Query         psy9699
Match_columns 123
No_of_seqs    105 out of 199
Neff          6.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:20:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9699.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9699hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06703 SPC25:  Microsomal sig 100.0 2.5E-38 5.3E-43  230.8  13.0  115    2-116    43-162 (162)
  2 KOG4072|consensus              100.0   8E-34 1.7E-38  195.9   2.6  120    4-123     2-127 (127)
  3 PF15000 TUSC2:  Tumour suppres  60.0     4.4 9.6E-05   28.0   0.9   23   85-107    46-68  (111)
  4 PF11322 DUF3124:  Protein of u  47.9      16 0.00034   25.9   2.1   21   86-106    40-60  (125)
  5 KOG0744|consensus               44.7     8.3 0.00018   32.1   0.3   29   84-113   217-245 (423)
  6 cd04752 Commd4 COMM_Domain con  43.8      65  0.0014   23.5   5.0   39   55-93    117-157 (174)
  7 PF00036 EF-hand_1:  EF hand;    41.5      27 0.00058   18.0   1.9   18   95-112    12-29  (29)
  8 PF07599 DUF1563:  Protein of u  41.0      39 0.00085   19.1   2.6   20   21-40      4-23  (43)
  9 TIGR01601 PYST-C1 Plasmodium y  40.1      15 0.00033   24.0   0.9   17   15-31      4-20  (82)
 10 PF01473 CW_binding_1:  Putativ  37.4      19 0.00041   16.6   0.8    8   93-100    12-19  (19)
 11 PF01708 Gemini_mov:  Geminivir  32.2      39 0.00085   22.6   2.0   29   21-50     41-70  (91)
 12 PF14770 TMEM18:  Transmembrane  31.2      27 0.00058   24.5   1.1   14   92-105    73-86  (123)
 13 PF13405 EF-hand_6:  EF-hand do  31.1      48   0.001   16.7   1.9   17   95-111    12-28  (31)
 14 cd03144 GATase1_ScBLP_like Typ  30.6     7.4 0.00016   26.9  -1.8   26   13-48     76-101 (114)
 15 PF08363 GbpC:  Glucan-binding   29.6      40 0.00086   26.9   2.0   38   63-101   135-172 (283)
 16 COG0765 HisM ABC-type amino ac  29.6      69  0.0015   24.6   3.2   26   17-42    192-217 (222)
 17 PF13127 DUF3955:  Protein of u  29.2      29 0.00062   21.5   0.9   14   90-103    24-37  (63)
 18 PF03729 DUF308:  Short repeat   28.0   1E+02  0.0022   18.0   3.3   26   16-41     22-47  (72)
 19 TIGR03567 FMN_reduc_SsuE FMN r  27.2      65  0.0014   23.0   2.6   26   92-117   143-169 (171)
 20 PRK15069 histidine/lysine/argi  26.8      80  0.0017   24.0   3.2   26   17-42    202-227 (234)
 21 PHA02132 hypothetical protein   26.8      56  0.0012   21.1   1.9   26   11-36      8-33  (86)
 22 PF05042 Caleosin:  Caleosin re  26.5      48   0.001   24.7   1.8   41   63-112    64-105 (174)
 23 PF13590 DUF4136:  Domain of un  26.4 2.1E+02  0.0046   19.3   5.3   46   67-116   103-148 (151)
 24 PF06196 DUF997:  Protein of un  26.0 1.5E+02  0.0032   19.1   3.9   34    8-43     39-72  (80)
 25 smart00054 EFh EF-hand, calciu  25.6      60  0.0013   14.4   1.6   17   95-111    12-28  (29)
 26 PF13202 EF-hand_5:  EF hand; P  25.3      74  0.0016   15.6   1.9   14   95-108    11-24  (25)
 27 TIGR02690 resist_ArsH arsenica  25.2      72  0.0016   24.4   2.7   24   94-117   174-197 (219)
 28 PF09926 DUF2158:  Uncharacteri  24.4      27 0.00058   20.9   0.1   18   90-108    33-50  (53)
 29 TIGR03249 KdgD 5-dehydro-4-deo  22.9      71  0.0015   25.0   2.3   25   90-114    13-37  (296)
 30 PRK15100 amino acid ABC transp  22.7   1E+02  0.0023   22.8   3.1   28   15-42    186-213 (220)
 31 COG3215 PilZ Tfp pilus assembl  22.7 1.6E+02  0.0035   20.4   3.7   83   29-113    20-108 (117)
 32 CHL00005 rps16 ribosomal prote  22.4 2.3E+02   0.005   18.4   4.4   52   54-111     4-59  (82)
 33 PF11295 DUF3096:  Protein of u  21.8 1.3E+02  0.0029   16.9   2.6   20   17-36     17-36  (39)
 34 PF11396 DUF2874:  Protein of u  21.5 1.4E+02  0.0031   17.2   3.0   24   65-100    37-60  (61)
 35 TIGR03592 yidC_oxa1_cterm memb  21.2 1.1E+02  0.0025   22.2   3.0   20   20-39    159-178 (181)
 36 TIGR02313 HpaI-NOT-DapA 2,4-di  20.6      84  0.0018   24.7   2.3   25   90-114     8-32  (294)
 37 PF07981 Plasmod_MYXSPDY:  Plas  20.5      82  0.0018   14.5   1.3   11   63-73      3-13  (17)
 38 PF07661 MORN_2:  MORN repeat v  20.3      42  0.0009   15.3   0.3   12   92-103     6-17  (22)

No 1  
>PF06703 SPC25:  Microsomal signal peptidase 25 kDa subunit (SPC25);  InterPro: IPR009582 This family consists of several microsomal signal peptidase 25 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains [].; GO: 0008233 peptidase activity, 0006465 signal peptide processing, 0005787 signal peptidase complex, 0016021 integral to membrane
Probab=100.00  E-value=2.5e-38  Score=230.82  Aligned_cols=115  Identities=38%  Similarity=0.633  Sum_probs=109.3

