhcCcccccc
Confidence            4444443333333344444333333333333345555555543


No 129
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=66.71  E-value=1.4  Score=21.34  Aligned_cols=13  Identities=8%  Similarity=0.159  Sum_probs=7.6

Q ss_pred             ccccchhhchhhh
Q psy9695         139 QQHIGAVEGKSFQ  151 (159)
Q Consensus       139 ~~~~C~~C~~~f~  151 (159)
                      .-+.|+.||..+-
T Consensus        31 p~~~C~~CGE~~~   43 (46)
T TIGR03831        31 PALVCPQCGEEYL   43 (46)
T ss_pred             CccccccCCCEee
Confidence            3456666666554


No 130
>KOG2593|consensus
Probab=66.54  E-value=3.8  Score=30.54  Aligned_cols=17  Identities=35%  Similarity=0.729  Sum_probs=8.5

Q ss_pred             ccccccccccccCcccc
Q psy9695          46 PFRCTICQKAFTTKGNL   62 (159)
Q Consensus        46 ~~~c~~c~~~~~~~~~l   62 (159)
                      .|.|+.|.++|.....+
T Consensus       128 ~Y~Cp~C~kkyt~Lea~  144 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEAL  144 (436)
T ss_pred             cccCCccccchhhhHHH
Confidence            35555555555444433


No 131
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=66.51  E-value=1.8  Score=30.94  Aligned_cols=37  Identities=24%  Similarity=0.635  Sum_probs=17.0

Q ss_pred             CcccCcccccccCChHHHHHHHHhhcCCCccccccccccc
Q psy9695          17 PKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAF   56 (159)
Q Consensus        17 ~~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~   56 (159)
                      ....|+.||..- ..+.+  +.....|.+...|..|+..+
T Consensus       186 ~~~~CPvCGs~P-~~s~v--~~~~~~G~RyL~CslC~teW  222 (309)
T PRK03564        186 QRQFCPVCGSMP-VSSVV--QIGTTQGLRYLHCNLCESEW  222 (309)
T ss_pred             CCCCCCCCCCcc-hhhee--eccCCCCceEEEcCCCCCcc
Confidence            345677777532 11111  11122344556666666554


No 132
>KOG2186|consensus
Probab=65.91  E-value=3.6  Score=28.40  Aligned_cols=39  Identities=26%  Similarity=0.565  Sum_probs=27.3

Q ss_pred             cccCcccccccCChHHHHHHHHhhcCCCccccccccccccC
Q psy9695          18 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTT   58 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~   58 (159)
                      -|.|+.||....... +..|+..-++ ..|.|-.|+..|..
T Consensus         3 ~FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~   41 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER   41 (276)
T ss_pred             EEehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc
Confidence            377888888765544 4557766555 67888888888866


No 133
>PRK05978 hypothetical protein; Provisional
Probab=65.87  E-value=2.8  Score=26.51  Aligned_cols=12  Identities=33%  Similarity=0.919  Sum_probs=7.5

Q ss_pred             cCCccccccccc
Q psy9695         107 RCTICQKAFTTK  118 (159)
Q Consensus       107 ~C~~C~~~f~~~  118 (159)
                      .|+.||..|...
T Consensus        54 ~C~~CG~~~~~~   65 (148)
T PRK05978         54 HCAACGEDFTHH   65 (148)
T ss_pred             CccccCCccccC
Confidence            677777666543


No 134
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=65.29  E-value=3.5  Score=25.46  Aligned_cols=20  Identities=25%  Similarity=0.591  Sum_probs=11.8

Q ss_pred             CCCccccccccccccCcccc
Q psy9695          43 GDKPFRCTICQKAFTTKGNL   62 (159)
Q Consensus        43 ~~~~~~c~~c~~~~~~~~~l   62 (159)
                      +.+.|.|++|...+....-|
T Consensus        77 d~~lYeCnIC~etS~ee~FL   96 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERFL   96 (140)
T ss_pred             CCCceeccCcccccchhhcC
Confidence            44567777777666554433


No 135
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=65.10  E-value=2.2  Score=19.96  Aligned_cols=12  Identities=8%  Similarity=-0.166  Sum_probs=6.9

Q ss_pred             cccccchhhchh
Q psy9695         138 AQQHIGAVEGKS  149 (159)
Q Consensus       138 ~~~~~C~~C~~~  149 (159)
                      .+.|+|.+||--
T Consensus         4 ~~~YkC~~CGni   15 (36)
T PF06397_consen    4 GEFYKCEHCGNI   15 (36)
T ss_dssp             TEEEE-TTT--E
T ss_pred             ccEEEccCCCCE
Confidence            378999999853


No 136
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=65.09  E-value=12  Score=26.76  Aligned_cols=25  Identities=28%  Similarity=0.600  Sum_probs=14.3

Q ss_pred             CCccCcccccccCChHHHHHHHHHc
Q psy9695          76 PKHLCHVCHKNFSSSSALQIHMRTH  100 (159)
Q Consensus        76 ~~~~C~~C~~~~~~~~~l~~H~~~h  100 (159)
                      ..|.|+.|...|-..-....|...|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            3466666666665555555555544


No 137
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=65.04  E-value=2.8  Score=18.98  Aligned_cols=9  Identities=44%  Similarity=1.232  Sum_probs=3.8

Q ss_pred             ccccccccc
Q psy9695          46 PFRCTICQK   54 (159)
Q Consensus        46 ~~~c~~c~~   54 (159)
                      +..|+.||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            344555543


No 138
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=64.81  E-value=13  Score=18.21  Aligned_cols=22  Identities=27%  Similarity=0.375  Sum_probs=18.1

Q ss_pred             ccCcccccccCChHHHHHHHHh
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRT   40 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~   40 (159)
                      |+|.+|..+...++.|-+|+..
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            8888998888888888888753


No 139
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=64.54  E-value=5  Score=19.38  Aligned_cols=42  Identities=17%  Similarity=0.196  Sum_probs=19.5

Q ss_pred             CCcccccccccCCcee-eehhhccCCCCCcccccccchhhchh
Q psy9695         108 CTICQKAFTTKGNLKV-REIEINIGSQLPKKAQQHIGAVEGKS  149 (159)
Q Consensus       108 C~~C~~~f~~~~~l~~-H~~~~h~~~~~~~~~~~~~C~~C~~~  149 (159)
                      |.+|++.|.....+.. |......+.....+.....|+.|...
T Consensus         1 C~~C~~~~~~~~~~~v~Hi~~~~~gg~~~~~Nl~~lC~~Ch~~   43 (47)
T PF01844_consen    1 CQYCGKPGSDNESLHVHHIIPRSKGGKNDLENLILLCPSCHRK   43 (47)
T ss_dssp             -TTT--B--GG-GEEEEESS-TTTT---STTTEEEEEHHHHHH
T ss_pred             CCCCCCcCccCcceEeECcCchhcCCCCCHHHHHHHhHHHHHH
Confidence            7788888877644443 44333334545566677778777654


No 140
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=64.37  E-value=6.9  Score=23.21  Aligned_cols=26  Identities=19%  Similarity=0.259  Sum_probs=21.9

Q ss_pred             CcccC----cccccccCChHHHHHHHHhhc
Q psy9695          17 PKHLC----HVCHKNFSSSSALQIHMRTHT   42 (159)
Q Consensus        17 ~~~~C----~~C~~~f~~~~~~~~h~~~~~   42 (159)
                      ..|.|    ..|+....+...+.+|...++
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            34899    999999999999999987654


No 141
>PRK04023 DNA polymerase II large subunit; Validated
Probab=63.97  E-value=7.5  Score=32.45  Aligned_cols=9  Identities=22%  Similarity=0.682  Sum_probs=4.5

Q ss_pred             ccCCccccc
Q psy9695         106 FRCTICQKA  114 (159)
Q Consensus       106 ~~C~~C~~~  114 (159)
                      |.|+.||..
T Consensus       664 y~CPKCG~E  672 (1121)
T PRK04023        664 DECEKCGRE  672 (1121)
T ss_pred             CcCCCCCCC
Confidence            445555543


No 142
>KOG2482|consensus
Probab=63.76  E-value=2.2  Score=30.73  Aligned_cols=55  Identities=24%  Similarity=0.422  Sum_probs=39.1

Q ss_pred             ccCccccccc-CChHHHHHHHHHccC-C---------------------CCccCCcccccccccCCceeeehhhccCC
Q psy9695          78 HLCHVCHKNF-SSSSALQIHMRTHTG-D---------------------KPFRCTICQKAFTTKGNLKVREIEINIGS  132 (159)
Q Consensus        78 ~~C~~C~~~~-~~~~~l~~H~~~h~~-~---------------------~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  132 (159)
                      -.|..|...+ ...+.+..|...-++ .                     ..++|-+|.+.|..+..|..||.+..+..
T Consensus       145 lqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrr  222 (423)
T KOG2482|consen  145 LQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRR  222 (423)
T ss_pred             eEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCcc
Confidence            5688887654 456777777664221 1                     23689999999999999999995555543


No 143
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=63.28  E-value=2.1  Score=20.49  Aligned_cols=11  Identities=9%  Similarity=0.205  Sum_probs=6.9

Q ss_pred             cccchhhchhh
Q psy9695         140 QHIGAVEGKSF  150 (159)
Q Consensus       140 ~~~C~~C~~~f  150 (159)
                      +-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45666666655


No 144
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=61.99  E-value=3.2  Score=19.78  Aligned_cols=9  Identities=33%  Similarity=1.036  Sum_probs=3.9

Q ss_pred             CCccCCccc
Q psy9695         104 KPFRCTICQ  112 (159)
Q Consensus       104 ~~~~C~~C~  112 (159)
                      +.|.|+.|+
T Consensus        23 ~~w~C~~C~   31 (40)
T PF04810_consen   23 KTWICNFCG   31 (40)
T ss_dssp             TEEEETTT-
T ss_pred             CEEECcCCC
Confidence            345555554


No 145
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=61.59  E-value=1.4  Score=22.41  Aligned_cols=22  Identities=23%  Similarity=0.665  Sum_probs=10.3

Q ss_pred             CCccCCcccccccccCCceeee
Q psy9695         104 KPFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      ..|+|+.|+..|--.-++-.|.
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE   41 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHE   41 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTT
T ss_pred             CeEECCCCCCccccCcChhhhc
Confidence            3466666666666666555555


No 146
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=61.08  E-value=8.6  Score=16.36  Aligned_cols=19  Identities=21%  Similarity=0.663  Sum_probs=11.9

Q ss_pred             cCcccccccCChHHHHHHHH
Q psy9695          20 LCHVCHKNFSSSSALQIHMR   39 (159)
Q Consensus        20 ~C~~C~~~f~~~~~~~~h~~   39 (159)
                      .||.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            588888877 4455555543


No 147
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=60.99  E-value=1.4  Score=20.46  Aligned_cols=8  Identities=38%  Similarity=0.845  Sum_probs=3.0

Q ss_pred             cCCccccc
Q psy9695         107 RCTICQKA  114 (159)
Q Consensus       107 ~C~~C~~~  114 (159)
                      .|..||-.
T Consensus        23 sC~~CGPr   30 (35)
T PF07503_consen   23 SCTNCGPR   30 (35)
T ss_dssp             -BTTCC-S
T ss_pred             cCCCCCCC
Confidence            45555543


No 148
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=60.66  E-value=2.5  Score=25.42  Aligned_cols=12  Identities=8%  Similarity=-0.105  Sum_probs=6.2

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      ..|+|..||..|
T Consensus        99 ~Fy~C~~Cg~~w  110 (113)
T COG1594          99 RFYKCTRCGYRW  110 (113)
T ss_pred             EEEEecccCCEe
Confidence            445555555444


No 149
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.39  E-value=1.2  Score=22.05  Aligned_cols=14  Identities=29%  Similarity=0.356  Sum_probs=8.4

