Query         psy9766
Match_columns 97
No_of_seqs    101 out of 470
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 19:01:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9766.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9766hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00121 IB Insulin growth f  99.7 1.6E-17 3.6E-22  106.3   5.1   67   21-93      2-75  (75)
  2 PF00219 IGFBP:  Insulin-like g  99.5 1.8E-15 3.9E-20   91.2  -1.3   51   23-78      3-53  (53)
  3 PF07327 Neuroparsin:  Neuropar  98.4 5.4E-07 1.2E-11   60.5   4.0   48   24-79     31-78  (103)
  4 PF03032 Brevenin:  Brevenin/es  71.0     2.8   6E-05   24.4   1.3   13    1-13      3-15  (46)
  5 PF11119 DUF2633:  Protein of u  60.6     5.7 0.00012   24.4   1.3   15    1-15      9-23  (59)
  6 PF08139 LPAM_1:  Prokaryotic m  54.6     9.4  0.0002   19.6   1.3   15    1-15      7-21  (25)
  7 PF13956 Ibs_toxin:  Toxin Ibs,  51.4      11 0.00023   18.1   1.1   15    1-15      1-15  (19)
  8 COG3898 Uncharacterized membra  48.9      11 0.00023   31.7   1.6   16    1-16      1-16  (531)
  9 PF12273 RCR:  Chitin synthesis  45.5     7.3 0.00016   26.4   0.1    8    3-10      1-8   (130)
 10 PRK10350 hypothetical protein;  43.8      15 0.00032   26.1   1.4   16    1-16      1-16  (145)
 11 PF07127 Nodulin_late:  Late no  42.9      36 0.00078   19.7   2.8   17    6-22     11-30  (54)
 12 PRK10081 entericidin B membran  38.5      20 0.00044   21.1   1.2   14    1-14      2-15  (48)
 13 PF03967 PRCH:  Photosynthetic   35.8      26 0.00057   24.8   1.7   12    3-14     17-28  (136)
 14 PRK10386 curli assembly protei  35.1      30 0.00066   24.2   1.9   18    1-18      1-18  (130)
 15 PF00734 CBM_1:  Fungal cellulo  34.9      15 0.00032   19.2   0.3   23   61-83      4-27  (29)
 16 PF02740 Colipase_C:  Colipase,  34.3     9.6 0.00021   22.2  -0.6   25   70-94     17-45  (45)
 17 PF11777 DUF3316:  Protein of u  31.1      31 0.00067   22.9   1.4   15    1-15      1-15  (114)
 18 cd00226 PRCH Photosynthetic re  30.2      34 0.00074   26.4   1.6   12    3-14     17-28  (246)
 19 TIGR01150 puhA photosynthetic   29.8      35 0.00076   26.5   1.6   12    3-14     17-28  (252)
 20 COG5510 Predicted small secret  25.5      52  0.0011   19.0   1.4   14    1-14      2-15  (44)
 21 PF11153 DUF2931:  Protein of u  22.0      64  0.0014   23.5   1.8   15    1-15      1-15  (216)
 22 cd02875 GH18_chitobiase Chitob  21.5      57  0.0012   25.7   1.5   13   20-32     17-30  (358)
 23 PF06291 Lambda_Bor:  Bor prote  20.6      83  0.0018   20.9   1.9   15    1-15      1-15  (97)

No 1  
>smart00121 IB Insulin growth factor-binding protein homologues. High affinity binding partners of insulin-like growth factors.
Probab=99.70  E-value=1.6e-17  Score=106.33  Aligned_cols=67  Identities=39%  Similarity=0.899  Sum_probs=58.5