Q ss_pred             eeecccccCCCCchhhhhhHHHHHHHHHHHHHHHHhhhhcCeEEEEE-e----CCcEEEEEeecCCCCceeEEEEEEEeC
Q psy9699           2 WYLPRNFTPVKRFEPVLIMCVTTYFLMMGILTLYTTYKEKGIFAVAK-K----DHIVWEASSYLKKYDDMYNLVLQYKDT   76 (123)
Q Consensus         2 ~f~~dy~~~f~~sk~~l~~~V~~YfiLsgilt~~~~~vEK~~~yvg~-k----~~~~i~isS~~~k~~p~Y~l~l~~~~~   76 (123)
                      +|+|||++|||+|++++++||++||+|||+||+|++|+|||++|+|. +    ++++|+|+|+++||+|+|+|++++.++
T Consensus        43 a~~~d~~~~f~~s~~~~~~~v~~YfiLs~il~~~~~~~ek~~~~~g~~~~~~~~~~~i~i~s~~~k~~p~Y~l~i~~~~~  122 (162)
T PF06703_consen   43 AFFYDYKYPFPESKPYLIICVILYFILSGILTLYSYFVEKDIFYVGKRKDGSSSGEKITISSSMPKYDPIYTLTITYRDG  122 (162)
T ss_pred             HHHhhhcCCCCccHHHHHHHHHHHHHHHHHHHHHHHHhcCCEEEEEeccCCCCCCCEEEEEEEccCCCCeEEEEEEEEcC
Confidence            58999999999999999999999999999999999999999999999 6    589999999999999999999999988


Q ss_pred             CCCeeeeEEEeeeccceeccCceechHhHHHHHHHHHHHH
Q psy9699          77 KTGVTRSEQFNKSVANYFDETGLLLPDLVENDVSRLHNSI  116 (123)
Q Consensus        77 ~~~~~~~~~~~~~v~~~Fd~~G~l~~~~f~~~l~~l~~~l  116 (123)
                      +++..++.+.++|+++|||+||+|++++|++|++++++++
T Consensus       123 ~~~~~~~~~~~~~v~~~Fde~G~l~~~~~~~~l~~ll~~~  162 (162)
T PF06703_consen  123 KSKSSKEVSVSKSVGKFFDEDGYLVEDLFENWLEKLLEKF  162 (162)
T ss_pred             CCCccceEEEEEehhhEECCCCEEeHHHHHHHHHHHHhcC
Confidence            7666677999999999999999999999999999999864


No 2  
>KOG4072|consensus
Probab=99.98  E-value=8e-34  Score=195.86  Aligned_cols=120  Identities=47%  Similarity=0.786  Sum_probs=116.2

Q ss_pred             ecccccCCCCchhhhhhHHHHHHHHHHHHHHHHhhhhcCeEEEEE-eC-----CcEEEEEeecCCCCceeEEEEEEEeCC
Q psy9699           4 LPRNFTPVKRFEPVLIMCVTTYFLMMGILTLYTTYKEKGIFAVAK-KD-----HIVWEASSYLKKYDDMYNLVLQYKDTK   77 (123)
Q Consensus         4 ~~dy~~~f~~sk~~l~~~V~~YfiLsgilt~~~~~vEK~~~yvg~-k~-----~~~i~isS~~~k~~p~Y~l~l~~~~~~   77 (123)
                      .|||..|||+|+++++.||.+||+++|+|+++++|+|||+++++. ++     ...|..||++++||+.|++++++.+++
T Consensus         2 ~~D~~~pfP~sk~vla~~v~syf~~mGil~~~~s~vek~i~~~a~q~d~~~~~~r~W~~ss~~ka~dDky~l~l~f~~gr   81 (127)
T KOG4072|consen    2 TADSRHPFPESKPVLAPCVWSYFQMMGILTIYTSYVEKSIFLVAHQKDPGMDPDRIWQLSSSLKAFDDKYTLKLTFISGR   81 (127)
T ss_pred             CccccCcCCCCcceeeeHHHHHHHHHhHHHHHHHHhcccceehhhhhccCCCCCcccccchhhhhccCcceeEEEEEecc
Confidence            589999999999999999999999999999999999999999998 66     688999999999999999999999999


Q ss_pred             CCeeeeEEEeeeccceeccCceechHhHHHHHHHHHHHHhhhhccC
Q psy9699          78 TGVTRSEQFNKSVANYFDETGLLLPDLVENDVSRLHNSILAEKKKE  123 (123)
Q Consensus        78 ~~~~~~~~~~~~v~~~Fd~~G~l~~~~f~~~l~~l~~~l~~~kk~~  123 (123)
                      +|++|+.++++++++|||.+|.+..++..++++.++++|.+++|++
T Consensus        82 ~gq~reak~tKsiakffDh~Gtl~~plv~~ev~~l~daLa~~~ki~  127 (127)
T KOG4072|consen   82 TGQQREAKFTKSIAKFFDHSGTLVMPLVEPEVSRLHDALASERKIK  127 (127)
T ss_pred             cchhhhhHHHHHHHHHccCCCeEeccCCccccchHHHHHHHHhccC
Confidence            9999999999999999999999999999999999999999999875


No 3  
>PF15000 TUSC2:  Tumour suppressor candidate 2
Probab=60.04  E-value=4.4  Score=28.04  Aligned_cols=23  Identities=35%  Similarity=0.608  Sum_probs=18.4

Q ss_pred             EEeeeccceeccCceechHhHHH
Q psy9699          85 QFNKSVANYFDETGLLLPDLVEN  107 (123)
Q Consensus        85 ~~~~~v~~~Fd~~G~l~~~~f~~  107 (123)
                      -.+..=+.||||||-|..+-+++
T Consensus        46 V~tr~sS~y~DeDGdlAhEFYeE   68 (111)
T PF15000_consen   46 VFTRRSSMYFDEDGDLAHEFYEE   68 (111)
T ss_pred             EEecCCceeEcCCcchhhhhhhh
Confidence            44455577999999999998877