Q ss_pred             cchhhchhhhhccc
Q psy9695         142 IGAVEGKSFQAKHK  155 (159)
Q Consensus       142 ~C~~C~~~f~~~~~  155 (159)
                      .|++|++.|..+-+
T Consensus        14 ICpvCqRPFsWRkK   27 (54)
T COG4338          14 ICPVCQRPFSWRKK   27 (54)
T ss_pred             hhhhhcCchHHHHH
Confidence            56666666665443


No 150
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=59.11  E-value=2.7  Score=26.67  Aligned_cols=7  Identities=29%  Similarity=0.937  Sum_probs=1.4

Q ss_pred             ccCCccc
Q psy9695         106 FRCTICQ  112 (159)
Q Consensus       106 ~~C~~C~  112 (159)
                      .+|-.||
T Consensus        61 leCy~Cg   67 (152)
T PF09416_consen   61 LECYNCG   67 (152)
T ss_dssp             ---TTT-
T ss_pred             EEEEecC
Confidence            3444444


No 151
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=58.80  E-value=5.4  Score=27.82  Aligned_cols=50  Identities=22%  Similarity=0.351  Sum_probs=26.0

Q ss_pred             CCCccCCcccccccccCCceeeehhhccCCCCCcc----c-ccccchhhchhhhhccc
Q psy9695         103 DKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKK----A-QQHIGAVEGKSFQAKHK  155 (159)
Q Consensus       103 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~----~-~~~~C~~C~~~f~~~~~  155 (159)
                      +.+|.||+.++.|.....+..-.   -+|.++++.    . ..-.|++|+..|...+-
T Consensus       111 ~~~~~CPvt~~~~~~~~~fv~l~---~cG~V~s~~alke~k~~~~Cp~c~~~f~~~Di  165 (260)
T PF04641_consen  111 EGRFICPVTGKEFNGKHKFVYLR---PCGCVFSEKALKELKKSKKCPVCGKPFTEEDI  165 (260)
T ss_pred             CceeECCCCCcccCCceeEEEEc---CCCCEeeHHHHHhhcccccccccCCccccCCE
Confidence            44577777777665444443222   222222210    0 13458888888886554


No 152
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=57.42  E-value=2.8  Score=24.63  Aligned_cols=40  Identities=13%  Similarity=0.080  Sum_probs=21.7

Q ss_pred             ccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhh
Q psy9695         106 FRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQA  152 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~  152 (159)
                      ..|+.||..-.....++... .....-      ..|.|..|+..+..
T Consensus        63 ~~Cp~Cg~~~a~f~~~Q~Rs-adE~~T------~fy~C~~C~~~w~~  102 (104)
T TIGR01384        63 VECPKCGHKEAYYWLLQTRR-ADEPET------RFYKCTKCGYVWRE  102 (104)
T ss_pred             CCCCCCCCCeeEEEEeccCC-CCCCcE------EEEEeCCCCCeeEe
Confidence            57888885544333333111 111222      67888888876543


No 153
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=57.34  E-value=1.7  Score=21.82  Aligned_cols=11  Identities=9%  Similarity=-0.100  Sum_probs=5.2

Q ss_pred             cccchhhchhh
Q psy9695         140 QHIGAVEGKSF  150 (159)
Q Consensus       140 ~~~C~~C~~~f  150 (159)
                      .|.|+.|..+|
T Consensus         7 ry~CDLCn~~~   17 (57)
T PF14445_consen    7 RYSCDLCNSSH   17 (57)
T ss_pred             hHhHHhhcccC
Confidence            34455554444


No 154
>KOG2593|consensus
Probab=56.96  E-value=7.5  Score=29.06  Aligned_cols=19  Identities=32%  Similarity=0.672  Sum_probs=11.7

Q ss_pred             CCccCCcccccccccCCce
Q psy9695         104 KPFRCTICQKAFTTKGNLK  122 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~  122 (159)
                      ..|.|+.|.+.|+...-++
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             ccccCCccccchhhhHHHH
Confidence            4577777777766554443


No 155
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=56.89  E-value=5.2  Score=18.98  Aligned_cols=14  Identities=29%  Similarity=0.807  Sum_probs=10.9

Q ss_pred             CccCCccccccccc
Q psy9695         105 PFRCTICQKAFTTK  118 (159)
Q Consensus       105 ~~~C~~C~~~f~~~  118 (159)
                      |+.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78888888888644


No 156
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=56.14  E-value=6.9  Score=20.93  Aligned_cols=10  Identities=30%  Similarity=0.700  Sum_probs=4.7

Q ss_pred             CccCCccccc
Q psy9695         105 PFRCTICQKA  114 (159)
Q Consensus       105 ~~~C~~C~~~  114 (159)
                      .|.|+.||..
T Consensus        46 ~~~C~~Cg~~   55 (69)
T PF07282_consen   46 VFTCPNCGFE   55 (69)
T ss_pred             eEEcCCCCCE
Confidence            3455555543


No 157
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=55.86  E-value=2.1  Score=22.12  Aligned_cols=13  Identities=8%  Similarity=0.148  Sum_probs=3.9

Q ss_pred             ccccchhhchhhh
Q psy9695         139 QQHIGAVEGKSFQ  151 (159)
Q Consensus       139 ~~~~C~~C~~~f~  151 (159)
                      +.|.|++||.+=.
T Consensus        32 r~y~Cp~CgAtGd   44 (55)
T PF05741_consen   32 RKYVCPICGATGD   44 (55)
T ss_dssp             GG---TTT---GG
T ss_pred             hcCcCCCCcCcCc
Confidence            5566666665433


No 158
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=55.53  E-value=6.4  Score=23.01  Aligned_cols=18  Identities=39%  Similarity=0.813  Sum_probs=13.7

Q ss_pred             HccCCCCccCCcccccccc
Q psy9695          99 THTGDKPFRCTICQKAFTT  117 (159)
Q Consensus        99 ~h~~~~~~~C~~C~~~f~~  117 (159)
                      .+.+ ++++|+.||..|.-
T Consensus        74 l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          74 LEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EeCC-CceeCCCCCcEEEE
Confidence            3444 79999999988864


No 159
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=55.25  E-value=10  Score=19.58  Aligned_cols=11  Identities=18%  Similarity=0.313  Sum_probs=6.8

Q ss_pred             CccCccccccc
Q psy9695          77 KHLCHVCHKNF   87 (159)
Q Consensus        77 ~~~C~~C~~~~   87 (159)
                      .|.|+.||-.+
T Consensus        14 ~~~Cp~cGipt   24 (55)
T PF13824_consen   14 NFECPDCGIPT   24 (55)
T ss_pred             CCcCCCCCCcC
Confidence            46677776543


No 160
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=55.07  E-value=5.2  Score=18.81  Aligned_cols=14  Identities=7%  Similarity=-0.123  Sum_probs=9.7

Q ss_pred             ccccchhhchhhhh
Q psy9695         139 QQHIGAVEGKSFQA  152 (159)
Q Consensus       139 ~~~~C~~C~~~f~~  152 (159)
                      ..|-|+.|...|..
T Consensus        22 y~fCC~tC~~~fk~   35 (37)
T PF08394_consen   22 YYFCCPTCLSQFKK   35 (37)
T ss_pred             EEEECHHHHHHHHh
Confidence            55666888777764


No 161
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=55.01  E-value=16  Score=17.51  Aligned_cols=24  Identities=25%  Similarity=0.517  Sum_probs=16.4

Q ss_pred             ccCcccccccC--ChHHHHHHHHHcc
Q psy9695          78 HLCHVCHKNFS--SSSALQIHMRTHT  101 (159)
Q Consensus        78 ~~C~~C~~~~~--~~~~l~~H~~~h~  101 (159)
                      ..|+.||..|.  .+..-..|.+-|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            58999998764  3456666766553


No 162
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=53.46  E-value=11  Score=30.52  Aligned_cols=8  Identities=38%  Similarity=1.007  Sum_probs=4.0

Q ss_pred             CccCCccc
Q psy9695         105 PFRCTICQ  112 (159)
Q Consensus       105 ~~~C~~C~  112 (159)
                      |..|+.||
T Consensus       475 p~~Cp~Cg  482 (730)
T COG1198         475 PQSCPECG  482 (730)
T ss_pred             CCCCCCCC
Confidence            44555555


No 163
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=53.31  E-value=8.5  Score=22.13  Aligned_cols=31  Identities=19%  Similarity=0.516  Sum_probs=18.3

Q ss_pred             CccccccccccccCccccccccccccccCCCCCccCcccccccC
Q psy9695          45 KPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFS   88 (159)
Q Consensus        45 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~   88 (159)
                      ..|.|+.|+..-.-.             .+...|.|..|++.|.
T Consensus        35 a~y~CpfCgk~~vkR-------------~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHAVKR-------------QAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCceee-------------eeeEEEEcCCCCCEEe
Confidence            468888887433111             1123588888887653


No 164
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=53.13  E-value=9.8  Score=23.64  Aligned_cols=26  Identities=42%  Similarity=0.820  Sum_probs=16.2

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCC
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKP  105 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~  105 (159)
                      ...|.+||+.|..   |..|.+.|+|-.|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eeEEccCCcccch---HHHHHHHccCCCH
Confidence            4789999999866   5889999976543


No 165
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=53.12  E-value=6.6  Score=23.62  Aligned_cols=24  Identities=17%  Similarity=0.494  Sum_probs=13.8

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQK  113 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  113 (159)
                      ..|..|+..|....            ..+.||.||.
T Consensus        71 ~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecCC------------cCccCcCCCC
Confidence            66777776553321            2345777773


No 166
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=53.04  E-value=9.1  Score=21.96  Aligned_cols=14  Identities=36%  Similarity=0.861  Sum_probs=10.5

Q ss_pred             CccccccccccccC
Q psy9695          45 KPFRCTICQKAFTT   58 (159)
Q Consensus        45 ~~~~c~~c~~~~~~   58 (159)
                      .|..|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            46788888887765


No 167
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=52.88  E-value=5.9  Score=23.88  Aligned_cols=26  Identities=23%  Similarity=0.617  Sum_probs=16.2

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCccccc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKA  114 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  114 (159)
                      ...|..|+..|.....            .+.||.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------LYRCPKCHGI   95 (115)
T ss_pred             EEEcccCCCEEecCCc------------CccCcCCcCC
Confidence            3678888866644311            3678888844


No 168
>KOG1280|consensus
Probab=52.65  E-value=6.1  Score=28.62  Aligned_cols=26  Identities=15%  Similarity=0.272  Sum_probs=14.7

Q ss_pred             CccCCcccccccccCCceeeehhhcc
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      .|.|++|++.-.....|..|....|.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCc
Confidence            56666666655555555556544443


No 169
>KOG3408|consensus
Probab=52.64  E-value=9  Score=23.30  Aligned_cols=26  Identities=31%  Similarity=0.632  Sum_probs=22.3

Q ss_pred             CCCCccCcccccccCChHHHHHHHHH
Q psy9695          74 GMPKHLCHVCHKNFSSSSALQIHMRT   99 (159)
Q Consensus        74 ~~~~~~C~~C~~~~~~~~~l~~H~~~   99 (159)
                      |...|-|..|.+-|.....|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44458999999999999999999874


No 170
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=52.58  E-value=5.3  Score=20.34  Aligned_cols=12  Identities=17%  Similarity=0.800  Sum_probs=6.0

Q ss_pred             cCCccccccccc
Q psy9695         107 RCTICQKAFTTK  118 (159)
Q Consensus       107 ~C~~C~~~f~~~  118 (159)
                      .||+|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            889998887643


No 171
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=51.87  E-value=6  Score=19.05  Aligned_cols=10  Identities=20%  Similarity=0.531  Sum_probs=5.4

Q ss_pred             ccCccccccc
Q psy9695          78 HLCHVCHKNF   87 (159)
Q Consensus        78 ~~C~~C~~~~   87 (159)
                      +.|..||...
T Consensus        20 ~vC~~CG~Vl   29 (43)
T PF08271_consen   20 LVCPNCGLVL   29 (43)
T ss_dssp             EEETTT-BBE
T ss_pred             EECCCCCCEe
Confidence            5677776543


No 172
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=51.73  E-value=2.9  Score=31.66  Aligned_cols=28  Identities=14%  Similarity=0.229  Sum_probs=21.9

