Diaphorina citri psyllid: psy9777


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MRQHMFTGYFGVHAALSLVKIINLRSWLELSSQLPCFKSGAATVQNLKNRFHMNLTEEQLQVLIDKLVDSSIHSLSTKLYDGFQYYTNGIL
cHHHHHHHHHHHHcHHcHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccc
MRQHMFTGYFGVHAALSLVKIINLRSWLELSSQLPCFKSGAATVQNLKNRFHMNLTEEQLQVLIDKLVDSSIHSLSTKLYDGFQYYTNGIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRQHMFTGYFGVHAALSLVKIINLRSWLELSSQLPCFKSGAATVQNLKNRFHMNLTEEQLQVLIDKLVDSSIHSLSTKLYDGFQYYTNGIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol 4-kinase beta Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation (By similarity). Involved in Golgi-to-plasma membrane trafficking.confidentB0KWC1
Phosphatidylinositol 4-kinase beta Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation (By similarity). Involved in Golgi-to-plasma membrane trafficking.confidentO02810
Phosphatidylinositol 4-kinase beta Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking.confidentO08561

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0004430 [MF]1-phosphatidylinositol 4-kinase activityprobableGO:0003824, GO:0052742, GO:0016772, GO:0016301, GO:0016773, GO:0016740, GO:0003674
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X6H, chain A
Confidence level:very confident
Coverage over the Query: 1-90
View the alignment between query and template
View the model in PyMOL