No 4  
>PF11322 DUF3124:  Protein of unknown function (DUF3124);  InterPro: IPR021471  This bacterial family of proteins has no known function. 
Probab=47.89  E-value=16  Score=25.91  Aligned_cols=21  Identities=19%  Similarity=0.512  Sum_probs=15.2

Q ss_pred             EeeeccceeccCceechHhHH
Q psy9699          86 FNKSVANYFDETGLLLPDLVE  106 (123)
Q Consensus        86 ~~~~v~~~Fd~~G~l~~~~f~  106 (123)
                      +...=.+|||.+|.|...-+.
T Consensus        40 i~i~~v~Yydt~G~lvr~yl~   60 (125)
T PF11322_consen   40 IYITSVDYYDTDGKLVRSYLD   60 (125)
T ss_pred             EEEEEEEEECCCCeEhHHhcC
Confidence            333347899999999877654


No 5  
>KOG0744|consensus
Probab=44.71  E-value=8.3  Score=32.10  Aligned_cols=29  Identities=17%  Similarity=0.407  Sum_probs=20.9

Q ss_pred             EEEeeeccceeccCceechHhHHHHHHHHH
Q psy9699          84 EQFNKSVANYFDETGLLLPDLVENDVSRLH  113 (123)
Q Consensus        84 ~~~~~~v~~~Fd~~G~l~~~~f~~~l~~l~  113 (123)
                      .....=|++||.|.|.++...|++ +.+++
T Consensus       217 inshsLFSKWFsESgKlV~kmF~k-I~ELv  245 (423)
T KOG0744|consen  217 INSHSLFSKWFSESGKLVAKMFQK-IQELV  245 (423)
T ss_pred             EehhHHHHHHHhhhhhHHHHHHHH-HHHHH
Confidence            344456899999999999988754 44443


No 6  
>cd04752 Commd4 COMM_Domain containing protein 4. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=43.76  E-value=65  Score=23.51  Aligned_cols=39  Identities=21%  Similarity=0.273  Sum_probs=26.4

Q ss_pred             EEEeec--CCCCceeEEEEEEEeCCCCeeeeEEEeeeccce
Q psy9699          55 EASSYL--KKYDDMYNLVLQYKDTKTGVTRSEQFNKSVANY   93 (123)
Q Consensus        55 ~isS~~--~k~~p~Y~l~l~~~~~~~~~~~~~~~~~~v~~~   93 (123)
                      .++|+.  +-..|.+++.+...++.+|...+..++-+..++
T Consensus       117 ~lsSs~l~~~~~P~~~l~L~v~~~~~~~~~~v~~e~s~~ql  157 (174)
T cd04752         117 ILSSSELQEVNEPLVQLRLKVRNADTGEITPHPFSVSADKF  157 (174)
T ss_pred             EEcchhhhhcCCCeEEEEEeeecCCCCCcceEEEEecHHHH
Confidence            445542  348999999999987766655566666655553


No 7  
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=41.47  E-value=27  Score=17.97  Aligned_cols=18  Identities=17%  Similarity=0.204  Sum_probs=14.0

Q ss_pred             ccCceechHhHHHHHHHH
Q psy9699          95 DETGLLLPDLVENDVSRL  112 (123)
Q Consensus        95 d~~G~l~~~~f~~~l~~l  112 (123)
                      |-||++..+.|...+.+|
T Consensus        12 d~dG~I~~~Ef~~~~~~L   29 (29)
T PF00036_consen   12 DGDGKIDFEEFKEMMKKL   29 (29)
T ss_dssp             TSSSEEEHHHHHHHHHHT
T ss_pred             CCCCcCCHHHHHHHHHhC
Confidence            457999999988877653


No 8  
>PF07599 DUF1563:  Protein of unknown function (DUF1563);  InterPro: IPR011457 This is a small family of short hypothetical proteins in Leptospira interrogans.
Probab=40.97  E-value=39  Score=19.11  Aligned_cols=20  Identities=35%  Similarity=0.665  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHhhhh
Q psy9699          21 CVTTYFLMMGILTLYTTYKE   40 (123)
Q Consensus        21 ~V~~YfiLsgilt~~~~~vE   40 (123)
                      ..+-+|+|-++=.+|++|+|
T Consensus         4 iL~~FFLL~TLeNlYatyve   23 (43)
T PF07599_consen    4 ILIGFFLLETLENLYATYVE   23 (43)
T ss_pred             hhhHHHHHHHHHHHHHHHHH
Confidence            34568899999999999998


No 9  
>TIGR01601 PYST-C1 Plasmodium yoelii subtelomeric domain PYST-C1. The C-terminal portions of the genes which contain this domain are divergent and some contain other yoelii-specific paralogous domains such as PYST-C2 (TIGR01604).
Probab=40.06  E-value=15  Score=24.02  Aligned_cols=17  Identities=18%  Similarity=0.458  Sum_probs=13.0

Q ss_pred             hhhhhhHHHHHHHHHHH
Q psy9699          15 EPVLIMCVTTYFLMMGI   31 (123)
Q Consensus        15 k~~l~~~V~~YfiLsgi   31 (123)
                      +.+-++|+++|.+|..-
T Consensus         4 rIfslVcivlY~ll~v~   20 (82)
T TIGR01601         4 RIFSLVCIVLYILLAVS   20 (82)
T ss_pred             eEeehhHHHHHHHHhee
Confidence            44668999999988654


No 10 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=37.43  E-value=19  Score=16.56  Aligned_cols=8  Identities=50%  Similarity=1.211  Sum_probs=5.5

Q ss_pred             eeccCcee
Q psy9699          93 YFDETGLL  100 (123)
Q Consensus        93 ~Fd~~G~l  100 (123)
                      +|+++|.+
T Consensus        12 y~~~~G~m   19 (19)
T PF01473_consen   12 YFDSDGYM   19 (19)
T ss_dssp             EETTTSBB
T ss_pred             EeCCCccC
Confidence            67777764