Q ss_pred             CccCCcccccccccCCceeeehhhccCC
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIGS  132 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~  132 (159)
                      -|.|+.|.+.|.....+..|+...|.+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            3678888888888888888886677665


No 173
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=51.55  E-value=7  Score=19.48  Aligned_cols=16  Identities=19%  Similarity=0.382  Sum_probs=12.3

Q ss_pred             CccCCcccccccccCC
Q psy9695         105 PFRCTICQKAFTTKGN  120 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~  120 (159)
                      .|.|+.||..+.-...
T Consensus        20 ~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       20 RFVCRKCGYEEPIEQK   35 (52)
T ss_pred             EEECCcCCCeEECCCc
Confidence            6889999977766555


No 174
>KOG0696|consensus
Probab=51.22  E-value=8  Score=29.23  Aligned_cols=61  Identities=23%  Similarity=0.294  Sum_probs=43.9

Q ss_pred             CCCCCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhch
Q psy9695          73 AGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGK  148 (159)
Q Consensus        73 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~  148 (159)
                      .|...|.|..|..        ..|++-|. -..|.|+-=++.+.....-.+|..++|+=.      -|--|+.||.
T Consensus        69 fgKQGfQCqvC~f--------vvHkrChe-fVtF~CPGadkg~dtDdpr~kHkf~~~tYs------sPTFCDhCGs  129 (683)
T KOG0696|consen   69 FGKQGFQCQVCCF--------VVHKRCHE-FVTFSCPGADKGPDTDDPRSKHKFKIHTYS------SPTFCDHCGS  129 (683)
T ss_pred             cccCceeeeEEee--------hhhhhhcc-eEEEECCCCCCCCCCCCcccccceeeeecC------CCchhhhHHH
Confidence            4556788888763        45666553 345788887888888888888887887765      6777888874


No 175
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=51.18  E-value=14  Score=31.81  Aligned_cols=8  Identities=38%  Similarity=0.912  Sum_probs=5.1

Q ss_pred             cccccccc
Q psy9695          47 FRCTICQK   54 (159)
Q Consensus        47 ~~c~~c~~   54 (159)
                      +.|+.||.
T Consensus       668 rkCPkCG~  675 (1337)
T PRK14714        668 RRCPSCGT  675 (1337)
T ss_pred             EECCCCCC
Confidence            56666664


No 176
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=51.09  E-value=8.2  Score=22.23  Aligned_cols=30  Identities=23%  Similarity=0.635  Sum_probs=17.7

Q ss_pred             CccccccccccccCccccccccccccccCCCCCccCccccccc
Q psy9695          45 KPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNF   87 (159)
Q Consensus        45 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~   87 (159)
                      ..|.|+.|+..-.-..             +...|.|..|++.|
T Consensus        34 a~y~CpfCgk~~vkR~-------------a~GIW~C~~C~~~~   63 (91)
T TIGR00280        34 AKYVCPFCGKKTVKRG-------------STGIWTCRKCGAKF   63 (91)
T ss_pred             cCccCCCCCCCceEEE-------------eeEEEEcCCCCCEE
Confidence            3588888874332111             11248888888765


No 177
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=50.81  E-value=6.2  Score=19.91  Aligned_cols=12  Identities=17%  Similarity=0.479  Sum_probs=8.3

Q ss_pred             CCccCCcccccc
Q psy9695         104 KPFRCTICQKAF  115 (159)
Q Consensus       104 ~~~~C~~C~~~f  115 (159)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            467888888654


No 178
>PLN02294 cytochrome c oxidase subunit Vb
Probab=50.74  E-value=8.5  Score=24.95  Aligned_cols=17  Identities=29%  Similarity=0.829  Sum_probs=13.5

Q ss_pred             CCCCccCCccccccccc
Q psy9695         102 GDKPFRCTICQKAFTTK  118 (159)
Q Consensus       102 ~~~~~~C~~C~~~f~~~  118 (159)
                      ..+|++|++||..|.-.
T Consensus       138 kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        138 KGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCCceeCCCCCCEEEEE
Confidence            35789999999888644


No 179
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=50.29  E-value=3.1  Score=20.11  Aligned_cols=11  Identities=36%  Similarity=0.480  Sum_probs=5.6

Q ss_pred             cchhhchhhhh
Q psy9695         142 IGAVEGKSFQA  152 (159)
Q Consensus       142 ~C~~C~~~f~~  152 (159)
                      .|++|++.|..
T Consensus        10 ~C~~C~rpf~W   20 (42)
T PF10013_consen   10 ICPVCGRPFTW   20 (42)
T ss_pred             cCcccCCcchH
Confidence            45555555543


No 180
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=49.47  E-value=17  Score=29.80  Aligned_cols=69  Identities=14%  Similarity=0.260  Sum_probs=36.3

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCc-eeee--hhhccCCCCCcccccc-cchhhchhhhhc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNL-KVRE--IEINIGSQLPKKAQQH-IGAVEGKSFQAK  153 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l-~~H~--~~~h~~~~~~~~~~~~-~C~~C~~~f~~~  153 (159)
                      -.|..|++.|.+....       ...+.+.|..||..|-...+- +.+.  .+. .....+.+..++ .|+.|-+.+...
T Consensus       461 dtC~~C~kkFfSlsK~-------L~~RKHHCRkCGrVFC~~CSSnRs~yp~aKL-pKPgsseE~ppRRVCD~CYdq~EnL  532 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRP-------LGTRAHHCRSCGIRLCVFCITKRAHYSFAKL-AKPGSSDEAEERLVCDTCYKEYETV  532 (1374)
T ss_pred             CcccCcCCcccccccc-------cccccccccCCccccCccccCCcccCccccc-CCCCCcccccccchhHHHHHHHHhH
Confidence            4588999888654110       123456677788877655332 2221  011 111112222445 899998777554


Q ss_pred             c
Q psy9695         154 H  154 (159)
Q Consensus       154 ~  154 (159)
                      .
T Consensus       533 l  533 (1374)
T PTZ00303        533 S  533 (1374)
T ss_pred             H
Confidence            3


No 181
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=49.06  E-value=8.8  Score=22.49  Aligned_cols=9  Identities=33%  Similarity=1.003  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy9695          47 FRCTICQKA   55 (159)
Q Consensus        47 ~~c~~c~~~   55 (159)
                      |.|+.|+..
T Consensus        23 FtCp~Cghe   31 (104)
T COG4888          23 FTCPRCGHE   31 (104)
T ss_pred             EecCccCCe
Confidence            444444433


No 182
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=48.52  E-value=16  Score=25.37  Aligned_cols=12  Identities=17%  Similarity=0.653  Sum_probs=6.7

Q ss_pred             CcccCccccccc
Q psy9695          17 PKHLCHVCHKNF   28 (159)
Q Consensus        17 ~~~~C~~C~~~f   28 (159)
                      ..|.|..|+..|
T Consensus       111 rqFaC~~Cd~~W  122 (278)
T PF15135_consen  111 RQFACSSCDHMW  122 (278)
T ss_pred             eeeeccccchHH
Confidence            346666666543


No 183
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=48.32  E-value=3.6  Score=21.24  Aligned_cols=39  Identities=18%  Similarity=0.514  Sum_probs=17.0

Q ss_pred             CccCcc--cccccCChHHHHHHHHHccCCCCccCCc----cccccc
Q psy9695          77 KHLCHV--CHKNFSSSSALQIHMRTHTGDKPFRCTI----CQKAFT  116 (159)
Q Consensus        77 ~~~C~~--C~~~~~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~  116 (159)
                      +..|+.  |...+. ...|..|....-..++-.|++    |+..+.
T Consensus         9 ~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             EeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            345555  333333 235666666433345556666    665543


No 184
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=48.23  E-value=29  Score=25.42  Aligned_cols=72  Identities=24%  Similarity=0.447  Sum_probs=45.5

Q ss_pred             ccCcccccccCChHHHHHHHHhhcCCCcccccccccc-------ccCccccccccccccccCCCCCccCcc--cc----c
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKA-------FTTKGNLKLIPNAVFNVAGMPKHLCHV--CH----K   85 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~-------~~~~~~l~~~~~~~~~~~~~~~~~C~~--C~----~   85 (159)
                      -+|.+|..-|-+..+|..|++..+    -.|-+|+.-       |.+...|..       |.....|.|..  |.    .
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~H----E~ChICD~v~p~~~QYFK~Y~~Le~-------HF~~~hy~ct~qtc~~~k~~  289 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRH----EACHICDMVGPIRYQYFKSYEDLEA-------HFRNAHYCCTFQTCRVGKCY  289 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhh----hhhhhhhccCccchhhhhCHHHHHH-------HhhcCceEEEEEEEecCcEE
Confidence            579999999999999999987544    235555432       444444433       22233466654  32    2


Q ss_pred             ccCChHHHHHHHHHcc
Q psy9695          86 NFSSSSALQIHMRTHT  101 (159)
Q Consensus        86 ~~~~~~~l~~H~~~h~  101 (159)
                      +|.....|+.|.-.-+
T Consensus       290 vf~~~~el~~h~~~~h  305 (493)
T COG5236         290 VFPYHTELLEHLTRFH  305 (493)
T ss_pred             EeccHHHHHHHHHHHh
Confidence            6788888888876543


No 185
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=47.46  E-value=11  Score=20.11  Aligned_cols=57  Identities=14%  Similarity=0.252  Sum_probs=26.0

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehh-hccCCCCCcccccccchhhchhh
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIE-INIGSQLPKKAQQHIGAVEGKSF  150 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-~h~~~~~~~~~~~~~C~~C~~~f  150 (159)
                      -.|..|++.|..            ..+.+.|..||..|-..-.-..-... ...+    .......|+.|...+
T Consensus        10 ~~C~~C~~~F~~------------~~rrhhCr~CG~~vC~~Cs~~~~~~~~~~~~----~~~~~RvC~~C~~~~   67 (69)
T PF01363_consen   10 SNCMICGKKFSL------------FRRRHHCRNCGRVVCSSCSSQRIPLPTPSSG----SGEPVRVCDSCYSKL   67 (69)
T ss_dssp             SB-TTT--B-BS------------SS-EEE-TTT--EEECCCS-EEEEET--GGT----ESEEEEE-HHHHHHH
T ss_pred             CcCcCcCCcCCC------------ceeeEccCCCCCEECCchhCCEEcccccccC----CCCcCEECHHHHHHh
Confidence            468889888843            24567899999998876554322211 0111    122567787776554


No 186
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=47.33  E-value=4.4  Score=19.58  Aligned_cols=16  Identities=38%  Similarity=0.277  Sum_probs=9.0

Q ss_pred             ccccchhhchhhhhcc
Q psy9695         139 QQHIGAVEGKSFQAKH  154 (159)
Q Consensus       139 ~~~~C~~C~~~f~~~~  154 (159)
                      .++.|+.|+..|=...
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            5778888888775443


No 187
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=47.20  E-value=11  Score=16.98  Aligned_cols=12  Identities=17%  Similarity=0.105  Sum_probs=7.4

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      .-|.|..|+..|
T Consensus        26 ~Cf~C~~C~~~L   37 (39)
T smart00132       26 ECFKCSKCGKPL   37 (39)
T ss_pred             cCCCCcccCCcC
Confidence            346677666654


No 188
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.14  E-value=11  Score=22.39  Aligned_cols=14  Identities=7%  Similarity=0.090  Sum_probs=10.1

Q ss_pred             CCccCcccccccCC
Q psy9695          76 PKHLCHVCHKNFSS   89 (159)
Q Consensus        76 ~~~~C~~C~~~~~~   89 (159)
                      .|.+|+.||++|+.
T Consensus        25 dPiVsPytG~s~P~   38 (129)
T COG4530          25 DPIVSPYTGKSYPR   38 (129)
T ss_pred             CccccCcccccchH
Confidence            36788888888733


No 189
>smart00507 HNHc HNH nucleases.
Probab=46.61  E-value=19  Score=17.27  Aligned_cols=12  Identities=25%  Similarity=0.481  Sum_probs=8.1