Q ss_pred             CC-cCCCCCCCCCCCCCCCCCCceeccCccccHHhhhhcCCCCCCCCCCcCCCCCCceeeccCCCCC------CCceeec
Q psy9766          21 SC-VCNPAECETLTDDDCPDRAGTVWDPCGCCKVCARAENQPCGGPYGFFGSCAHDLECVVTDVTNE------NSGGVCT   93 (97)
Q Consensus        21 ~C-~C~~~~Cp~~p~~~C~~~~g~v~D~CgCC~vCa~~eGe~Cg~~~~~~g~C~~GL~C~~~~~~~~------~~~GvC~   93 (97)
                      .| +|++..||+.|+ +|+.  ++++|.||||.+||++|||+||+.   .++|++||+|.++.++.+      +++|+|+
T Consensus         2 ~C~~C~~~~Cp~~p~-~C~~--~~~~d~CgCC~vCa~~eGe~Cg~~---~~~C~~GL~C~~~~~~~~p~~al~~g~g~C~   75 (75)
T smart00121        2 RCPPCDPARCPPCPP-GCAE--LVRLDGCGCCPVCARQEGEPCGVY---TPRCAPGLRCQPPPGEERPLRALLHGRGVCM   75 (75)
T ss_pred             CCCCCCHhHCcCCCC-CCCc--cccCCCCchhHHHhcccCCcCCCC---CCCCCCCCEEcCCCCCcChHHHHhccCcccC
Confidence            57 688999998774 8998  899999999999999999999963   579999999999988744      6889985


No 2  
>PF00219 IGFBP:  Insulin-like growth factor binding protein;  InterPro: IPR000867  The insulin family of proteins groups together several evolutionarily related active peptides []: these include insulin [, ], relaxin [, ], insect prothoracicotropic hormone (bombyxin) [], insulin-like growth factors (IGF1 and IGF2) [, ], mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP) (gene INSL4), locust insulin-related peptide (LIRP), molluscan insulin-related peptides (MIP), and Caenorhabditis elegans insulin-like peptides. The 3D structures of a number of family members have been determined [, , ]. The fold comprises two polypeptide chains (A and B) linked by two disulphide bonds: all share a conserved arrangement of 4 cysteines in their A chain, the first of which is linked by a disulphide bond to the third, while the second and fourth are linked by interchain disulphide bonds to cysteines in the B chain.   Insulin is found in many animals, and is involved in the regulation of normal glucose homeostasis. It also has other specific physiological effects, such as increasing the permeability of cells to monosaccharides, amino acids and fatty acids, and accelerating glycolysis and glycogen synthesis in the liver []. Insulin exerts its effects by interaction with a cell-surface receptor, which may also result in the promotion of cell growth [].   Insulin is synthesised as a prepropeptide from which an endoplasmic reticulum-targeting sequence is cleaved to yield proinsulin. The sequence of prosinsulin contains 2 well-conserved regions (designated A and B), separated by an intervening connecting region (C), which is variable between species []. The connecting region is cleaved, liberating the active protein, which contains the A and B chains, held together by 2 disulphide bonds [].  Insulin-like Growth Factor Binding Proteins (IGFBP) are a group of vertebrate secreted proteins, which bind to IGF-I and IGF-II with high affinity and modulate the biological actions of IGFs. The IGFBP family has six distinct subgroups, IGFBP-1 through 6, based on conservation of gene (intron-exon) organisation, structural similarity, and binding affinity for IGFs. Across species, IGFBP-5 exhibits the most sequence conservation, while IGFBP-6 exhibits the least sequence conservation. The IGFBPs contain inhibitor domain homologues, which are related to MEROPS protease inhibitor family I31 (equistatin, clan IX).  All IGFBPs share a common domain architecture (IPR000867 from INTERPRO:IPR000716 from INTERPRO). While the N-terminal (IPR000867 from INTERPRO, IGF binding protein domain), and the C-terminal (IPR000716 from INTERPRO, thyroglobulin type-1 repeat) domains are conserved across vertebrate species, the mid-region is highly variable with respect to protease cleavage sites and phosphorylation and glycosylation sites. IGFBPs contain 16-18 conserved cysteines located in the N-terminal and the C-terminal regions, which form 8-9 disulphide bonds [].   As demonstrated for human IGFBP-5, the N terminus is the primary binding site for IGF. This region, comprised of Val49, Tyr50, Pro62 and Lys68-Leu75, forms a hydrophobic patch on the surface of the protein []. The C terminus is also required for high affinity IGF binding, as well as for binding to the extracellular matrix [] and for nuclear translocation [, ] of IGFBP-3 and -5.   IGFBPs are unusually pleiotropic molecules. Like other binding proteins, IGFBP can prolong the half-life of IGFs via high affinity binding of the ligands. In addition to functioning as simple carrier proteins, serum IGFBPs also serve to regulate the endocrine and paracrine/autocrine actions of IGF by modulating the IGF available to bind to signalling IGF-I receptors [, ]. Furthermore, IGFBPs can function as growth modulators independent of IGFs. For example, IGFBP-5 stimulates markers of bone formation in osteoblasts lacking functional IGFs []. The binding of IGFBP to its putative receptor on the cell membrane may stimulate the signalling pathway independent of an IGF receptor, to mediate the effects of IGFBPs in certain target cell types. IGFBP-1 and -2, but not other IGFBPs, contain a C-terminal Arg-Gly-Asp integrin-binding motif. Thus, IGFBP-1 can also stimulate cell migration of CHO and human trophoblast cells through an action mediated by alpha 5 beta 1 integrin []. Finally, IGFBPs transported into the nucleus (via the nuclear localisation signal) may also exert IGF-independent effects by transcriptional activation of genes. This entry represents insulin-like growth factors (IGF-I and IGF-II), which bind to specific binding proteins in extracellular fluids with high affinity [, , ]. These IGF-binding proteins (IGFBP) prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cells culture. They seem to alter the interaction of IGFs with their cell surface receptors. There are at least six different IGFBPs and they are structurally related. The following growth-factor inducible proteins are structurally related to IGFBPs and could function as growth-factor binding proteins [, ], mouse protein cyr61 and its probable chicken homolog, protein CEF-10; human connective tissue growth factor (CTGF) and its mouse homolog, protein FISP-12; and vertebrate protein NOV.; GO: 0005520 insulin-like growth factor binding, 0001558 regulation of cell growth, 0005576 extracellular region; PDB: 2DSQ_A 2DSP_B 2DSR_B 1WQJ_B 1H59_B 1BOE_A 3TJQ_A.
Probab=99.49  E-value=1.8e-15  Score=91.18  Aligned_cols=51  Identities=49%  Similarity=1.162  Sum_probs=31.3