No 11 
>PF01708 Gemini_mov:  Geminivirus putative movement protein ;  InterPro: IPR002621 This family consists of putative movement proteins from Maize streak virus and Wheat dwarf virus [].; GO: 0046740 spread of virus in host, cell to cell, 0016021 integral to membrane
Probab=32.20  E-value=39  Score=22.59  Aligned_cols=29  Identities=24%  Similarity=0.268  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHhhhhcCeEEEEE-eC
Q psy9699          21 CVTTYFLMMGILTLYTTYKEKGIFAVAK-KD   50 (123)
Q Consensus        21 ~V~~YfiLsgilt~~~~~vEK~~~yvg~-k~   50 (123)
                      ++++.+.+-.++-+|+|+. ||+|++=+ |.
T Consensus        41 ~i~~lvaVg~~YL~y~~fL-kDlIlv~KAkr   70 (91)
T PF01708_consen   41 AIFTLVAVGCLYLAYTWFL-KDLILVLKAKR   70 (91)
T ss_pred             eehHHHHHHHHHHHHHHHH-HHHhheeeecc
Confidence            4444555555556677766 88898876 44


No 12 
>PF14770 TMEM18:  Transmembrane protein 18
Probab=31.24  E-value=27  Score=24.50  Aligned_cols=14  Identities=36%  Similarity=0.895  Sum_probs=11.4

Q ss_pred             ceeccCceechHhH
Q psy9699          92 NYFDETGLLLPDLV  105 (123)
Q Consensus        92 ~~Fd~~G~l~~~~f  105 (123)
                      +|||++|.|..-.+
T Consensus        73 nYFDs~G~Fisvv~   86 (123)
T PF14770_consen   73 NYFDSSGVFISVVF   86 (123)
T ss_pred             cCcCCCCeeehHHH
Confidence            79999999876554


No 13 
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=31.13  E-value=48  Score=16.71  Aligned_cols=17  Identities=12%  Similarity=0.194  Sum_probs=13.8

Q ss_pred             ccCceechHhHHHHHHH
Q psy9699          95 DETGLLLPDLVENDVSR  111 (123)
Q Consensus        95 d~~G~l~~~~f~~~l~~  111 (123)
                      |.+|++..+.|.+.+++
T Consensus        12 d~dG~I~~~el~~~l~~   28 (31)
T PF13405_consen   12 DGDGFIDFEELRAILRK   28 (31)
T ss_dssp             TSSSEEEHHHHHHHHHH
T ss_pred             CCCCcCcHHHHHHHHHH
Confidence            45799999999988874


No 14 
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP). Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP). Biotin-apoprotein ligase modifies proteins by covalently attaching biotin.  ScBLP is known to biotinylate acety-CoA carboxylase and pyruvate carboxylase.  The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, the Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in a typical GATase1 domain is conserved.
Probab=30.62  E-value=7.4  Score=26.93  Aligned_cols=26  Identities=19%  Similarity=0.236  Sum_probs=20.6

Q ss_pred             CchhhhhhHHHHHHHHHHHHHHHHhhhhcCeEEEEE
Q psy9699          13 RFEPVLIMCVTTYFLMMGILTLYTTYKEKGIFAVAK   48 (123)
Q Consensus        13 ~sk~~l~~~V~~YfiLsgilt~~~~~vEK~~~yvg~   48 (123)
                      +-++++.+|+++|+.          |.+.|..+.+.
T Consensus        76 ~g~p~LGIClGAy~a----------~~~~G~~~~~~  101 (114)
T cd03144          76 NGGNYLGICAGAYLA----------YFNGGPVFEGA  101 (114)
T ss_pred             CCCcEEEEecCccce----------EEcCCeeeccC
Confidence            457899999999999          66677777654


No 15 
>PF08363 GbpC:  Glucan-binding protein C;  InterPro: IPR013574 This domain is found in glucan-binding protein C (GbpC) and in the V-region of surface protein antigen; both these proteins belong to the Spa family of Streptococcal proteins []. This domain consists of a beta-supersandwich of 18 beta-strands in two sheets.  There are at least four types of glucan-binding proteins (Gbp) in Streptococcus mutans, GbpA, GbpB, GbpC and GbpD. These proteins promote the adhesion of Streptococcal bacteria to teeth and are associated with dental caries []. GbpC is a cell-wall anchoring protein that plays an important role in sucrose-dependent adhesion by binding to soluble glucan synthesised by glucosyltransferase D (GTFD) []. Spa antigens I/II are multi-functional proteins expressed at the cell wall surface of oral Streptococci, where they function as adhesins. Antigens I/II recognise a wide range of ligands. They exert an immunomodulatory effect on human cells and are important in inflammatory disorders, such as dental caries. These proteins can be divided into seven regions: signal peptide, N-terminal, A-region (alanine-rich), V-region (variable domain), P-region (proline-rich), C-terminal domain, and a cell wall anchor motif. The V-region is the central domain and exhibits the greatest variability in sequence, and is responsible for binding monocyte receptors, its binding stimulating the release of TNF-alpha from the monocytes. The crystal structure of the V-region revealed a lectin-like fold that displays a putative preformed carbohydrate-binding site stabilised by a metal ion [].; GO: 0005488 binding, 0009405 pathogenesis, 0044406 adhesion to host, 0009274 peptidoglycan-based cell wall; PDB: 1JMM_A 3IPK_A 3IOX_A 2WD6_B.
Probab=29.64  E-value=40  Score=26.91  Aligned_cols=38  Identities=18%  Similarity=0.271  Sum_probs=18.0

Q ss_pred             CCceeEEEEEEEeCCCCeeeeEEEeeeccceeccCceec
Q psy9699          63 YDDMYNLVLQYKDTKTGVTRSEQFNKSVANYFDETGLLL  101 (123)
Q Consensus        63 ~~p~Y~l~l~~~~~~~~~~~~~~~~~~v~~~Fd~~G~l~  101 (123)
                      .||.-++.+-...+..++....++... .+||||||.+.
T Consensus       135 ~DPT~ti~~~~~~~~~~~~~~~~v~v~-~~FYDedG~~i  172 (283)
T PF08363_consen  135 NDPTKTIFYGASTGDGGKDDSIKVNVD-VKFYDEDGKEI  172 (283)
T ss_dssp             SSGGG-EEEE-TTSSEBTT-EEEEEEE-EEEEETTS-BE
T ss_pred             CCCceEEEEEeecCCCCceeeeEEEeE-EEEECCCCCEE
Confidence            466655555433222221223344444 45999999864