Q ss_pred             ccCCcccccccc
Q psy9695         106 FRCTICQKAFTT  117 (159)
Q Consensus       106 ~~C~~C~~~f~~  117 (159)
                      +.|.+|+..+..
T Consensus        11 ~~C~~C~~~~~~   22 (52)
T smart00507       11 GVCAYCGKPASE   22 (52)
T ss_pred             CCCcCCcCCCCC
Confidence            577777766654


No 190
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=46.13  E-value=11  Score=21.70  Aligned_cols=30  Identities=20%  Similarity=0.533  Sum_probs=17.7

Q ss_pred             CccccccccccccCccccccccccccccCCCCCccCccccccc
Q psy9695          45 KPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNF   87 (159)
Q Consensus        45 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~   87 (159)
                      ..|.|+.|+..-.-..             +...|.|..|++.|
T Consensus        35 a~y~CpfCgk~~vkR~-------------a~GIW~C~~C~~~~   64 (90)
T PRK03976         35 AKHVCPVCGRPKVKRV-------------GTGIWECRKCGAKF   64 (90)
T ss_pred             cCccCCCCCCCceEEE-------------EEEEEEcCCCCCEE
Confidence            3588888864432211             11247888888765


No 191
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.03  E-value=9.7  Score=23.32  Aligned_cols=11  Identities=18%  Similarity=0.193  Sum_probs=6.9

Q ss_pred             ccCcccccccCC
Q psy9695          78 HLCHVCHKNFSS   89 (159)
Q Consensus        78 ~~C~~C~~~~~~   89 (159)
                      +.| .|+..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            667 77765543


No 192
>PF10621 FpoO:  F420H2 dehydrogenase subunit FpoO ;  InterPro: IPR018288 This entry represents the FpoO subunit of membrane-bound multi-subunit F420H2 dehydrogenase, which oxidises the reduced coenzyme F420H2 to coenzyme F420 and feeds the electrons via an FeS cluster into an energy-conserving electron transport chain [, ]. This enzyme plays a role in the methanogenic pathway in methanogenic archaea. Reduced coenzyme F420H2 is the major cytoplasmic electron carrier of methanogens and a reversible hydride donor, much like NADH []. F420H2 + COB-S-S-CoM = F420 + CoM-SH + CoB-SH  Where CoB-S-S-CoM (the heterosulphide of 2-mercaptoethanesulphonate and 7-mercaptoheptanoylthreonine phosphate) is the terminal electron acceptor of the methanogenic pathway, and is reduced with the concomitant generation of a transmembrane proton potential and ATP synthesis.  The FpoO subunit of F420H2 dehydrogenase probably participates in the reduction of methanophenazine, where it acts as a special mechanism for the reduction of the methanogenic cofactor []. 
Probab=45.84  E-value=9.2  Score=22.76  Aligned_cols=65  Identities=20%  Similarity=0.432  Sum_probs=31.1

Q ss_pred             ccccccccccCccccccccccccc--cCCCCCccCcccccccCChHHHHHHHHHccCCCCccCCccccc
Q psy9695          48 RCTICQKAFTTKGNLKLIPNAVFN--VAGMPKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKA  114 (159)
Q Consensus        48 ~c~~c~~~~~~~~~l~~~~~~~~~--~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  114 (159)
                      .|..||...++...+.........  +.|...-.|..|-.+.  ......+......-+.=+|..||..
T Consensus         3 DCdLCg~~~Pt~~PvrV~~Pr~~~~yPeGvwKGLC~~CL~sa--~~ty~e~~~~~~s~~~gKC~LCG~k   69 (119)
T PF10621_consen    3 DCDLCGRAIPTVCPVRVFAPRLTLAYPEGVWKGLCETCLDSA--EKTYQEVNENESSCRSGKCDLCGKK   69 (119)
T ss_pred             ccchhcCcCCceeEEEeecchhhccCcchHHHhhHHHHHHHH--HHHHHHHhcccccccccceeccCCc
Confidence            366677666555544422111111  2232233466665433  2233334333443455689999955


No 193
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=45.63  E-value=7  Score=24.69  Aligned_cols=10  Identities=30%  Similarity=1.261  Sum_probs=6.4

Q ss_pred             ccCCcccccc
Q psy9695         106 FRCTICQKAF  115 (159)
Q Consensus       106 ~~C~~C~~~f  115 (159)
                      |.|..|+..+
T Consensus       124 ~~C~~C~~~~  133 (157)
T PF10263_consen  124 YRCPSCGREY  133 (157)
T ss_pred             EEcCCCCCEe
Confidence            5676677554


No 194
>KOG2807|consensus
Probab=45.55  E-value=67  Score=23.42  Aligned_cols=25  Identities=20%  Similarity=0.607  Sum_probs=17.1

Q ss_pred             CccCCcccccccccCCceeeehhhcc
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINI  130 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~  130 (159)
                      .|+|..|...|-...+.-.|- ..|.
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHe-sLh~  369 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHE-SLHN  369 (378)
T ss_pred             cEEchhccceeeccchHHHHh-hhhc
Confidence            477777777777777666666 5553


No 195
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=45.32  E-value=17  Score=18.48  Aligned_cols=12  Identities=17%  Similarity=0.617  Sum_probs=6.4

Q ss_pred             ccCcccccccCC
Q psy9695          78 HLCHVCHKNFSS   89 (159)
Q Consensus        78 ~~C~~C~~~~~~   89 (159)
                      +.|+.|+..+..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            556666554433


No 196
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=45.22  E-value=9.3  Score=23.14  Aligned_cols=13  Identities=23%  Similarity=0.588  Sum_probs=8.6

Q ss_pred             CccCcccccccCC
Q psy9695          77 KHLCHVCHKNFSS   89 (159)
Q Consensus        77 ~~~C~~C~~~~~~   89 (159)
                      .+.|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3678888866543


No 197
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=45.07  E-value=15  Score=21.61  Aligned_cols=16  Identities=31%  Similarity=0.681  Sum_probs=12.2

Q ss_pred             cccCcccccccCChHH
Q psy9695          18 KHLCHVCHKNFSSSSA   33 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~   33 (159)
                      |++|.-||..|..-+.
T Consensus         2 pH~CtrCG~vf~~g~~   17 (112)
T COG3364           2 PHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CceecccccccccccH
Confidence            6788888888877543


No 198
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=44.90  E-value=16  Score=29.61  Aligned_cols=11  Identities=9%  Similarity=-0.070  Sum_probs=8.6

Q ss_pred             ccccchhhchh
Q psy9695         139 QQHIGAVEGKS  149 (159)
Q Consensus       139 ~~~~C~~C~~~  149 (159)
                      .+..|+.||..
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            78888888854


No 199
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=44.73  E-value=5  Score=32.03  Aligned_cols=60  Identities=23%  Similarity=0.347  Sum_probs=36.6

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCc-cCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhh
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPF-RCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQ  151 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~-~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~  151 (159)
                      ..|..||..|.-...|-- -+..+.-+.| .|+.|.+.|...-+-+=|.             ++.-|+.||=...
T Consensus       124 ~~CT~CGPRfTIi~alPY-DR~nTsM~~F~lC~~C~~EY~dP~nRRfHA-------------Qp~aCp~CGP~~~  184 (750)
T COG0068         124 INCTNCGPRFTIIEALPY-DRENTSMADFPLCPFCDKEYKDPLNRRFHA-------------QPIACPKCGPHLF  184 (750)
T ss_pred             cccCCCCcceeeeccCCC-CcccCccccCcCCHHHHHHhcCcccccccc-------------ccccCcccCCCeE
Confidence            347777765533222111 1122222333 5999999888877777777             8999999996443


No 200
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=44.15  E-value=19  Score=23.57  Aligned_cols=33  Identities=15%  Similarity=0.499  Sum_probs=18.4

Q ss_pred             cCCCccccccccccccCccccccccccccccCCCCCccCcccccc
Q psy9695          42 TGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKN   86 (159)
Q Consensus        42 ~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~   86 (159)
                      ....-|.|+.|...+..-..+.            ..|.|+.||..
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~~------------~~F~Cp~Cg~~  141 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAME------------LGFTCPKCGED  141 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHHH------------hCCCCCCCCch
Confidence            3445577766665554433221            13777777764


No 201
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=44.12  E-value=31  Score=17.43  Aligned_cols=14  Identities=7%  Similarity=0.128  Sum_probs=7.3

Q ss_pred             ccchhhchhhhhcc
Q psy9695         141 HIGAVEGKSFQAKH  154 (159)
Q Consensus       141 ~~C~~C~~~f~~~~  154 (159)
                      ..|..|+..|....
T Consensus        26 ~LCnaCgl~~~k~~   39 (52)
T smart00401       26 TLCNACGLYYKKHG   39 (52)
T ss_pred             cEeecccHHHHHcC
Confidence            55555555554433


No 202
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=43.68  E-value=11  Score=24.00  Aligned_cols=33  Identities=21%  Similarity=0.625  Sum_probs=17.4

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCCccCCccccc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKA  114 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  114 (159)
                      +|.|. |+..+.+.   ..|-..-.|+ .|.|..|+..
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            46666 76665443   2233333344 5777766644


No 203
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=42.90  E-value=5.9  Score=26.32  Aligned_cols=12  Identities=25%  Similarity=0.260  Sum_probs=7.0

Q ss_pred             ccCCcccccccc
Q psy9695         106 FRCTICQKAFTT  117 (159)
Q Consensus       106 ~~C~~C~~~f~~  117 (159)
                      +.|..||..++.
T Consensus        44 ~~C~~CgYR~~D   55 (201)
T COG1779          44 GVCERCGYRSTD   55 (201)
T ss_pred             EEccccCCcccc
Confidence            456667665543


No 204
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=42.84  E-value=2.7  Score=30.53  Aligned_cols=11  Identities=9%  Similarity=-0.130  Sum_probs=3.6

Q ss_pred             ccccchhhchh
Q psy9695         139 QQHIGAVEGKS  149 (159)
Q Consensus       139 ~~~~C~~C~~~  149 (159)
                      +.|+|..|+.+
T Consensus       284 RFFkC~~C~~R  294 (344)
T PF09332_consen  284 RFFKCKDCGNR  294 (344)
T ss_dssp             EEEE-T-TS-E
T ss_pred             eeEECCCCCCe
Confidence            44444444443


No 205
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.84  E-value=6.3  Score=20.77  Aligned_cols=11  Identities=0%  Similarity=0.069  Sum_probs=5.6

Q ss_pred             ccchhhchhhh
Q psy9695         141 HIGAVEGKSFQ  151 (159)
Q Consensus       141 ~~C~~C~~~f~  151 (159)
                      -.|++|+..|.
T Consensus        49 v~CPYC~t~y~   59 (62)
T COG4391          49 VVCPYCSTRYR   59 (62)
T ss_pred             EecCccccEEE
Confidence            45555555443


No 206
>KOG1729|consensus
Probab=41.20  E-value=21  Score=25.41  Aligned_cols=58  Identities=12%  Similarity=0.109  Sum_probs=31.3

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhh
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQA  152 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~  152 (159)
                      -.|..|+.+..+...-+     |+      |..||..|....+-..=+.......      ..++|++|-..|..
T Consensus       169 ~~C~~C~~~~Ftl~~RR-----HH------CR~CG~ivC~~Cs~n~~~l~~~~~k------~~rvC~~CF~el~~  226 (288)
T KOG1729|consen  169 TECMVCGCTEFTLSERR-----HH------CRNCGDIVCAPCSRNRFLLPNLSTK------PIRVCDICFEELEK  226 (288)
T ss_pred             eecccCCCccccHHHHH-----HH------HHhcchHhhhhhhcCcccccccCCC------CceecHHHHHHHhc
Confidence            56888888532332222     22      6667777665333322221223333      44599999887753


No 207
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=39.95  E-value=15  Score=18.60  Aligned_cols=6  Identities=33%  Similarity=1.381  Sum_probs=2.8