Q ss_pred             cCCCCCCCCCCCCCCCCCCceeccCccccHHhhhhcCCCCCCCCCCcCCCCCCcee
Q psy9766          23 VCNPAECETLTDDDCPDRAGTVWDPCGCCKVCARAENQPCGGPYGFFGSCAHDLEC   78 (97)
Q Consensus        23 ~C~~~~Cp~~p~~~C~~~~g~v~D~CgCC~vCa~~eGe~Cg~~~~~~g~C~~GL~C   78 (97)
                      +|+++ ||+++ ++|+.++.+|+|.||||.+||++|||+||..   +++|++||+|
T Consensus         3 ~C~~~-Cp~~~-~~C~~g~~~v~d~CGCC~vCA~~~Ge~CG~~---~~~C~~GL~C   53 (53)
T PF00219_consen    3 PCDPE-CPPPP-PDCPAGVSLVLDGCGCCKVCARQEGEPCGVY---TGPCGPGLRC   53 (53)
T ss_dssp             SB-HH-------SS-TTEEEE--STTS-SEEE-B-TTSEESTT---S--BSTTEEE
T ss_pred             CCccc-CCCCC-CCCCCcccccCCCCcCHHHHHhhcCCcCCCc---CCCCCCcCCC
Confidence            47667 87665 5899955567799999999999999999864   5799999997