No 16 
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism]
Probab=29.56  E-value=69  Score=24.63  Aligned_cols=26  Identities=19%  Similarity=0.352  Sum_probs=21.8

Q ss_pred             hhhhHHHHHHHHHHHHHHHHhhhhcC
Q psy9699          17 VLIMCVTTYFLMMGILTLYTTYKEKG   42 (123)
Q Consensus        17 ~l~~~V~~YfiLsgilt~~~~~vEK~   42 (123)
                      ...++-+.|++++.+++......||-
T Consensus       192 ~~~~~a~iY~~l~~~ls~~~~~lErr  217 (222)
T COG0765         192 VYLLAALIYLILCLPLSLLSRRLERR  217 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44556668999999999999999974


No 17 
>PF13127 DUF3955:  Protein of unknown function (DUF3955)
Probab=29.18  E-value=29  Score=21.47  Aligned_cols=14  Identities=36%  Similarity=0.714  Sum_probs=12.1

Q ss_pred             ccceeccCceechH
Q psy9699          90 VANYFDETGLLLPD  103 (123)
Q Consensus        90 v~~~Fd~~G~l~~~  103 (123)
                      ++++=|+||.++++
T Consensus        24 ~~syVd~~G~L~Ep   37 (63)
T PF13127_consen   24 IGSYVDEDGVLHEP   37 (63)
T ss_pred             ccceECCCCeEecc
Confidence            45788999999998


No 18 
>PF03729 DUF308:  Short repeat of unknown function (DUF308);  InterPro: IPR005325 This represents a group of short repeats that occurs in a limited number of membrane proteins. It may divide further in short repeats of around 7-10 residues of the pattern G-#-X(2)-#(2)-X (#=hydrophobic).
Probab=27.97  E-value=1e+02  Score=18.04  Aligned_cols=26  Identities=15%  Similarity=0.565  Sum_probs=20.9

Q ss_pred             hhhhhHHHHHHHHHHHHHHHHhhhhc
Q psy9699          16 PVLIMCVTTYFLMMGILTLYTTYKEK   41 (123)
Q Consensus        16 ~~l~~~V~~YfiLsgilt~~~~~vEK   41 (123)
                      ......++.+++++|+..+...+.++
T Consensus        22 ~~~~~i~g~~~i~~Gi~~l~~~~~~~   47 (72)
T PF03729_consen   22 AALAIILGIWLIISGIFQLISAFRRR   47 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            45567788899999999999877743


No 19 
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family. Members of this protein family use NAD(P)H to reduce FMN and regenerate FMNH2. Members include the homodimeric, NAD(P)H-dependent enzyme SsuE from Escherichia coli, which serves as a partner to an FMNH2-dependent alkanesulfonate monooxygenase. It is induced by sulfate starvation. The NADH-dependent enzyme MsuE from Pseudomonas aeruginosa is outside the scope of this model (see model TIGR03566).
Probab=27.17  E-value=65  Score=22.98  Aligned_cols=26  Identities=19%  Similarity=0.291  Sum_probs=20.8

Q ss_pred             ceeccCcee-chHhHHHHHHHHHHHHh
Q psy9699          92 NYFDETGLL-LPDLVENDVSRLHNSIL  117 (123)
Q Consensus        92 ~~Fd~~G~l-~~~~f~~~l~~l~~~l~  117 (123)
                      .-||++|.+ ..+...+.+.++...+.
T Consensus       143 ~~~d~~g~~~~d~~~~~~l~~~~~~~~  169 (171)
T TIGR03567       143 IERDEDGTLQLDEEIKERLDEALEDLV  169 (171)
T ss_pred             hccccCCccccCHHHHHHHHHHHHHHH
Confidence            449999999 76777888888887764


No 20 
>PRK15069 histidine/lysine/arginine/ornithine ABC transporter permease HisM; Provisional
Probab=26.80  E-value=80  Score=23.99  Aligned_cols=26  Identities=12%  Similarity=0.168  Sum_probs=21.8

Q ss_pred             hhhhHHHHHHHHHHHHHHHHhhhhcC
Q psy9699          17 VLIMCVTTYFLMMGILTLYTTYKEKG   42 (123)
Q Consensus        17 ~l~~~V~~YfiLsgilt~~~~~vEK~   42 (123)
                      ...++.++|++++.++.....+.||-
T Consensus       202 ~~~~~~~~Y~~l~~~~~~~~~~le~r  227 (234)
T PRK15069        202 AFGIAAVLYLIISFVLISLFRRAERR  227 (234)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45567778999999999999999974


No 21 
>PHA02132 hypothetical protein
Probab=26.79  E-value=56  Score=21.06  Aligned_cols=26  Identities=19%  Similarity=0.180  Sum_probs=20.3

Q ss_pred             CCCchhhhhhHHHHHHHHHHHHHHHH
Q psy9699          11 VKRFEPVLIMCVTTYFLMMGILTLYT   36 (123)
Q Consensus        11 f~~sk~~l~~~V~~YfiLsgilt~~~   36 (123)
                      |-.|..|.++++.+|.++.|.-.+=.
T Consensus         8 f~~svqys~ia~~vyvl~hg~affde   33 (86)
T PHA02132          8 FILSVQYSIIAVMVYVLIHGFAFFDE   33 (86)
T ss_pred             HHHHHHHHHHHHHHHHHHhhHHHHHH
Confidence            44678899999999999999764433


No 22 
>PF05042 Caleosin:  Caleosin related protein;  InterPro: IPR007736 This family contains plant proteins related to caleosin. Caleosins contain calcium-binding domains and have an oleosin-like association with lipid bodies. Caleosins are present at relatively low levels and are mainly bound to microsomal membrane fractions at the early stages of seed development. As the seeds mature, overall levels of caleosins increased dramatically and they were associated almost exclusively with storage lipid bodies []. The calcium binding domain is probably related to the calcium-binding EF-hands motif IPR002048 from INTERPRO.
Probab=26.49  E-value=48  Score=24.74  Aligned_cols=41  Identities=20%  Similarity=0.340  Sum_probs=27.8

