Diaphorina citri psyllid: psy9766


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MIRSVFWIFLSYCLGRSIAFSCVCNPAECETLTDDDCPDRAGTVWDPCGCCKVCARAENQPCGGPYGFFGSCAHDLECVVTDVTNENSGGVCTQEIM
cHHHHHHHHHHHHHHHccccccccccccccccccccccccccEECccccccHHHHcccccccccccccccccccccEEEEccccccccccCEEECcc
*IRSVFWIFLSYCLGRSIAFSCVCNPAECETLTDDDCPDRAGTVWDPCGCCKVCARAENQPCGGPYGFFGSCAHDLECVVTDVTNENSGGVCTQEIM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRSVFWIFLSYCLGRSIAFSCVCNPAECETLTDDDCPDRAGTVWDPCGCCKVCARAENQPCGGPYGFFGSCAHDLECVVTDVTNENSGGVCTQEIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0070011 [MF]peptidase activity, acting on L-amino acid peptidesprobableGO:0016787, GO:0008233, GO:0003674, GO:0003824
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TJQ, chain A
Confidence level:very confident
Coverage over the Query: 21-94
View the alignment between query and template
View the model in PyMOL