No 3  
>PF07327 Neuroparsin:  Neuroparsin;  InterPro: IPR010850 This family consists of several locust specific neuroparsin proteins. Neuroparsins are produced by the A1 type of protocerebral median neurosecretory cells of the PI-CC system and display pleiotropic activities: inhibition of the effect of juvenile hormone, stimulation of fluid reabsorption of isolated recta, induction of an increase in hemolymph lipid and trehalose levels, and neurotrophic effects [].
Probab=98.35  E-value=5.4e-07  Score=60.49  Aligned_cols=48  Identities=42%  Similarity=0.967  Sum_probs=40.1

Q ss_pred             CCCCCCCCCCCCCCCCCCceeccCccccHHhhhhcCCCCCCCCCCcCCCCCCceee
Q psy9766          24 CNPAECETLTDDDCPDRAGTVWDPCGCCKVCARAENQPCGGPYGFFGSCAHDLECV   79 (97)
Q Consensus        24 C~~~~Cp~~p~~~C~~~~g~v~D~CgCC~vCa~~eGe~Cg~~~~~~g~C~~GL~C~   79 (97)
                      |+.+.|-.-+ ..|++  |.+.|.||. .+||+..||.||+    +|.|++||.|.
T Consensus        31 c~~~~C~~d~-~~C~Y--G~v~d~cgr-~~CaKGPge~CGg----~G~CGeGl~C~   78 (103)
T PF07327_consen   31 CEGANCVVDC-TKCEY--GEVTDFCGR-KVCAKGPGERCGG----YGKCGEGLRCS   78 (103)
T ss_pred             cchhhccccc-ccccc--cceecccCc-chhhcCCCCcCCC----cceecCCcEec
Confidence            4445555433 58999  899999998 8999999999999    58999999994


No 4  
>PF03032 Brevenin:  Brevenin/esculentin/gaegurin/rugosin family;  InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=71.00  E-value=2.8  Score=24.43  Aligned_cols=13  Identities=15%  Similarity=0.358  Sum_probs=9.7

Q ss_pred             CchHHHHHHHHHh
Q psy9766           1 MIRSVFWIFLSYC   13 (97)
Q Consensus         1 ~~~~~~~~~~~~~   13 (97)
                      |||+|+++||+=.
T Consensus         3 lKKsllLlfflG~   15 (46)
T PF03032_consen    3 LKKSLLLLFFLGT   15 (46)
T ss_pred             chHHHHHHHHHHH
Confidence            7889888877543


No 5  
>PF11119 DUF2633:  Protein of unknown function (DUF2633);  InterPro: IPR022576  This family is conserved largely in Proteobacteria. Several members are named as YfgG. The function is not known. 
Probab=60.56  E-value=5.7  Score=24.38  Aligned_cols=15  Identities=33%  Similarity=0.425  Sum_probs=11.5

Q ss_pred             CchHHHHHHHHHhhc
Q psy9766           1 MIRSVFWIFLSYCLG   15 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (97)
                      |+|+|++|.++++++
T Consensus         9 mtriVLLISfiIlfg   23 (59)
T PF11119_consen    9 MTRIVLLISFIILFG   23 (59)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            788888887766654


No 6  
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=54.59  E-value=9.4  Score=19.56  Aligned_cols=15  Identities=20%  Similarity=0.381  Sum_probs=10.4

Q ss_pred             CchHHHHHHHHHhhc
Q psy9766           1 MIRSVFWIFLSYCLG   15 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (97)
                      |||.+|.+.+++.++
T Consensus         7 mKkil~~l~a~~~La   21 (25)
T PF08139_consen    7 MKKILFPLLALFMLA   21 (25)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            378888777776554


No 7  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=51.44  E-value=11  Score=18.11  Aligned_cols=15  Identities=13%  Similarity=0.319  Sum_probs=7.5

Q ss_pred             CchHHHHHHHHHhhc
Q psy9766           1 MIRSVFWIFLSYCLG   15 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (97)
                      |.|.+.++.++++.+
T Consensus         1 MMk~vIIlvvLLliS   15 (19)
T PF13956_consen    1 MMKLVIILVVLLLIS   15 (19)
T ss_pred             CceehHHHHHHHhcc
Confidence            445555545555444