Q ss_pred             CCceeEEEEEEEe-CCCCeeeeEEEeeeccceeccCceechHhHHHHHHHH
Q psy9699          63 YDDMYNLVLQYKD-TKTGVTRSEQFNKSVANYFDETGLLLPDLVENDVSRL  112 (123)
Q Consensus        63 ~~p~Y~l~l~~~~-~~~~~~~~~~~~~~v~~~Fd~~G~l~~~~f~~~l~~l  112 (123)
                      .+|...+-|.... ++         ..|=+.-+|.+|.|+++.|++-+++.
T Consensus        64 p~P~f~Iyi~nIhk~k---------HGSDSg~YD~eGrFvp~kFe~iF~ky  105 (174)
T PF05042_consen   64 PDPFFRIYIKNIHKGK---------HGSDSGAYDTEGRFVPQKFEEIFSKY  105 (174)
T ss_pred             CCCceeEEeecccccc---------cCCCccccccCCcCCHHHHHHHHHHh
Confidence            4666666665321 11         12335579999999999999988874


No 23 
>PF13590 DUF4136:  Domain of unknown function (DUF4136)
Probab=26.40  E-value=2.1e+02  Score=19.32  Aligned_cols=46  Identities=13%  Similarity=0.240  Sum_probs=31.0

Q ss_pred             eEEEEEEEeCCCCeeeeEEEeeeccceeccCceechHhHHHHHHHHHHHH
Q psy9699          67 YNLVLQYKDTKTGVTRSEQFNKSVANYFDETGLLLPDLVENDVSRLHNSI  116 (123)
Q Consensus        67 Y~l~l~~~~~~~~~~~~~~~~~~v~~~Fd~~G~l~~~~f~~~l~~l~~~l  116 (123)
                      -+|.|...|.+++   +.-++......++++.. ..+.+...++++++.+
T Consensus       103 g~L~i~i~D~~~~---~~vW~g~a~~~~~~~~~-~~~~i~~~V~~i~~~f  148 (151)
T PF13590_consen  103 GTLVIDIIDAKTN---KVVWRGTASGRLSDNAD-REEAIPKAVNKIFEQF  148 (151)
T ss_pred             EEEEEEEEeCCCC---CEEEEEEEEeccCCCcC-HHHHHHHHHHHHHHhC
Confidence            3577777787654   35677777777777665 6666777777776654


No 24 
>PF06196 DUF997:  Protein of unknown function (DUF997);  InterPro: IPR010398 This is a family of predicted bacterial membrane protein with unknown function.
Probab=25.97  E-value=1.5e+02  Score=19.12  Aligned_cols=34  Identities=15%  Similarity=0.146  Sum_probs=25.2

Q ss_pred             ccCCCCchhhhhhHHHHHHHHHHHHHHHHhhhhcCe
Q psy9699           8 FTPVKRFEPVLIMCVTTYFLMMGILTLYTTYKEKGI   43 (123)
Q Consensus         8 ~~~f~~sk~~l~~~V~~YfiLsgilt~~~~~vEK~~   43 (123)
                      -.|+|  -.....|++.+.++..+.++..+++=||+
T Consensus        39 i~GlP--lWF~~SCi~~~il~~~l~~~~vk~~Fkd~   72 (80)
T PF06196_consen   39 IFGLP--LWFFYSCIGGPILFIILVWLMVKFFFKDI   72 (80)
T ss_pred             ccCCc--HHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence            34444  35667788899998888888888876664


No 25 
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=25.63  E-value=60  Score=14.37  Aligned_cols=17  Identities=12%  Similarity=0.083  Sum_probs=11.8

Q ss_pred             ccCceechHhHHHHHHH
Q psy9699          95 DETGLLLPDLVENDVSR  111 (123)
Q Consensus        95 d~~G~l~~~~f~~~l~~  111 (123)
                      |.+|.+..+.|...+..
T Consensus        12 ~~~g~i~~~e~~~~~~~   28 (29)
T smart00054       12 DGDGKIDFEEFKDLLKA   28 (29)
T ss_pred             CCCCcEeHHHHHHHHHh
Confidence            34578888877777654


No 26 
>PF13202 EF-hand_5:  EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A ....
Probab=25.26  E-value=74  Score=15.57  Aligned_cols=14  Identities=14%  Similarity=0.081  Sum_probs=10.8

Q ss_pred             ccCceechHhHHHH
Q psy9699          95 DETGLLLPDLVEND  108 (123)
Q Consensus        95 d~~G~l~~~~f~~~  108 (123)
                      |.||.+..+.|.+.
T Consensus        11 d~DG~is~~E~~~~   24 (25)
T PF13202_consen   11 DGDGKISFEEFQRL   24 (25)
T ss_dssp             TSSSEEEHHHHHHH
T ss_pred             CCCCcCCHHHHHHH
Confidence            66899988887763


No 27 
>TIGR02690 resist_ArsH arsenical resistance protein ArsH. Members of this protein family occur in arsenate resistance operons that include at least two different types of arsenate reductase. ArsH is not required for arsenate resistance in some systems. This family belongs to the larger family of NADPH-dependent FMN reductases (Pfam model pfam03358). The function of ArsH is not known.
Probab=25.18  E-value=72  Score=24.38  Aligned_cols=24  Identities=25%  Similarity=0.396  Sum_probs=21.4

Q ss_pred             eccCceechHhHHHHHHHHHHHHh
Q psy9699          94 FDETGLLLPDLVENDVSRLHNSIL  117 (123)
Q Consensus        94 Fd~~G~l~~~~f~~~l~~l~~~l~  117 (123)
                      ||++|.+..+...+.+..+++++.
T Consensus       174 fd~~G~l~d~~~~~~l~~~l~~~~  197 (219)
T TIGR02690       174 FDEAGRMKPSDYYDRVVDVMEELT  197 (219)
T ss_pred             cCcCCCCCCHHHHHHHHHHHHHHH
Confidence            999999999999998888888765