Q ss_pred             cCCccc
Q psy9695         107 RCTICQ  112 (159)
Q Consensus       107 ~C~~C~  112 (159)
                      +|+-|+
T Consensus        26 KCpRC~   31 (51)
T PF10122_consen   26 KCPRCK   31 (51)
T ss_pred             ECCCCC
Confidence            444444


No 208
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=39.50  E-value=9.4  Score=17.77  Aligned_cols=12  Identities=33%  Similarity=0.739  Sum_probs=4.9

Q ss_pred             CCcccccccccC
Q psy9695         108 CTICQKAFTTKG  119 (159)
Q Consensus       108 C~~C~~~f~~~~  119 (159)
                      |+.|++.|-..+
T Consensus         5 CprC~kg~Hwa~   16 (36)
T PF14787_consen    5 CPRCGKGFHWAS   16 (36)
T ss_dssp             -TTTSSSCS-TT
T ss_pred             CcccCCCcchhh
Confidence            555555544433


No 209
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=39.29  E-value=12  Score=22.06  Aligned_cols=35  Identities=17%  Similarity=0.154  Sum_probs=18.8

Q ss_pred             CCccCcccccccCChHHHHHHHHHccCCCCccCCcccccccc
Q psy9695          76 PKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTT  117 (159)
Q Consensus        76 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  117 (159)
                      ..|.|+.|+... -...+..      +.-...|+.||..+..
T Consensus        20 t~f~CP~Cge~~-v~v~~~k------~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         20 KIFECPRCGKVS-ISVKIKK------NIAIITCGNCGLYTEF   54 (99)
T ss_pred             cEeECCCCCCeE-eeeecCC------CcceEECCCCCCccCE
Confidence            358888888422 1111111      2233578888866553


No 210
>KOG4167|consensus
Probab=39.22  E-value=6.4  Score=31.55  Aligned_cols=25  Identities=32%  Similarity=0.527  Sum_probs=21.7

Q ss_pred             CccCcccccccCChHHHHHHHHHcc
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHT  101 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~  101 (159)
                      .|-|.+|++.|.-...+..|++.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999988888888888775


No 211
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=39.18  E-value=11  Score=18.92  Aligned_cols=9  Identities=44%  Similarity=1.357  Sum_probs=3.7

Q ss_pred             CccCCcccc
Q psy9695         105 PFRCTICQK  113 (159)
Q Consensus       105 ~~~C~~C~~  113 (159)
                      .|.|++|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            399999985


No 212
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=38.92  E-value=8.4  Score=19.99  Aligned_cols=8  Identities=25%  Similarity=1.053  Sum_probs=4.2

Q ss_pred             CccCCccc
Q psy9695         105 PFRCTICQ  112 (159)
Q Consensus       105 ~~~C~~C~  112 (159)
                      .|.|+.|.
T Consensus        31 tYmC~eC~   38 (56)
T PF09963_consen   31 TYMCDECK   38 (56)
T ss_pred             ceeChhHH
Confidence            35555554


No 213
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=38.42  E-value=10  Score=22.79  Aligned_cols=25  Identities=24%  Similarity=0.667  Sum_probs=14.4

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCccccc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKA  114 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  114 (159)
                      ..|..|+..|.....            .+.||.||..
T Consensus        71 ~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEF------------DFSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHC------------CHH-SSSSSS
T ss_pred             EECCCCCCEEecCCC------------CCCCcCCcCC
Confidence            678888877755322            1448888854


No 214
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.86  E-value=14  Score=25.28  Aligned_cols=16  Identities=19%  Similarity=0.652  Sum_probs=7.6

Q ss_pred             ccCCcccccccccCCc
Q psy9695         106 FRCTICQKAFTTKGNL  121 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l  121 (159)
                      ..||+|+-.|....-+
T Consensus        20 ieCPvC~tkFkkeev~   35 (267)
T COG1655          20 IECPVCNTKFKKEEVK   35 (267)
T ss_pred             eccCcccchhhhhhee
Confidence            4455555555444333


No 215
>cd00085 HNHc HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.
Probab=37.74  E-value=20  Score=17.59  Aligned_cols=10  Identities=30%  Similarity=0.411  Sum_probs=7.4

Q ss_pred             ccCCcccccc
Q psy9695         106 FRCTICQKAF  115 (159)
Q Consensus       106 ~~C~~C~~~f  115 (159)
                      +.|.+|+..+
T Consensus        12 ~~C~~c~~~~   21 (57)
T cd00085          12 GLCPYCGKPG   21 (57)
T ss_pred             CcCccCCCcC
Confidence            6788887766


No 216
>PRK04351 hypothetical protein; Provisional
Probab=37.50  E-value=16  Score=23.22  Aligned_cols=13  Identities=0%  Similarity=-0.158  Sum_probs=7.2

Q ss_pred             ccccchhhchhhh
Q psy9695         139 QQHIGAVEGKSFQ  151 (159)
Q Consensus       139 ~~~~C~~C~~~f~  151 (159)
                      ..|.|..|+-.+.
T Consensus       131 ~~yrCg~C~g~L~  143 (149)
T PRK04351        131 KRYRCGKCRGKLK  143 (149)
T ss_pred             CcEEeCCCCcEee
Confidence            3466666665443


No 217
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=37.37  E-value=35  Score=20.55  Aligned_cols=20  Identities=15%  Similarity=0.441  Sum_probs=13.2

Q ss_pred             CCccCcccccccCChHHHHH
Q psy9695          76 PKHLCHVCHKNFSSSSALQI   95 (159)
Q Consensus        76 ~~~~C~~C~~~~~~~~~l~~   95 (159)
                      ..+.|+.||..+.+......
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~   49 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKR   49 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHH
Confidence            45788888887766544443


No 218
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=37.36  E-value=18  Score=27.20  Aligned_cols=14  Identities=29%  Similarity=0.645  Sum_probs=8.2

Q ss_pred             CccCCccccccccc
Q psy9695         105 PFRCTICQKAFTTK  118 (159)
Q Consensus       105 ~~~C~~C~~~f~~~  118 (159)
                      -|+|+.||..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56666666555443


No 219
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=37.21  E-value=16  Score=18.68  Aligned_cols=11  Identities=18%  Similarity=0.797  Sum_probs=7.3

Q ss_pred             ccCCccccccc
Q psy9695         106 FRCTICQKAFT  116 (159)
Q Consensus       106 ~~C~~C~~~f~  116 (159)
                      +.||+||..+.
T Consensus         1 i~CPyCge~~~   11 (52)
T PF14255_consen    1 IQCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCCeeE
Confidence            36888886654


No 220
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=36.40  E-value=24  Score=25.44  Aligned_cols=16  Identities=0%  Similarity=-0.201  Sum_probs=12.2

Q ss_pred             cccccchhhchhhhhc
Q psy9695         138 AQQHIGAVEGKSFQAK  153 (159)
Q Consensus       138 ~~~~~C~~C~~~f~~~  153 (159)
                      .+...|..|+..++.-
T Consensus       250 ~r~e~C~~C~~YlK~~  265 (305)
T TIGR01562       250 LKAETCDSCQGYLKIL  265 (305)
T ss_pred             eEEeeccccccchhhh
Confidence            3778999999776654


No 221
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=36.33  E-value=29  Score=17.50  Aligned_cols=13  Identities=23%  Similarity=0.731  Sum_probs=6.6

Q ss_pred             CccCCcccccccc
Q psy9695         105 PFRCTICQKAFTT  117 (159)
Q Consensus       105 ~~~C~~C~~~f~~  117 (159)
                      .+.|..||..|-.
T Consensus        18 k~~Cr~Cg~~~C~   30 (57)
T cd00065          18 RHHCRNCGRIFCS   30 (57)
T ss_pred             ccccCcCcCCcCh
Confidence            3455555555543


No 222
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=36.21  E-value=11  Score=26.92  Aligned_cols=40  Identities=18%  Similarity=0.196  Sum_probs=23.1

Q ss_pred             CccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhh
Q psy9695         105 PFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQ  151 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~  151 (159)
                      .+.|+.|+..=.....++..- .....-      ..|.|..||..+.
T Consensus       258 ~~~C~~C~~~~~~~~q~Qtrs-aDEpmT------~f~~C~~Cg~~w~  297 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQLQTRS-ADEPMT------TFVTCEECGNRWK  297 (299)
T ss_pred             cccCCCCCCccceEEEecccC-CCCCCe------EEEEcCCCCCeee
Confidence            489999995544333332211 111112      6889999997653


No 223
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=35.42  E-value=24  Score=17.79  Aligned_cols=12  Identities=17%  Similarity=0.077  Sum_probs=5.4

Q ss_pred             cccchhhchhhh
Q psy9695         140 QHIGAVEGKSFQ  151 (159)
Q Consensus       140 ~~~C~~C~~~f~  151 (159)
                      -|.|..|++.+.
T Consensus        26 Cf~C~~C~~~l~   37 (58)
T PF00412_consen   26 CFKCSKCGKPLN   37 (58)
T ss_dssp             TSBETTTTCBTT
T ss_pred             ccccCCCCCccC
Confidence            344444444443


No 224
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=35.22  E-value=32  Score=18.25  Aligned_cols=17  Identities=29%  Similarity=0.856  Sum_probs=7.6

Q ss_pred             ccCCcccccccccCCce
Q psy9695         106 FRCTICQKAFTTKGNLK  122 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~  122 (159)
                      |.|..|..-++....|+
T Consensus        31 ~~Ck~C~rywT~GG~lR   47 (63)
T PF02701_consen   31 YFCKSCRRYWTHGGTLR   47 (63)
T ss_pred             hhhHHHHHHHHhcceec
Confidence            44444444444444443


No 225
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=34.79  E-value=20  Score=21.40  Aligned_cols=8  Identities=25%  Similarity=0.742  Sum_probs=3.7

Q ss_pred             ccCccccc
Q psy9695          78 HLCHVCHK   85 (159)
Q Consensus        78 ~~C~~C~~   85 (159)
                      |.|++|+.
T Consensus        20 ~iCpeC~~   27 (109)
T TIGR00686        20 LICPSCLY   27 (109)
T ss_pred             eECccccc
Confidence            44454443


No 226
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=34.49  E-value=24  Score=20.85  Aligned_cols=9  Identities=22%  Similarity=0.678  Sum_probs=6.4

Q ss_pred             CccCccccc
Q psy9695          77 KHLCHVCHK   85 (159)
Q Consensus        77 ~~~C~~C~~   85 (159)
                      |..|+.||.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            567888875


No 227
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=34.21  E-value=22  Score=16.71  Aligned_cols=15  Identities=27%  Similarity=0.718  Sum_probs=5.7

Q ss_pred             CccCCcccccccccC
Q psy9695         105 PFRCTICQKAFTTKG  119 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~  119 (159)
                      .|-|++|+..|+..+
T Consensus         3 ryyCdyC~~~~~~d~   17 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDS   17 (38)
T ss_dssp             S-B-TTT--B-S--S
T ss_pred             CeecccccceecCCC
Confidence            477888888886554


No 228
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=32.59  E-value=18  Score=18.18  Aligned_cols=10  Identities=20%  Similarity=0.647  Sum_probs=6.8

Q ss_pred             CccCCccccc
Q psy9695         105 PFRCTICQKA  114 (159)
Q Consensus       105 ~~~C~~C~~~  114 (159)
                      .|.|..||..
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            5777777743


No 229
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=32.36  E-value=26  Score=21.13  Aligned_cols=11  Identities=18%  Similarity=0.736  Sum_probs=6.1

Q ss_pred             ccCcccccccC
Q psy9695          78 HLCHVCHKNFS   88 (159)
Q Consensus        78 ~~C~~C~~~~~   88 (159)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (114)
T PRK03681         71 CWCETCQQYVT   81 (114)
T ss_pred             EEcccCCCeee
Confidence            55666665543


No 230
>KOG0978|consensus
Probab=32.36  E-value=21  Score=28.73  Aligned_cols=22  Identities=18%  Similarity=0.495  Sum_probs=16.7

Q ss_pred             CCccCCcccccccccCCceeee
Q psy9695         104 KPFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      +.-+||.|+.+|....-++.|+
T Consensus       677 RqRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             hcCCCCCCCCCCCcccccccCC
Confidence            3458999999998887766653