No 8  
>COG3898 Uncharacterized membrane-bound protein [Function unknown]
Probab=48.92  E-value=11  Score=31.75  Aligned_cols=16  Identities=44%  Similarity=0.769  Sum_probs=13.7

Q ss_pred             CchHHHHHHHHHhhcc
Q psy9766           1 MIRSVFWIFLSYCLGR   16 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (97)
                      |||.+||+++++.+++
T Consensus         1 MiRvlfflilV~alg~   16 (531)
T COG3898           1 MIRVLFFLILVAALGF   16 (531)
T ss_pred             ChhHHHHHHHHHHHHh
Confidence            9999999999887754


No 9  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=45.48  E-value=7.3  Score=26.42  Aligned_cols=8  Identities=25%  Similarity=0.559  Sum_probs=3.8

Q ss_pred             hHHHHHHH
Q psy9766           3 RSVFWIFL   10 (97)
Q Consensus         3 ~~~~~~~~   10 (97)
                      |||+|++|
T Consensus         1 RW~l~~ii    8 (130)
T PF12273_consen    1 RWVLFAII    8 (130)
T ss_pred             CeeeHHHH
Confidence            45555443


No 10 
>PRK10350 hypothetical protein; Provisional
Probab=43.80  E-value=15  Score=26.10  Aligned_cols=16  Identities=25%  Similarity=0.173  Sum_probs=10.1

Q ss_pred             CchHHHHHHHHHhhcc
Q psy9766           1 MIRSVFWIFLSYCLGR   16 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (97)
                      |||+|+|++++-+.+.
T Consensus         1 MKr~L~~~allP~~~~   16 (145)
T PRK10350          1 MKRLLLLTALLPFVGF   16 (145)
T ss_pred             ChhHHHHHHHhHHHHH
Confidence            8999866665444433


No 11 
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=42.93  E-value=36  Score=19.74  Aligned_cols=17  Identities=35%  Similarity=0.522  Sum_probs=7.4

Q ss_pred             HHHHHHHhhccccc---cCC
Q psy9766           6 FWIFLSYCLGRSIA---FSC   22 (97)
Q Consensus         6 ~~~~~~~~~~~~~~---~~C   22 (97)
                      ++||+++.+.+...   ..|
T Consensus        11 mIiflslflv~~~~~~~~~C   30 (54)
T PF07127_consen   11 MIIFLSLFLVVTNVDAIIPC   30 (54)
T ss_pred             HHHHHHHHHhhcccCCCccc
Confidence            34444444433333   466


No 12 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=38.48  E-value=20  Score=21.09  Aligned_cols=14  Identities=21%  Similarity=0.306  Sum_probs=9.0

Q ss_pred             CchHHHHHHHHHhh
Q psy9766           1 MIRSVFWIFLSYCL   14 (97)
Q Consensus         1 ~~~~~~~~~~~~~~   14 (97)
                      |||.+.+|++++++
T Consensus         2 mKk~i~~i~~~l~~   15 (48)
T PRK10081          2 VKKTIAAIFSVLVL   15 (48)
T ss_pred             hHHHHHHHHHHHHH
Confidence            67777776665543