No 28 
>PF09926 DUF2158:  Uncharacterized small protein (DUF2158);  InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function. 
Probab=24.37  E-value=27  Score=20.93  Aligned_cols=18  Identities=22%  Similarity=0.407  Sum_probs=13.0

Q ss_pred             ccceeccCceechHhHHHH
Q psy9699          90 VANYFDETGLLLPDLVEND  108 (123)
Q Consensus        90 v~~~Fd~~G~l~~~~f~~~  108 (123)
                      .=.|||.+|. +++.|..+
T Consensus        33 ~C~WFd~~~~-~~~~F~~~   50 (53)
T PF09926_consen   33 ECQWFDGHGE-QRETFPED   50 (53)
T ss_pred             EEEeCCCCCc-cccccChH
Confidence            3569999998 77666543


No 29 
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=22.93  E-value=71  Score=25.01  Aligned_cols=25  Identities=16%  Similarity=0.195  Sum_probs=21.0

Q ss_pred             ccceeccCceechHhHHHHHHHHHH
Q psy9699          90 VANYFDETGLLLPDLVENDVSRLHN  114 (123)
Q Consensus        90 v~~~Fd~~G~l~~~~f~~~l~~l~~  114 (123)
                      .-.-||+||.++.+.+.+.++.+++
T Consensus        13 ~vTPf~~dg~iD~~~l~~li~~l~~   37 (296)
T TIGR03249        13 PVTPFDADGSFDEAAYRENIEWLLG   37 (296)
T ss_pred             eeCCcCCCCCcCHHHHHHHHHHHHh
Confidence            3345899999999999999988875


No 30 
>PRK15100 amino acid ABC transporter permease; Provisional
Probab=22.70  E-value=1e+02  Score=22.83  Aligned_cols=28  Identities=14%  Similarity=0.244  Sum_probs=23.3

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHhhhhcC
Q psy9699          15 EPVLIMCVTTYFLMMGILTLYTTYKEKG   42 (123)
Q Consensus        15 k~~l~~~V~~YfiLsgilt~~~~~vEK~   42 (123)
                      .....++.++|++++.++.......||-
T Consensus       186 ~~~~~~~~~~~~~l~~~~~~~~~~l~~~  213 (220)
T PRK15100        186 FTMYLAASLIYWIMATVLSALQNRFENQ  213 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456667788999999999999999975


No 31 
>COG3215 PilZ Tfp pilus assembly protein PilZ [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=22.68  E-value=1.6e+02  Score=20.39  Aligned_cols=83  Identities=13%  Similarity=0.118  Sum_probs=48.1

Q ss_pred             HHHHHHHHhhhhcCeEEEEE-eC---CcEEEEEeecCCCCceeEEE--EEEEeCCCCeeeeEEEeeeccceeccCceech
Q psy9699          29 MGILTLYTTYKEKGIFAVAK-KD---HIVWEASSYLKKYDDMYNLV--LQYKDTKTGVTRSEQFNKSVANYFDETGLLLP  102 (123)
Q Consensus        29 sgilt~~~~~vEK~~~yvg~-k~---~~~i~isS~~~k~~p~Y~l~--l~~~~~~~~~~~~~~~~~~v~~~Fd~~G~l~~  102 (123)
                      ++++..|+.|.|.|-+||-+ +.   |+.+-.--++..+...|.|-  +.-..+.+.++|..-+-..+++  +++|.-+.
T Consensus        20 a~LYsaYMpfl~nGglFVpTnk~y~iG~evfl~l~lld~pekl~vagkVaWitP~gt~sr~~GiGv~f~d--~e~g~~vr   97 (117)
T COG3215          20 ALLYSAYMPFLENGGLFVPTNKVYSIGEEVFLLLELLDFPEKLPVAGKVAWITPVGTQSRPAGIGVQFTD--GENGLKVR   97 (117)
T ss_pred             HHHHHHHhHHHhcCcEEcccCCccccchhhhhhhhhcCchhhccccceEEEEccCCCCCCCCceeeeccC--CCchhhHH
Confidence            45667789999998888877 44   55555554444444444442  1122222222344444445554  67777777


Q ss_pred             HhHHHHHHHHH
Q psy9699         103 DLVENDVSRLH  113 (123)
Q Consensus       103 ~~f~~~l~~l~  113 (123)
                      +..+..+...+
T Consensus        98 ~~IE~~Lg~~i  108 (117)
T COG3215          98 NQIETLLGGTI  108 (117)
T ss_pred             HHHHHHHHhhc
Confidence            77776666554


No 32 
>CHL00005 rps16 ribosomal protein S16
Probab=22.42  E-value=2.3e+02  Score=18.42  Aligned_cols=52  Identities=12%  Similarity=0.115  Sum_probs=31.1

Q ss_pred             EEEEeecCCCCceeEEEEEEEeC-CCCeeeeEEEeeeccceecc---CceechHhHHHHHHH
Q psy9699          54 WEASSYLKKYDDMYNLVLQYKDT-KTGVTRSEQFNKSVANYFDE---TGLLLPDLVENDVSR  111 (123)
Q Consensus        54 i~isS~~~k~~p~Y~l~l~~~~~-~~~~~~~~~~~~~v~~~Fd~---~G~l~~~~f~~~l~~  111 (123)
                      |+.+=.=.|..|.|++.+..... ..|+..  +.-.    +||.   .-.+..+....|+++
T Consensus         4 IRL~R~G~kk~P~YrIVvadsr~~RdGk~i--E~lG----~YnP~~~~~~ln~eri~~Wl~~   59 (82)
T CHL00005          4 LRLKRCGRKQQAVYRIVAIDVRSRREGRDL--EKVG----FYDPIKNQTYLNVPAILYFLEK   59 (82)
T ss_pred             EecccCCCCCCCeEEEEEEeCCCCCCCcce--eEee----eccCCCcccEEeHHHHHHHHHC
Confidence            44444446899999999875432 333322  1111    2332   348888999999875