No 231
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG2071|consensus
Probab=31.57  E-value=35  Score=26.86  Aligned_cols=28  Identities=25%  Similarity=0.434  Sum_probs=23.5

Q ss_pred             CCCcccCcccccccCChHHHHHHHHhhc
Q psy9695          15 GMPKHLCHVCHKNFSSSSALQIHMRTHT   42 (159)
Q Consensus        15 ~~~~~~C~~C~~~f~~~~~~~~h~~~~~   42 (159)
                      ...+.+|..||..|........|+.+|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3556899999999999999888887764


No 233
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=31.49  E-value=31  Score=22.95  Aligned_cols=31  Identities=19%  Similarity=0.484  Sum_probs=19.3

Q ss_pred             CCccCcccccccCChHHHHHHHHHccCCCCccCCccccccc
Q psy9695          76 PKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFT  116 (159)
Q Consensus        76 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  116 (159)
                      ++-.|..|+..|.....          ...|-++.|+..+.
T Consensus         5 k~rKCKvCg~~F~P~~s----------~q~vCSpeCa~a~~   35 (189)
T PF05766_consen    5 KRRKCKVCGEWFVPARS----------NQKVCSPECAIALA   35 (189)
T ss_pred             CCCcCcccCCccccCCC----------ceeeeCHHHHhHHH
Confidence            35678888888754322          23466677886554


No 234
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=31.36  E-value=34  Score=26.37  Aligned_cols=46  Identities=9%  Similarity=0.260  Sum_probs=20.9

Q ss_pred             CCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhh
Q psy9695         104 KPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQ  151 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~  151 (159)
                      ..|+|..||..|-....-...  .+-.|-....=.-.|.||.|+..-.
T Consensus       424 ~~~~c~~c~~~yd~~~g~~~~--~~~~gt~~~~lp~~~~cp~c~~~k~  469 (479)
T PRK05452        424 PRMQCSVCQWIYDPAKGEPMQ--DVAPGTPWSEVPDNFLCPECSLGKD  469 (479)
T ss_pred             CeEEECCCCeEECCCCCCccc--CCCCCCChhhCCCCCcCcCCCCcHH
Confidence            447888888655433221111  1222211100113578888876533


No 235
>KOG4167|consensus
Probab=31.33  E-value=13  Score=29.99  Aligned_cols=24  Identities=33%  Similarity=0.578  Sum_probs=22.4

Q ss_pred             ccCcccccccCChHHHHHHHHhhc
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHT   42 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~   42 (159)
                      |.|.+|++.|....++..||..|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            999999999999999999999885


No 236
>KOG2231|consensus
Probab=31.27  E-value=49  Score=26.67  Aligned_cols=21  Identities=38%  Similarity=0.838  Sum_probs=11.0

Q ss_pred             cCcccccccCChHHHHHHHHh
Q psy9695          20 LCHVCHKNFSSSSALQIHMRT   40 (159)
Q Consensus        20 ~C~~C~~~f~~~~~~~~h~~~   40 (159)
                      .|..|...|-....+..|+..
T Consensus       184 ~C~~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcc
Confidence            455555555555555555443


No 237
>PF12773 DZR:  Double zinc ribbon
Probab=31.23  E-value=41  Score=16.47  Aligned_cols=9  Identities=22%  Similarity=0.467  Sum_probs=4.7

Q ss_pred             CccCCcccc
Q psy9695         105 PFRCTICQK  113 (159)
Q Consensus       105 ~~~C~~C~~  113 (159)
                      ...|+.||.
T Consensus        29 ~~~C~~Cg~   37 (50)
T PF12773_consen   29 KKICPNCGA   37 (50)
T ss_pred             CCCCcCCcC
Confidence            345555554


No 238
>PRK10220 hypothetical protein; Provisional
Probab=31.18  E-value=32  Score=20.56  Aligned_cols=11  Identities=18%  Similarity=0.836  Sum_probs=5.1

Q ss_pred             ccccccccccc
Q psy9695          47 FRCTICQKAFT   57 (159)
Q Consensus        47 ~~c~~c~~~~~   57 (159)
                      +.|++|+..+.
T Consensus        21 ~vCpeC~hEW~   31 (111)
T PRK10220         21 YICPECAHEWN   31 (111)
T ss_pred             EECCcccCcCC
Confidence            44444444443


No 239
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=31.15  E-value=16  Score=18.89  Aligned_cols=10  Identities=30%  Similarity=0.979  Sum_probs=5.8

Q ss_pred             cCCccccccc
Q psy9695         107 RCTICQKAFT  116 (159)
Q Consensus       107 ~C~~C~~~f~  116 (159)
                      -|+.|+..|.
T Consensus        41 gCPfC~~~~~   50 (55)
T PF14447_consen   41 GCPFCGTPFE   50 (55)
T ss_pred             CCCCCCCccc
Confidence            4666666554


No 240
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.01  E-value=32  Score=18.17  Aligned_cols=8  Identities=25%  Similarity=1.065  Sum_probs=4.1

Q ss_pred             CccCCccc
Q psy9695         105 PFRCTICQ  112 (159)
Q Consensus       105 ~~~C~~C~  112 (159)
                      .|.|+.|.
T Consensus        31 tymC~eC~   38 (68)
T COG4896          31 TYMCPECE   38 (68)
T ss_pred             eEechhhH
Confidence            35555554


No 241
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=30.85  E-value=6  Score=19.55  Aligned_cols=15  Identities=27%  Similarity=0.596  Sum_probs=7.5

Q ss_pred             CCccCCc--cccccccc
Q psy9695         104 KPFRCTI--CQKAFTTK  118 (159)
Q Consensus       104 ~~~~C~~--C~~~f~~~  118 (159)
                      .-|+|..  ||..|...
T Consensus        24 ~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen   24 LYCQCTNPECGHTFVAN   40 (47)
T ss_pred             EEEEECCCcCCCEEEEE
Confidence            3355533  66555443


No 242
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=30.14  E-value=66  Score=19.01  Aligned_cols=18  Identities=11%  Similarity=0.095  Sum_probs=9.1

Q ss_pred             ccccccccccccCccccc
Q psy9695          46 PFRCTICQKAFTTKGNLK   63 (159)
Q Consensus        46 ~~~c~~c~~~~~~~~~l~   63 (159)
                      .|.|+.-|..|.+.....
T Consensus         3 Vf~i~~T~EiF~dYe~Y~   20 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYL   20 (102)
T ss_pred             eEEeCCCCcccCCHHHHH
Confidence            344555555555555443


No 243
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=30.08  E-value=20  Score=14.98  Aligned_cols=6  Identities=17%  Similarity=0.169  Sum_probs=2.4

Q ss_pred             hchhhh
Q psy9695         146 EGKSFQ  151 (159)
Q Consensus       146 C~~~f~  151 (159)
                      |...|.
T Consensus         6 C~~Gy~   11 (24)
T PF12662_consen    6 CPPGYQ   11 (24)
T ss_pred             CCCCCc
Confidence            444443


No 244
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=29.98  E-value=24  Score=22.34  Aligned_cols=7  Identities=29%  Similarity=0.909  Sum_probs=3.9

Q ss_pred             ccCCccc
Q psy9695         106 FRCTICQ  112 (159)
Q Consensus       106 ~~C~~C~  112 (159)
                      |.|..||
T Consensus       113 l~C~~Cg  119 (146)
T PF07295_consen  113 LVCENCG  119 (146)
T ss_pred             EecccCC
Confidence            5555555


No 245
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=29.91  E-value=16  Score=22.80  Aligned_cols=15  Identities=40%  Similarity=0.884  Sum_probs=12.4

Q ss_pred             CCCccCCcccccccc
Q psy9695         103 DKPFRCTICQKAFTT  117 (159)
Q Consensus       103 ~~~~~C~~C~~~f~~  117 (159)
                      .++.+|+.||..|.-
T Consensus       110 g~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  110 GKPQRCPECGQVFKL  124 (136)
T ss_dssp             TSEEEETTTEEEEEE
T ss_pred             CCccCCCCCCeEEEE
Confidence            468999999998864


No 246
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=29.77  E-value=13  Score=18.91  Aligned_cols=15  Identities=0%  Similarity=-0.219  Sum_probs=9.1

Q ss_pred             ccccchhhchhhhhc
Q psy9695         139 QQHIGAVEGKSFQAK  153 (159)
Q Consensus       139 ~~~~C~~C~~~f~~~  153 (159)
                      ..|+|.+|++.|...
T Consensus        34 ~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   34 IKLRCHYCERIITED   48 (52)
T ss_dssp             CEEEETTT--EEEHH
T ss_pred             CEEEeeCCCCEeccc
Confidence            678888888776543


No 247
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.27  E-value=21  Score=15.77  Aligned_cols=9  Identities=33%  Similarity=1.054  Sum_probs=3.1

Q ss_pred             ccCCccccc
Q psy9695         106 FRCTICQKA  114 (159)
Q Consensus       106 ~~C~~C~~~  114 (159)
                      |.|+.|+..
T Consensus        14 Y~Cp~C~~~   22 (30)
T PF04438_consen   14 YRCPRCGAR   22 (30)
T ss_dssp             EE-TTT--E
T ss_pred             EECCCcCCc
Confidence            555555544


No 248
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=28.16  E-value=39  Score=15.87  Aligned_cols=16  Identities=25%  Similarity=0.503  Sum_probs=8.3

Q ss_pred             CccCCcccccccccCC
Q psy9695         105 PFRCTICQKAFTTKGN  120 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~  120 (159)
                      ...|..|++.+.....
T Consensus         6 ~~~C~~C~~~~~~~~~   21 (43)
T PF06467_consen    6 MKTCSYCKKYIPNKPT   21 (43)
T ss_dssp             CEE-TTT--EEECCC-
T ss_pred             CCcCcccCCcccCCCc
Confidence            3568888888866664


No 249
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=27.32  E-value=22  Score=16.02  Aligned_cols=12  Identities=8%  Similarity=-0.006  Sum_probs=8.6

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      +.|+|..||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            578888887543


No 250
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=26.85  E-value=23  Score=22.24  Aligned_cols=12  Identities=8%  Similarity=-0.039  Sum_probs=7.1

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      ..|.|..|+-.|
T Consensus       132 ~~y~C~~C~g~l  143 (146)
T smart00731      132 SRYRCGKCGGKL  143 (146)
T ss_pred             ceEEcCCCCCEE
Confidence            346776676544


No 251
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=26.75  E-value=56  Score=16.62  Aligned_cols=11  Identities=27%  Similarity=0.673  Sum_probs=5.6

Q ss_pred             CCccccccccc
Q psy9695          44 DKPFRCTICQK   54 (159)
Q Consensus        44 ~~~~~c~~c~~   54 (159)
                      +....|+.||+
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            44455555553


No 252
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=26.67  E-value=77  Score=20.38  Aligned_cols=43  Identities=14%  Similarity=0.213  Sum_probs=22.6

Q ss_pred             cccccccccccCccccccccccccc-cCCCCCccCcccccccCChHH
Q psy9695          47 FRCTICQKAFTTKGNLKLIPNAVFN-VAGMPKHLCHVCHKNFSSSSA   92 (159)
Q Consensus        47 ~~c~~c~~~~~~~~~l~~~~~~~~~-~~~~~~~~C~~C~~~~~~~~~   92 (159)
                      -.|+.|+.......-...   .... .....|.-|..||+.|+|-..
T Consensus        40 ~~Cp~C~~~IrG~y~v~g---v~~~g~~~~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   40 TSCPNCSTPIRGDYHVEG---VFGLGGHYEAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             HHCcCCCCCCCCceecCC---eeeeCCCCCCChhHHhCCCCCchHHH
Confidence            357777655543322211   1111 222356778888888877543


No 253
>PF14369 zf-RING_3:  zinc-finger
Probab=26.61  E-value=49  Score=15.19  Aligned_cols=10  Identities=30%  Similarity=0.923  Sum_probs=5.9