No 13 
>PF03967 PRCH:  Photosynthetic reaction centre, H-chain N-terminal region;  InterPro: IPR015810  The photosynthetic apparatus in non-oxygenic bacteria consists of light-harvesting (LH) protein-pigment complexes LH1 and LH2, which use carotenoid and bacteriochlorophyll as primary donors []. LH1 acts as the energy collection hub, temporarily storing it before its transfer to the photosynthetic reaction centre (RC) []. Electrons are transferred from the primary donor via an intermediate acceptor (bacteriopheophytin) to the primary acceptor (quinine Qa), and finally to the secondary acceptor (quinone Qb), resulting in the formation of ubiquinol QbH2. RC uses the excitation energy to shuffle electrons across the membrane, transferring them via ubiquinol to the cytochrome bc1 complex in order to establish a proton gradient across the membrane, which is used by ATP synthetase to form ATP [, , ].  The core complex is anchored in the cell membrane, consisting of one unit of RC surrounded by LH1; in some species there may be additional subunits []. RC consists of three subunits: L (light), M (medium), and H (heavy). Subunits L and M provide the scaffolding for the chromophore, while subunit H contains a cytoplasmic domain []. In Rhodopseudomonas viridis, there is also a non-membranous tetrahaem cytochrome (4Hcyt) subunit on the periplasmic surface.  This entry represents the N-terminal domain of the photosynthetic reaction centre H subunit, which includes the transmembrane domain and part of the cytoplasmic domain [].; GO: 0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, 0019684 photosynthesis, light reaction, 0030077 plasma membrane light-harvesting complex; PDB: 1RZZ_H 1PST_H 2J8D_H 3DUQ_H 1FNP_H 1KBY_H 1E14_H 2HG3_H 1UMX_H 1YST_H ....
Probab=35.80  E-value=26  Score=24.82  Aligned_cols=12  Identities=33%  Similarity=0.794  Sum_probs=8.9

Q ss_pred             hHHHHHHHHHhh
Q psy9766           3 RSVFWIFLSYCL   14 (97)
Q Consensus         3 ~~~~~~~~~~~~   14 (97)
                      -++|||||+.++
T Consensus        17 lyaFwiFFagLi   28 (136)
T PF03967_consen   17 LYAFWIFFAGLI   28 (136)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            468999886664


No 14 
>PRK10386 curli assembly protein CsgE; Provisional
Probab=35.15  E-value=30  Score=24.25  Aligned_cols=18  Identities=28%  Similarity=0.231  Sum_probs=13.4

Q ss_pred             CchHHHHHHHHHhhcccc
Q psy9766           1 MIRSVFWIFLSYCLGRSI   18 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~   18 (97)
                      |||.+.|+.+++++..+.
T Consensus         1 ~~r~~~~~l~~~~l~~~~   18 (130)
T PRK10386          1 MKRYLRWIVAAELLFAAG   18 (130)
T ss_pred             ChhHHHHHHHHHHHHhCc
Confidence            899998988877665433


No 15 
>PF00734 CBM_1:  Fungal cellulose binding domain;  InterPro: IPR000254 The microbial degradation of cellulose and xylans requires several types of enzymes such as endoglucanases (3.2.1.4 from EC), cellobiohydrolases (3.2.1.91 from EC) (exoglucanases), or xylanases (3.2.1.8 from EC) []. Structurally, cellulases and xylanases generally consist of a catalytic domain joined to a cellulose-binding domain (CBD) by a short linker sequence rich in proline and/or hydroxy-amino acids. The CBD of a number of fungal cellulases has been shown to consist of 36 amino acid residues, and it is found either at the N-terminal or at the C-terminal extremity of the enzymes. As it is shown in the following schematic representation, there are four conserved cysteines in this type of CBD domain, all involved in disulphide bonds.  +----------------+ | +-----|---------+ | | | | xxxxxxxCxxxxxxxxxxCxxxxxCxxxxxxxxxCx ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0030248 cellulose binding, 0005975 carbohydrate metabolic process, 0005576 extracellular region; PDB: 1AZK_A 2CBH_A 1AZJ_A 1AZ6_A 1CBH_A 1AZH_A.
Probab=34.93  E-value=15  Score=19.24  Aligned_cols=23  Identities=30%  Similarity=0.469  Sum_probs=14.0