No 33 
>PF11295 DUF3096:  Protein of unknown function (DUF3096);  InterPro: IPR021446 This entry is represented by the archaeal Thermoproteus tenax spherical virus 1, Orf18. The characteristics of the protein distribution suggest prophage matches and lateral genetic transfer in addition to the phage matches.
Probab=21.80  E-value=1.3e+02  Score=16.95  Aligned_cols=20  Identities=30%  Similarity=0.702  Sum_probs=15.9

Q ss_pred             hhhhHHHHHHHHHHHHHHHH
Q psy9699          17 VLIMCVTTYFLMMGILTLYT   36 (123)
Q Consensus        17 ~l~~~V~~YfiLsgilt~~~   36 (123)
                      ++-..|++|.++-|++-+..
T Consensus        17 llnyiVaiyLI~~G~lgL~~   36 (39)
T PF11295_consen   17 LLNYIVAIYLIVIGLLGLFG   36 (39)
T ss_pred             HHHHHHHHHHHHHHHHHhhh
Confidence            45567899999999987764


No 34 
>PF11396 DUF2874:  Protein of unknown function (DUF2874);  InterPro: IPR021533  This bacterial family of proteins are probable periplasmic proteins with unknown function. There are between one and four copies of this domain per sequence. ; PDB: 3DUE_A 3U1W_B 3DB7_A 4DSD_A 3ELG_A.
Probab=21.49  E-value=1.4e+02  Score=17.17  Aligned_cols=24  Identities=29%  Similarity=0.636  Sum_probs=13.9

Q ss_pred             ceeEEEEEEEeCCCCeeeeEEEeeeccceeccCcee
Q psy9699          65 DMYNLVLQYKDTKTGVTRSEQFNKSVANYFDETGLL  100 (123)
Q Consensus        65 p~Y~l~l~~~~~~~~~~~~~~~~~~v~~~Fd~~G~l  100 (123)
                      ..|.+.+. .++.       +.+    =+||++|.+
T Consensus        37 ~~Y~v~l~-~~~~-------~~~----v~fd~~G~~   60 (61)
T PF11396_consen   37 KYYEVELK-KGGN-------EYE----VYFDANGNW   60 (61)
T ss_dssp             EEEEEEET-ETTT-------SEE----EEEETTS-E
T ss_pred             CEEEEEEE-EeCC-------eEE----EEEcCCCCC
Confidence            77888776 2221       111    279999976


No 35 
>TIGR03592 yidC_oxa1_cterm membrane protein insertase, YidC/Oxa1 family, C-terminal domain. This model describes full-length from some species, and the C-terminal region only from other species, of the YidC/Oxa1 family of proteins. This domain appears to be univeral among bacteria (although absent from Archaea). The well-characterized YidC protein from Escherichia coli and its close homologs contain a large N-terminal periplasmic domain in addition to the region modeled here.
Probab=21.17  E-value=1.1e+02  Score=22.21  Aligned_cols=20  Identities=10%  Similarity=0.316  Sum_probs=15.8

Q ss_pred             hHHHHHHHHHHHHHHHHhhh
Q psy9699          20 MCVTTYFLMMGILTLYTTYK   39 (123)
Q Consensus        20 ~~V~~YfiLsgilt~~~~~v   39 (123)
                      .++.+|++.|+++++...++
T Consensus       159 a~l~lYw~~s~~~sl~Q~~~  178 (181)
T TIGR03592       159 AGLVLYWVVSNLFTIIQQLI  178 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            46778999999998887654


No 36 
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see TIGR02311). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the one identified by this model is part of an operon for 4-hydroxyphenylacetic acid catabolism.
Probab=20.56  E-value=84  Score=24.69  Aligned_cols=25  Identities=8%  Similarity=0.076  Sum_probs=21.0

Q ss_pred             ccceeccCceechHhHHHHHHHHHH
Q psy9699          90 VANYFDETGLLLPDLVENDVSRLHN  114 (123)
Q Consensus        90 v~~~Fd~~G~l~~~~f~~~l~~l~~  114 (123)
                      +-.-||+||.++.+.+.+.++.+++
T Consensus         8 ~~TPf~~dg~iD~~~l~~lv~~~~~   32 (294)
T TIGR02313         8 LITPFKRNGDIDEEALRELIEFQIE   32 (294)
T ss_pred             eeCCcCCCCCcCHHHHHHHHHHHHH
Confidence            3445999999999999999988875


No 37 
>PF07981 Plasmod_MYXSPDY:  Plasmodium repeat_MYXSPDY;  InterPro: IPR012598 This repeat is found in two hypothetical Plasmodium proteins.
Probab=20.48  E-value=82  Score=14.50  Aligned_cols=11  Identities=27%  Similarity=0.395  Sum_probs=8.5

Q ss_pred             CCceeEEEEEE
Q psy9699          63 YDDMYNLVLQY   73 (123)
Q Consensus        63 ~~p~Y~l~l~~   73 (123)
                      ++|-|+|.+..
T Consensus         3 ~SPdytL~~v~   13 (17)
T PF07981_consen    3 FSPDYTLRLVQ   13 (17)
T ss_pred             cCCCceEEEEe
Confidence            57999998753


No 38 
>PF07661 MORN_2:  MORN repeat variant;  InterPro: IPR011652 This entry represents an apparent variant of the IPR003409 from INTERPRO repeat.
Probab=20.27  E-value=42  Score=15.32  Aligned_cols=12  Identities=25%  Similarity=0.606  Sum_probs=8.9

Q ss_pred             ceeccCceechH
Q psy9699          92 NYFDETGLLLPD  103 (123)
Q Consensus        92 ~~Fd~~G~l~~~  103 (123)
                      ..|+++|.+...
T Consensus         6 ~~yy~nG~l~~~   17 (22)
T PF07661_consen    6 KFYYENGKLKSE   17 (22)
T ss_pred             EEEeCCCCEEEE
Confidence            468888888654


Done!