Q ss_pred             cccccccccc
Q psy9695          48 RCTICQKAFT   57 (159)
Q Consensus        48 ~c~~c~~~~~   57 (159)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4666666553


No 254
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=26.51  E-value=36  Score=23.34  Aligned_cols=27  Identities=19%  Similarity=0.314  Sum_probs=17.8

Q ss_pred             CCCCccCCcccccccccCCceeeehhhccCC
Q psy9695         102 GDKPFRCTICQKAFTTKGNLKVREIEINIGS  132 (159)
Q Consensus       102 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  132 (159)
                      ..++.+|+.||..|..    ..+.+....|+
T Consensus       178 EGkpqRCpECGqVFKL----Vr~~~s~~dg~  204 (268)
T PTZ00043        178 EGFLYRCGECDQIFML----VRVLYSLPDGE  204 (268)
T ss_pred             CCCCccCCCCCcEEEE----EEEEeecCCCC
Confidence            3568999999988864    44443444444


No 255
>KOG1842|consensus
Probab=26.47  E-value=13  Score=28.10  Aligned_cols=27  Identities=19%  Similarity=0.266  Sum_probs=0.0

Q ss_pred             ccCCcccccccccCCceeeehhhccCC
Q psy9695         106 FRCTICQKAFTTKGNLKVREIEINIGS  132 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~~~~h~~~  132 (159)
                      |.||.|...|.....|..|....|.++
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhcccc


No 256
>KOG2906|consensus
Probab=26.45  E-value=20  Score=20.91  Aligned_cols=36  Identities=11%  Similarity=0.006  Sum_probs=20.6

Q ss_pred             cCCcccccccccCCceeeehhhccCCCCCcccccccchhhchh
Q psy9695         107 RCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKS  149 (159)
Q Consensus       107 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~  149 (159)
                      .|+.||..=.+--.|+... ...+.-      ..|+|-.|+..
T Consensus        67 ~Cp~Cgh~rayF~qlQtRS-ADEPmT------~FYkC~~C~~~  102 (105)
T KOG2906|consen   67 TCPTCGHERAYFMQLQTRS-ADEPMT------TFYKCCKCKHR  102 (105)
T ss_pred             cCCCCCCCceEEEEeeecc-CCCcHh------Hhhhhhccccc
Confidence            6777775544444444433 333333      67888777654


No 257
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=26.01  E-value=92  Score=15.07  Aligned_cols=9  Identities=33%  Similarity=0.947  Sum_probs=4.9

Q ss_pred             ccccccccc
Q psy9695          47 FRCTICQKA   55 (159)
Q Consensus        47 ~~c~~c~~~   55 (159)
                      +.|+.||..
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            456666543


No 258
>PRK01343 zinc-binding protein; Provisional
Probab=25.94  E-value=33  Score=17.88  Aligned_cols=12  Identities=33%  Similarity=0.517  Sum_probs=8.9

Q ss_pred             CccCCccccccc
Q psy9695         105 PFRCTICQKAFT  116 (159)
Q Consensus       105 ~~~C~~C~~~f~  116 (159)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            357888988764


No 259
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=25.65  E-value=22  Score=16.01  Aligned_cols=12  Identities=25%  Similarity=0.030  Sum_probs=9.1

Q ss_pred             ccccchhhchhh
Q psy9695         139 QQHIGAVEGKSF  150 (159)
Q Consensus       139 ~~~~C~~C~~~f  150 (159)
                      +.|+|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            688998888544


No 260
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=25.53  E-value=69  Score=15.07  Aligned_cols=23  Identities=13%  Similarity=0.312  Sum_probs=17.8

Q ss_pred             CCCcccCcccccccCChHHHHHH
Q psy9695          15 GMPKHLCHVCHKNFSSSSALQIH   37 (159)
Q Consensus        15 ~~~~~~C~~C~~~f~~~~~~~~h   37 (159)
                      +-.-..|+.|+..|-...++..-
T Consensus        16 ~~~id~C~~C~G~W~d~~el~~~   38 (41)
T PF13453_consen   16 DVEIDVCPSCGGIWFDAGELEKL   38 (41)
T ss_pred             CEEEEECCCCCeEEccHHHHHHH
Confidence            34457899999999888887753


No 261
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=25.31  E-value=15  Score=26.11  Aligned_cols=77  Identities=17%  Similarity=0.351  Sum_probs=30.1

Q ss_pred             cccCcccccccCChHHHHHHHHhhcCCCccccccccccccCccccccccccccccCCCCCccCcccccccCChHHHHHHH
Q psy9695          18 KHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNFSSSSALQIHM   97 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~   97 (159)
                      .-.|+.||..- ..+.+..--.  .|.+...|..|+..+...                 ...|+.||..-...-.... .
T Consensus       172 ~g~CPvCGs~P-~~s~l~~~~~--~G~R~L~Cs~C~t~W~~~-----------------R~~Cp~Cg~~~~~~l~~~~-~  230 (290)
T PF04216_consen  172 RGYCPVCGSPP-VLSVLRGGER--EGKRYLHCSLCGTEWRFV-----------------RIKCPYCGNTDHEKLEYFT-V  230 (290)
T ss_dssp             -SS-TTT---E-EEEEEE--------EEEEEETTT--EEE-------------------TTS-TTT---SS-EEE-----
T ss_pred             CCcCCCCCCcC-ceEEEecCCC--CccEEEEcCCCCCeeeec-----------------CCCCcCCCCCCCcceeeEe-c
Confidence            35899999642 2222111111  255678899998777332                 2569999875433221110 1


Q ss_pred             HHccCCCCccCCcccccc
Q psy9695          98 RTHTGDKPFRCTICQKAF  115 (159)
Q Consensus        98 ~~h~~~~~~~C~~C~~~f  115 (159)
                      ....+.+.+.|..|+.-.
T Consensus       231 e~~~~~rve~C~~C~~Yl  248 (290)
T PF04216_consen  231 EGEPAYRVEVCESCGSYL  248 (290)
T ss_dssp             ----SEEEEEETTTTEEE
T ss_pred             CCCCcEEEEECCcccchH
Confidence            122245567888888443


No 262
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=25.09  E-value=59  Score=17.99  Aligned_cols=42  Identities=19%  Similarity=0.048  Sum_probs=20.1

Q ss_pred             CCCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhc
Q psy9695         102 GDKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEG  147 (159)
Q Consensus       102 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~  147 (159)
                      ..+.--|..|+-.+....+......+..    .......+.|..||
T Consensus        43 ~~kr~~Ck~C~~~liPG~~~~vri~~~~----~~~~~l~~~C~~C~   84 (85)
T PF04032_consen   43 EIKRTICKKCGSLLIPGVNCSVRIRKKK----KKKNFLVYTCLNCG   84 (85)
T ss_dssp             TCCCTB-TTT--B--CTTTEEEEEE-------SSS-EEEEEETTTT
T ss_pred             HHhcccccCCCCEEeCCCccEEEEEecC----CCCCEEEEEccccC
Confidence            3445568888887777766665552111    11122678888886


No 263
>KOG3507|consensus
Probab=24.93  E-value=41  Score=17.63  Aligned_cols=10  Identities=30%  Similarity=0.677  Sum_probs=5.3

Q ss_pred             CccCCccccc
Q psy9695         105 PFRCTICQKA  114 (159)
Q Consensus       105 ~~~C~~C~~~  114 (159)
                      ..+|..||..
T Consensus        37 ~irCReCG~R   46 (62)
T KOG3507|consen   37 VIRCRECGYR   46 (62)
T ss_pred             cEehhhcchH
Confidence            3556666543


No 264
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=24.62  E-value=40  Score=21.06  Aligned_cols=26  Identities=38%  Similarity=0.558  Sum_probs=20.0

Q ss_pred             CccCcccccccCChHHHHHHHHHccCCCC
Q psy9695          77 KHLCHVCHKNFSSSSALQIHMRTHTGDKP  105 (159)
Q Consensus        77 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~  105 (159)
                      ...|.++|+.|.+   |.+|..+|.+--|
T Consensus        76 ~IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          76 YIICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             eEEEeccCcchHH---HHHHHhcccCCCH
Confidence            3679999988854   7889998887544


No 265
>KOG0402|consensus
Probab=24.60  E-value=28  Score=19.67  Aligned_cols=29  Identities=21%  Similarity=0.553  Sum_probs=16.1

Q ss_pred             ccccccccccccCccccccccccccccCCCCCccCccccccc
Q psy9695          46 PFRCTICQKAFTTKGNLKLIPNAVFNVAGMPKHLCHVCHKNF   87 (159)
Q Consensus        46 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~~~~C~~C~~~~   87 (159)
                      .|.|+.||+.-.-...             ...|.|..|.+.+
T Consensus        36 ky~CsfCGK~~vKR~A-------------vGiW~C~~C~kv~   64 (92)
T KOG0402|consen   36 KYTCSFCGKKTVKRKA-------------VGIWKCGSCKKVV   64 (92)
T ss_pred             hhhhhhcchhhhhhhc-------------eeEEecCCcccee
Confidence            4778887754422211             1236777776654


No 266
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=24.10  E-value=23  Score=18.52  Aligned_cols=12  Identities=17%  Similarity=0.100  Sum_probs=8.0

Q ss_pred             ccccchhhchhhh
Q psy9695         139 QQHIGAVEGKSFQ  151 (159)
Q Consensus       139 ~~~~C~~C~~~f~  151 (159)
                      -.|.|+ ||.+|.
T Consensus        21 ftyPCP-CGDRFe   32 (67)
T COG5216          21 FTYPCP-CGDRFE   32 (67)
T ss_pred             EEecCC-CCCEeE
Confidence            456777 777764


No 267
>KOG3352|consensus
Probab=24.00  E-value=19  Score=22.84  Aligned_cols=14  Identities=14%  Similarity=0.157  Sum_probs=10.4

Q ss_pred             ccccchhhchhhhh
Q psy9695         139 QQHIGAVEGKSFQA  152 (159)
Q Consensus       139 ~~~~C~~C~~~f~~  152 (159)
                      ..++|+.||..|+-
T Consensus       132 e~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  132 ETQRCPECGHYFKL  145 (153)
T ss_pred             CcccCCcccceEEe
Confidence            46778888888763


No 268
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=23.99  E-value=33  Score=20.37  Aligned_cols=25  Identities=28%  Similarity=0.587  Sum_probs=20.7

Q ss_pred             CCCccCcccccccCChHHHHHHHHH
Q psy9695          75 MPKHLCHVCHKNFSSSSALQIHMRT   99 (159)
Q Consensus        75 ~~~~~C~~C~~~~~~~~~l~~H~~~   99 (159)
                      ...+-|.+|.+.|.+...|..|.+.
T Consensus        53 lGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          53 LGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CceeeeehhHHHHHHHHHHHHHhcc
Confidence            3347799999999999999998773


No 269
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=23.97  E-value=59  Score=25.02  Aligned_cols=29  Identities=28%  Similarity=0.523  Sum_probs=23.8

Q ss_pred             CCCCccCcccccccCChHHHHHHHHH-ccC
Q psy9695          74 GMPKHLCHVCHKNFSSSSALQIHMRT-HTG  102 (159)
Q Consensus        74 ~~~~~~C~~C~~~~~~~~~l~~H~~~-h~~  102 (159)
                      ..+-|.|+.|.+.|.....+..|+.. |.+
T Consensus        54 sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   54 SWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             ceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            34568999999999999999999885 443


No 270
>PRK12860 transcriptional activator FlhC; Provisional
Probab=23.89  E-value=44  Score=22.25  Aligned_cols=11  Identities=36%  Similarity=0.818  Sum_probs=6.6

Q ss_pred             ccCCccccccc
Q psy9695         106 FRCTICQKAFT  116 (159)
Q Consensus       106 ~~C~~C~~~f~  116 (159)
                      ..|..||-.|.
T Consensus       135 ~~C~~Cgg~fv  145 (189)
T PRK12860        135 ARCCRCGGKFV  145 (189)
T ss_pred             ccCCCCCCCee
Confidence            45666665555