Q ss_pred             CCCCCCCCc-CCCCCCceeeccCC
Q psy9766          61 PCGGPYGFF-GSCAHDLECVVTDV   83 (97)
Q Consensus        61 ~Cg~~~~~~-g~C~~GL~C~~~~~   83 (97)
                      .|||..+.. ..|.+|+.|...++
T Consensus         4 QCGG~~~~G~t~C~~g~~C~~~n~   27 (29)
T PF00734_consen    4 QCGGIGWTGPTCCASGYTCVYQND   27 (29)
T ss_dssp             EEECTT-SS---BSSSSCEEEEET
T ss_pred             ccCCCCcccCCcCCCcCEeeeECC
Confidence            477655322 35999999987653


No 16 
>PF02740 Colipase_C:  Colipase, C-terminal domain;  InterPro: IPR017914 This entry represents the C-terminal domain of colipase proteins. Colipase [, ] is a small protein cofactor needed by pancreatic lipase for efficient dietary lipid hydrolyisis. It also binds to the bile-salt covered triacylglycerol interface, thus allowing the enzyme to anchor itself to the water-lipid interface. Efficient absorption of dietary fats is dependent on the action of pancreatic triglyceride lipase. Colipase binds to the C-terminal, non-catalytic domain of lipase, thereby stabilising as active conformation and considerably increasing the overall hydrophobic binding site. Structural studies of the complex and of colipase alone have revealed the functionality of its architecture [, ]. Colipase is a small protein with five conserved disulphide bonds. Structural analogies have been recognised between a developmental protein (Dickkopf), the pancreatic lipase C-terminal domain, the N-terminal domains of lipoxygenases and the C-terminal domain of alpha-toxin. These non-catalytic domains in the latter enzymes are important for interaction with membrane. It has not been established if these domains are also involved in eventual protein cofactor binding as is the case for pancreatic lipase [].; GO: 0008047 enzyme activator activity, 0007586 digestion, 0016042 lipid catabolic process, 0005576 extracellular region; PDB: 1PCO_A 1PCN_A 1LPA_A 1N8S_C 1LPB_A 1ETH_D.
Probab=34.32  E-value=9.6  Score=22.15  Aligned_cols=25  Identities=20%  Similarity=0.477  Sum_probs=15.0

Q ss_pred             CCCCCCceeeccCCCCC----CCceeecc
Q psy9766          70 GSCAHDLECVVTDVTNE----NSGGVCTQ   94 (97)
Q Consensus        70 g~C~~GL~C~~~~~~~~----~~~GvC~~   94 (97)
                      =+|.+||.|.....-..    ...|||.+
T Consensus        17 CPCE~GLtCe~dktivgsItNtn~GiC~d   45 (45)
T PF02740_consen   17 CPCERGLTCEGDKTIVGSITNTNFGICHD   45 (45)
T ss_dssp             --BSTTEEEEECESHHHHHHTC-EEEEEE
T ss_pred             ccCCCCcEEecccceEEEEEcccceeecC
Confidence            47899999986553211    36788864


No 17 
>PF11777 DUF3316:  Protein of unknown function (DUF3316);  InterPro: IPR016879 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=31.07  E-value=31  Score=22.93  Aligned_cols=15  Identities=13%  Similarity=0.060  Sum_probs=10.4

Q ss_pred             CchHHHHHHHHHhhc
Q psy9766           1 MIRSVFWIFLSYCLG   15 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (97)
                      |||.+++++++++..
T Consensus         1 MKk~~ll~~~ll~s~   15 (114)
T PF11777_consen    1 MKKIILLASLLLLSS   15 (114)
T ss_pred             CchHHHHHHHHHHHH
Confidence            888888776655543


No 18 
>cd00226 PRCH Photosynthetic reaction center (RC) complex, subunit H;  RC is an integral membrane protein-pigment complex which catalyzes light-induced reduction of ubiquinone to ubiquinol, generating a transmembrane electrochemical gradient of protons used to produce ATP by ATP synthase. Subunit H is positioned mainly in the cytoplasm with one transmembrane alpha helix. Provides proton transfer pathway (water channels) connecting the terminal quinone electron acceptor of RC, to the aqueous phase. Found in photosynthetic bacteria: alpha, beta, and gamma proteobacteria.
Probab=30.16  E-value=34  Score=26.43  Aligned_cols=12  Identities=33%  Similarity=0.788  Sum_probs=9.1

