Diaphorina citri psyllid: psy9732

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250

MLQGEWMVEFFAPWCPACKQMEKVWQEYSGWAQDLNINVAQVDVTVSPGLSGRFMVTALPTIFQEGIRGNIERGYFNIAKEIEELFRVEHNFGQSFIASTFPEHSTTIQCNVLMLISEIQNKKMHNKMMEDYGIPAWGSYTIFAMVTIMIGALLGLLLVFIIDQIYPPSAVVKKSSVTKKKKGKDLGAKDSDVETDESDLRDDTGLIEGTVTTKVLPLRIQRTGYKKASYCKNKPYLFNNNNNRLEWKVI

cccccEEEEEEccccHHHHccHHHHHHHHHHccccccEEEEEEccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccEEEEc

MLQGEWMVEFFAPWCPACKQMEKVWQEYSGWAQDLNINVAQVDVTVSPGLSGRFMVTALPTIFQEGIRGNIERGYFNIAKEIEELFRVEHNFGQSFIASTFPEHSTTIQCNVLMLISEIQNKKMHNKMMEDYGIPAWGSYTIFAMVTIMIGALLGLLLVFIIDQIYPPS********************************************KVLPLRIQRTGYKKASYCKN******NNNN****K**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Thioredoxin-related transmembrane protein 1	May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.	confident	Q8VBT0
Thioredoxin-related transmembrane protein 1	May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.	confident	Q0Z7W6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006464 [BP]	cellular protein modification process	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0015035 [MF]	protein disulfide oxidoreductase activity	probable	GO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IDV, chain A
Confidence level:very confident
Coverage over the Query: 3-143
View the alignment between query and template
View the model in PyMOL