No 271
>KOG2857|consensus
Probab=23.80  E-value=34  Score=21.53  Aligned_cols=21  Identities=14%  Similarity=0.599  Sum_probs=17.0

Q ss_pred             CccCCcccccccccCCceeee
Q psy9695         105 PFRCTICQKAFTTKGNLKVRE  125 (159)
Q Consensus       105 ~~~C~~C~~~f~~~~~l~~H~  125 (159)
                      .|+|+.|...|-+-.-++.|+
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk   37 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHK   37 (157)
T ss_pred             hccCCCCCCccccchhhhhcc
Confidence            488888888888888888787


No 272
>PF14279 HNH_5:  HNH endonuclease
Probab=23.72  E-value=71  Score=17.42  Aligned_cols=10  Identities=10%  Similarity=0.116  Sum_probs=5.2

Q ss_pred             cchhhchhhh
Q psy9695         142 IGAVEGKSFQ  151 (159)
Q Consensus       142 ~C~~C~~~f~  151 (159)
                      .|+.|...|-
T Consensus        32 vC~~CN~~~g   41 (71)
T PF14279_consen   32 VCDKCNNKFG   41 (71)
T ss_pred             hhHHHhHHHh
Confidence            5555555443


No 273
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=23.58  E-value=34  Score=15.52  Aligned_cols=9  Identities=22%  Similarity=0.840  Sum_probs=4.1

Q ss_pred             ccCcccccc
Q psy9695          78 HLCHVCHKN   86 (159)
Q Consensus        78 ~~C~~C~~~   86 (159)
                      +.|..|+.+
T Consensus        22 ~~C~~Cg~~   30 (33)
T PF08792_consen   22 EVCIFCGSS   30 (33)
T ss_pred             EEcccCCcE
Confidence            444444443


No 274
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=23.54  E-value=74  Score=21.31  Aligned_cols=38  Identities=13%  Similarity=0.291  Sum_probs=21.6

Q ss_pred             CcccCcccccccCChHHHHHHHHhhcCCCccccccccccccC
Q psy9695          17 PKHLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKAFTT   58 (159)
Q Consensus        17 ~~~~C~~C~~~f~~~~~~~~h~~~~~~~~~~~c~~c~~~~~~   58 (159)
                      ..+.|+.|+.    ...+..=++.-..+....|..||.-++.
T Consensus         5 iy~~Cp~Cg~----eev~hEVik~~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           5 IYIECPSCGS----EEVSHEVIKERGREPLVRCEECGTVHPA   42 (201)
T ss_pred             EEEECCCCCc----chhhHHHHHhcCCceEEEccCCCcEeec
Confidence            3478999982    1111111233344456899999977744


No 275
>PTZ00448 hypothetical protein; Provisional
Probab=23.09  E-value=63  Score=23.98  Aligned_cols=23  Identities=26%  Similarity=0.583  Sum_probs=19.9

Q ss_pred             cccCcccccccCChHHHHHHHHh
Q psy9695          18 KHLCHVCHKNFSSSSALQIHMRT   40 (159)
Q Consensus        18 ~~~C~~C~~~f~~~~~~~~h~~~   40 (159)
                      .|.|..|+..|.+......|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999888888888864


No 276
>PRK11823 DNA repair protein RadA; Provisional
Probab=22.96  E-value=50  Score=25.18  Aligned_cols=11  Identities=18%  Similarity=0.591  Sum_probs=6.6

Q ss_pred             ccccccccccc
Q psy9695          46 PFRCTICQKAF   56 (159)
Q Consensus        46 ~~~c~~c~~~~   56 (159)
                      .|.|..||..+
T Consensus         7 ~y~C~~Cg~~~   17 (446)
T PRK11823          7 AYVCQECGAES   17 (446)
T ss_pred             eEECCcCCCCC
Confidence            46777776443


No 277
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.88  E-value=42  Score=23.95  Aligned_cols=7  Identities=43%  Similarity=1.397  Sum_probs=2.8

Q ss_pred             ccCCccc
Q psy9695         106 FRCTICQ  112 (159)
Q Consensus       106 ~~C~~C~  112 (159)
                      |.|+.||
T Consensus       323 ~~C~~cg  329 (364)
T COG0675         323 FKCPRCG  329 (364)
T ss_pred             EECCCCC
Confidence            3344443


No 278
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=22.75  E-value=36  Score=20.47  Aligned_cols=33  Identities=12%  Similarity=0.165  Sum_probs=19.7

Q ss_pred             CCCccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchhhhhcc
Q psy9695         103 DKPFRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKSFQAKH  154 (159)
Q Consensus       103 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f~~~~  154 (159)
                      .....||.|++..            .--|       +...|.+|+....-..
T Consensus        67 av~V~CP~C~K~T------------KmLG-------r~D~CM~C~~pLTLd~   99 (114)
T PF11023_consen   67 AVQVECPNCGKQT------------KMLG-------RVDACMHCKEPLTLDP   99 (114)
T ss_pred             ceeeECCCCCChH------------hhhc-------hhhccCcCCCcCccCc
Confidence            3456899998651            1122       3468888876654433


No 279
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=22.35  E-value=11  Score=20.26  Aligned_cols=34  Identities=18%  Similarity=0.404  Sum_probs=14.8

Q ss_pred             ccCcccccccCChHHHHHHHHHccCCCCccCCccccc
Q psy9695          78 HLCHVCHKNFSSSSALQIHMRTHTGDKPFRCTICQKA  114 (159)
Q Consensus        78 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  114 (159)
                      |+|..|+......  +.. ..-+.|..--+|+-|...
T Consensus         5 FTC~~C~~Rs~~~--~sk-~aY~~GvViv~C~gC~~~   38 (66)
T PF05180_consen    5 FTCNKCGTRSAKM--FSK-QAYHKGVVIVQCPGCKNR   38 (66)
T ss_dssp             EEETTTTEEEEEE--EEH-HHHHTSEEEEE-TTS--E
T ss_pred             EEcCCCCCcccee--eCH-HHHhCCeEEEECCCCcce
Confidence            6777776432111  111 122445555677777754


No 280
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.29  E-value=32  Score=14.99  Aligned_cols=10  Identities=10%  Similarity=-0.031  Sum_probs=5.4

Q ss_pred             ccchhhchhh
Q psy9695         141 HIGAVEGKSF  150 (159)
Q Consensus       141 ~~C~~C~~~f  150 (159)
                      |.|++|++..
T Consensus         1 ~~C~~C~~~~   10 (30)
T PF03107_consen    1 FWCDVCRRKI   10 (30)
T ss_pred             CCCCCCCCCc
Confidence            4566665543


No 281
>KOG4118|consensus
Probab=22.16  E-value=69  Score=17.20  Aligned_cols=25  Identities=20%  Similarity=0.535  Sum_probs=17.5

Q ss_pred             ccCcccccccCChHHHHHHHHhhcC
Q psy9695          19 HLCHVCHKNFSSSSALQIHMRTHTG   43 (159)
Q Consensus        19 ~~C~~C~~~f~~~~~~~~h~~~~~~   43 (159)
                      |+|..|....+....+..|....+.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCC
Confidence            7788887777777777777655443


No 282
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=21.49  E-value=65  Score=18.58  Aligned_cols=21  Identities=14%  Similarity=0.488  Sum_probs=14.9

Q ss_pred             CCcccCcccccccCChHHHHH
Q psy9695          16 MPKHLCHVCHKNFSSSSALQI   36 (159)
Q Consensus        16 ~~~~~C~~C~~~f~~~~~~~~   36 (159)
                      -+-..|+.||..|-+...+..
T Consensus        33 VPa~~C~~CGe~y~~dev~~e   53 (89)
T TIGR03829        33 TPSISCSHCGMEYQDDTTVKE   53 (89)
T ss_pred             CCcccccCCCcEeecHHHHHH
Confidence            344789999988877766554


No 283
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.30  E-value=30  Score=22.79  Aligned_cols=8  Identities=38%  Similarity=1.244  Sum_probs=4.3

Q ss_pred             ccCCcccc
Q psy9695         106 FRCTICQK  113 (159)
Q Consensus       106 ~~C~~C~~  113 (159)
                      |+|..|+.
T Consensus        50 YkC~~Cd~   57 (203)
T COG4332          50 YKCTHCDY   57 (203)
T ss_pred             EEeeccCC
Confidence            55555553


No 284
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=21.19  E-value=48  Score=23.26  Aligned_cols=30  Identities=13%  Similarity=0.038  Sum_probs=19.9

Q ss_pred             ccCCcccccccccCCceeeehhhccCCCCCcccccccchhhchh
Q psy9695         106 FRCTICQKAFTTKGNLKVREIEINIGSQLPKKAQQHIGAVEGKS  149 (159)
Q Consensus       106 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~  149 (159)
                      -.||.||+.-.-...|.       .-       --|+|+.|...
T Consensus       221 r~CP~Cg~~W~L~~plh-------~i-------FdFKCD~CRLV  250 (258)
T PF10071_consen  221 RKCPSCGGDWRLKEPLH-------DI-------FDFKCDPCRLV  250 (258)
T ss_pred             CCCCCCCCccccCCchh-------hc-------eeccCCcceee
Confidence            47999997655555552       21       46999999754


No 285
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=20.97  E-value=49  Score=15.87  Aligned_cols=11  Identities=36%  Similarity=0.788  Sum_probs=8.1

Q ss_pred             CccCCcccccc
Q psy9695         105 PFRCTICQKAF  115 (159)
Q Consensus       105 ~~~C~~C~~~f  115 (159)
                      |..|+.||..-
T Consensus         2 ~~~Cp~Cg~~~   12 (47)
T PF14690_consen    2 PPRCPHCGSPS   12 (47)
T ss_pred             CccCCCcCCCc
Confidence            56899999443


No 286
>PRK11295 hypothetical protein; Provisional
Probab=20.73  E-value=45  Score=20.16  Aligned_cols=47  Identities=9%  Similarity=-0.004  Sum_probs=23.6

Q ss_pred             CCccCCcccccccccC---CceeeehhhccCCCCCcccccccchhhchhh
Q psy9695         104 KPFRCTICQKAFTTKG---NLKVREIEINIGSQLPKKAQQHIGAVEGKSF  150 (159)
Q Consensus       104 ~~~~C~~C~~~f~~~~---~l~~H~~~~h~~~~~~~~~~~~~C~~C~~~f  150 (159)
                      .||.|..|+..|....   ....|+.-.+.+......+-...|..|...-
T Consensus        23 ~p~lC~~Cgr~~~~a~~~a~vVDHIip~~~gd~~D~sNLQ~LC~~CHn~k   72 (113)
T PRK11295         23 YPWVCGRCSREFVYSNLRELTVHHIDHDHDNNPEDGSNWELLCLYCHDHE   72 (113)
T ss_pred             CcchhhhhcChhccCCCCCceeeccCCCCCCCCCchhHHHHHhHHHHhHH
Confidence            3567777777643222   2333442223233333455666777776554


No 287
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.65  E-value=72  Score=22.71  Aligned_cols=13  Identities=23%  Similarity=0.743  Sum_probs=8.3

Q ss_pred             CCccCCccccccc
Q psy9695         104 KPFRCTICQKAFT  116 (159)
Q Consensus       104 ~~~~C~~C~~~f~  116 (159)
                      ..|.|++|.-.|.
T Consensus       254 ~GyvCs~Clsi~C  266 (279)
T TIGR00627       254 IGFVCSVCLSVLC  266 (279)
T ss_pred             ceEECCCccCCcC
Confidence            3477777776554


No 288
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=20.30  E-value=49  Score=18.85  Aligned_cols=12  Identities=25%  Similarity=0.780  Sum_probs=7.7

Q ss_pred             cCCccccccccc
Q psy9695         107 RCTICQKAFTTK  118 (159)
Q Consensus       107 ~C~~C~~~f~~~  118 (159)
                      +|+.||..|...
T Consensus        10 ~C~~CG~d~~~~   21 (86)
T PF06170_consen   10 RCPHCGLDYSHA   21 (86)
T ss_pred             cccccCCccccC
Confidence            577777666543


Done!