Q ss_pred             hHHHHHHHHHhh
Q psy9766           3 RSVFWIFLSYCL   14 (97)
Q Consensus         3 ~~~~~~~~~~~~   14 (97)
                      -++|||||..++
T Consensus        17 l~~Fw~ffa~Li   28 (246)
T cd00226          17 IYAFWIFFAGLI   28 (246)
T ss_pred             HHHHHHHHHHHH
Confidence            478999886665


No 19 
>TIGR01150 puhA photosynthetic reaction center, subunit H, bacterial. This model describes the photosynthetic reaction center H subunit in non-oxygenic photosynthetic bacteria. The reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in the form of NADH. Ultimately, the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is an organic acid rather than water. Much of our current functional understanding of photosynthesis comes from the structural determination 
Probab=29.77  E-value=35  Score=26.48  Aligned_cols=12  Identities=42%  Similarity=0.844  Sum_probs=9.0

Q ss_pred             hHHHHHHHHHhh
Q psy9766           3 RSVFWIFLSYCL   14 (97)
Q Consensus         3 ~~~~~~~~~~~~   14 (97)
                      -++|||||..++
T Consensus        17 ly~FwiFFA~Li   28 (252)
T TIGR01150        17 IYAFWIFLAGLI   28 (252)
T ss_pred             HHHHHHHHHHHH
Confidence            478999886664


No 20 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=25.52  E-value=52  Score=19.05  Aligned_cols=14  Identities=21%  Similarity=0.306  Sum_probs=8.4

Q ss_pred             CchHHHHHHHHHhh
Q psy9766           1 MIRSVFWIFLSYCL   14 (97)
Q Consensus         1 ~~~~~~~~~~~~~~   14 (97)
                      |+|+.++++++++.
T Consensus         2 mk~t~l~i~~vll~   15 (44)
T COG5510           2 MKKTILLIALVLLA   15 (44)
T ss_pred             chHHHHHHHHHHHH
Confidence            67766666655543


No 21 
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=22.02  E-value=64  Score=23.46  Aligned_cols=15  Identities=20%  Similarity=0.372  Sum_probs=10.1

Q ss_pred             CchHHHHHHHHHhhc
Q psy9766           1 MIRSVFWIFLSYCLG   15 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (97)
                      |++.+++++++++.+
T Consensus         1 mk~i~~l~l~lll~~   15 (216)
T PF11153_consen    1 MKKILLLLLLLLLTG   15 (216)
T ss_pred             ChHHHHHHHHHHHHh
Confidence            888777776555544


No 22 
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
Probab=21.47  E-value=57  Score=25.74  Aligned_cols=13  Identities=31%  Similarity=0.984  Sum_probs=8.4

Q ss_pred             cCCcCCC-CCCCCC
Q psy9766          20 FSCVCNP-AECETL   32 (97)
Q Consensus        20 ~~C~C~~-~~Cp~~   32 (97)
                      ..|||.. +.|+|.
T Consensus        17 ~~c~~~~~~~~~p~   30 (358)
T cd02875          17 YECPCIEPELCEPI   30 (358)
T ss_pred             CCCCCCCHhhCCCc
Confidence            5698864 556654


No 23 
>PF06291 Lambda_Bor:  Bor protein;  InterPro: IPR010438 This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the E. coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis [].
Probab=20.62  E-value=83  Score=20.86  Aligned_cols=15  Identities=20%  Similarity=0.144  Sum_probs=11.3

Q ss_pred             CchHHHHHHHHHhhc
Q psy9766           1 MIRSVFWIFLSYCLG   15 (97)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (97)
                      |||.++..++++++.
T Consensus         1 mKk~ll~~~lallLt   15 (97)
T PF06291_consen    1 MKKLLLAAALALLLT   15 (97)
T ss_pred             CcHHHHHHHHHHHHc
Confidence            898888777776654


Done!